F450676

General Info

Members Datasets Scaffolds Average Seq Length
471 296 942 155

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0468335|Ga0501038_0468335_217_789
Length 190
Sequence MRAISGPLSRLGFMELARVVRNLSLSNPESSSSAMIWFFVVKYLHVVGAVVILGTGTGIAFFMLMAHRSGDSAYIARTAATVVVADMLFTATAVILQPITGAWLMWLSSITRVETWLAASLGLYVVAGLFWIPVVFMQVEMRDLARAADAQHRPLPLRYFVLFRRWFIFGIPGFGSVMAILWLMIAKPQL

Samples

Sample ID Description Type Environment
1 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
70 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
99 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
153 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
154 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
155 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
164 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
175 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
176 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
190 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
193 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
194 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
197 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
198 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
212 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
220 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
223 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
244 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
245 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
248 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
249 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
256 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
262 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
265 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
266 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
267 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
268 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
269 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
270 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
271 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
272 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
273 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
274 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
275 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
276 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
277 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
278 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
279 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
280 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
281 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
282 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
283 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
284 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
285 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
286 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
287 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
288 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
289 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
290 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
291 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
292 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
293 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
294 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
295 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
296 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.77
Nodule 1.7
Rhizoplane 10.62
Rhizosphere 65.82
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501038_0468335 3300049574 Unclassified 967
2 JGI24742J22300_10026646 3300002244 Bacteria 1000
3 JGI25153J46596_10001817 3300003215 Bacteria 12646
4 JGI25160J50197_1004970 3300003354 Bacteria 5643
5 Ga0055542_1009281 3300003762 Bacteria 1865
6 Ga0070658_10042636 3300005327 Bacteria 3665
7 Ga0070676_10814688 3300005328 Bacteria 690
8 Ga0070683_100246386 3300005329 Bacteria 1700
9 Ga0070690_100983441 3300005330 Bacteria 664
10 Ga0070670_100716912 3300005331 Bacteria 900
11 Ga0070666_10224342 3300005335 Bacteria 1326
12 Ga0070682_100984567 3300005337 Bacteria 699
13 Ga0068868_100026570 3300005338 Bacteria 4413
14 Ga0068868_100369071 3300005338 Bacteria 1233
15 Ga0070660_100124048 3300005339 Bacteria 2063
16 Ga0070660_100217128 3300005339 Bacteria 1553
17 Ga0070660_100628357 3300005339 Bacteria 899
18 Ga0070689_101064919 3300005340 Bacteria 722
19 Ga0070661_100019746 3300005344 Bacteria 4802
20 Ga0070661_100088768 3300005344 Bacteria 2289
21 Ga0070692_10093065 3300005345 Bacteria 1641
22 Ga0070668_100148366 3300005347 Bacteria 1894
23 Ga0070668_100700083 3300005347 Bacteria 893
24 Ga0070669_100103680 3300005353 Bacteria 2149
25 Ga0070669_100284067 3300005353 Bacteria 1327
26 Ga0070673_100939578 3300005364 Bacteria 803
27 Ga0070659_100687166 3300005366 Bacteria 884
28 Ga0070659_101186400 3300005366 Bacteria 675
29 Ga0070667_100118667 3300005367 Bacteria 2299
30 Ga0070710_10416692 3300005437 Bacteria 904
31 Ga0070700_100298167 3300005441 Bacteria 1175
32 Ga0070663_100038050 3300005455 Bacteria 3353
33 Ga0070663_100067133 3300005455 Bacteria 2601
34 Ga0070663_100083860 3300005455 Bacteria 2348
35 Ga0070678_100061221 3300005456 Bacteria 2774
36 Ga0070678_100091144 3300005456 Bacteria 2339
37 Ga0070678_100288290 3300005456 Bacteria 1391
38 Ga0070662_100252749 3300005457 Bacteria 1418
39 Ga0070681_10680085 3300005458 Bacteria 944
40 Ga0068867_100174577 3300005459 Bacteria 1704
41 Ga0070685_10097717 3300005466 Bacteria 1788
42 Ga0070706_100213771 3300005467 Bacteria 1800
43 Ga0070698_100153847 3300005471 Bacteria 2246
44 Ga0070679_100122418 3300005530 Bacteria 2585
45 Ga0070679_100607297 3300005530 Bacteria 1037
46 Ga0070684_100148682 3300005535 Bacteria 2121
47 Ga0070684_100352584 3300005535 Bacteria 1354
48 Ga0070697_100378352 3300005536 Bacteria 1226
49 Ga0068853_100212816 3300005539 Bacteria 1762
50 Ga0068853_100502508 3300005539 Bacteria 1145
51 Ga0070672_100125245 3300005543 Bacteria 2107
52 Ga0070672_100424113 3300005543 Bacteria 1143
53 Ga0070686_100081777 3300005544 Bacteria 2141
54 Ga0070665_100166813 3300005548 Bacteria 2204
55 Ga0070665_100225223 3300005548 Bacteria 1875
56 Ga0068855_100453562 3300005563 Bacteria 1399
57 Ga0068855_100772458 3300005563 Bacteria 1023
58 Ga0070664_100518719 3300005564 Bacteria 1100
59 Ga0070664_101064820 3300005564 Bacteria 761
60 Ga0068857_100042105 3300005577 Bacteria 4050
61 Ga0068857_100111902 3300005577 Bacteria 2455
62 Ga0068854_100239340 3300005578 Bacteria 1444
63 Ga0068856_102128524 3300005614 Bacteria 570
64 Ga0070702_100059143 3300005615 Bacteria 2223
65 Ga0068852_100060160 3300005616 Bacteria 3297
66 Ga0068852_100154455 3300005616 Bacteria 2137
67 Ga0068852_100437279 3300005616 Bacteria 1293
68 Ga0068852_100490570 3300005616 Bacteria 1222
69 Ga0068864_100099893 3300005618 Bacteria 2571
70 Ga0068866_10123645 3300005718 Bacteria 1462
71 Ga0068861_100071784 3300005719 Bacteria 2684
72 Ga0068851_10474413 3300005834 Bacteria 747
73 Ga0068863_100050335 3300005841 Bacteria 3949
74 Ga0068863_100834914 3300005841 Bacteria 920
75 Ga0068858_100599462 3300005842 Bacteria 1068
76 Ga0068860_100013777 3300005843 Bacteria 7928
77 Ga0068860_100075655 3300005843 Bacteria 3202
78 Ga0068860_101969189 3300005843 Bacteria 606
79 Ga0068862_101221118 3300005844 Bacteria 751
80 Ga0081540_1056227 3300005983 Bacteria 1911
81 Ga0075365_10051816 3300006038 Bacteria 2712
82 Ga0075365_10221836 3300006038 Bacteria 1326
83 Ga0075368_10200275 3300006042 Bacteria 845
84 Ga0075368_10292418 3300006042 Bacteria 702
85 Ga0075363_100078972 3300006048 Bacteria 1797
86 Ga0075364_10384816 3300006051 Bacteria 957
87 Ga0075364_10538702 3300006051 Bacteria 798
88 Ga0070716_101049562 3300006173 Bacteria 647
89 Ga0070712_101369806 3300006175 Bacteria 617
90 Ga0075367_10022518 3300006178 Bacteria 3535
91 Ga0075369_10007655 3300006186 Bacteria 4126
92 Ga0075366_10336117 3300006195 Bacteria 926
93 Ga0097621_100482259 3300006237 Bacteria 1121
94 Ga0075370_10119323 3300006353 Bacteria 1534
95 Ga0075428_101478971 3300006844 Bacteria 712
96 Ga0068865_100136750 3300006881 Bacteria 1843
97 Ga0099825_1022278 3300006941 Bacteria 4122
98 Ga0099823_1052736 3300006944 Bacteria 2413
99 Ga0099795_10241677 3300007788 Bacteria 775
100 Ga0105240_10022674 3300009093 Bacteria 8318
101 Ga0105240_10035222 3300009093 Bacteria 6453
102 Ga0105240_10211606 3300009093 Bacteria 2265
103 Ga0105245_10537651 3300009098 Bacteria 1189
104 Ga0105245_10970585 3300009098 Bacteria 893
105 Ga0105247_10255979 3300009101 Bacteria 1198
106 Ga0105247_10289237 3300009101 Bacteria 1133
107 Ga0105243_10123694 3300009148 Bacteria 2185
108 Ga0105241_10052443 3300009174 Bacteria 3114
109 Ga0105242_10360619 3300009176 Bacteria 1345
110 Ga0105242_10369049 3300009176 Bacteria 1331
111 Ga0105242_11876096 3300009176 Bacteria 639
112 Ga0105248_10165974 3300009177 Bacteria 2489
113 Ga0105248_10224779 3300009177 Bacteria 2113
114 Ga0105248_10942837 3300009177 Bacteria 975
115 Ga0105237_10007349 3300009545 Bacteria 12073
116 Ga0105237_10229541 3300009545 Bacteria 1857
117 Ga0105237_10813793 3300009545 Bacteria 941
118 Ga0105238_10052679 3300009551 Bacteria 4090
119 Ga0099796_10084105 3300010159 Bacteria 1172
120 Ga0105239_10074689 3300010375 Bacteria 3727
121 Ga0105239_10121848 3300010375 Bacteria 2897
122 Ga0105239_10131807 3300010375 Bacteria 2781
123 Ga0105239_10157338 3300010375 Bacteria 2538
124 Ga0105239_10189605 3300010375 Bacteria 2302
125 Ga0105239_10265335 3300010375 Bacteria 1930
126 Ga0105239_10277620 3300010375 Bacteria 1886
127 Ga0105246_10019599 3300011119 Bacteria 4326
128 Ga0105246_10044908 3300011119 Bacteria 3005
129 Ga0105246_10225818 3300011119 Bacteria 1471
130 Ga0157369_10005855 3300013105 Bacteria 14284
131 Ga0157369_10034938 3300013105 Bacteria 5513
132 Ga0157374_10124093 3300013296 Bacteria 2495
133 Ga0157378_10126933 3300013297 Bacteria 2357
134 Ga0163162_10774164 3300013306 Bacteria 1078
135 Ga0163162_11600677 3300013306 Bacteria 743
136 Ga0157372_10609977 3300013307 Bacteria 1272
137 Ga0157372_10691059 3300013307 Bacteria 1187
138 Ga0157372_10718634 3300013307 Bacteria 1162
139 Ga0157375_10172799 3300013308 Bacteria 2309
140 Ga0157375_11679217 3300013308 Bacteria 752
141 Ga0163163_10101301 3300014325 Bacteria 2902
142 Ga0163163_10579226 3300014325 Bacteria 1185
143 Ga0163163_10922164 3300014325 Bacteria 937
144 Ga0157380_10437491 3300014326 Bacteria 1252
145 Ga0157377_10434172 3300014745 Bacteria 903
146 Ga0157379_10034672 3300014968 Bacteria 4500
147 Ga0157379_10075490 3300014968 Bacteria 3018
148 Ga0157379_10930802 3300014968 Bacteria 826
149 Ga0157379_11065139 3300014968 Bacteria 773
150 Ga0157376_10630855 3300014969 Bacteria 1070
151 Ga0163161_10032768 3300017792 Bacteria 3712
152 Ga0163161_10201152 3300017792 Bacteria 1535
153 Ga0163161_10656104 3300017792 Bacteria 870
154 Ga0214544_1022172 3300021320 Bacteria 3917
155 Ga0209148_1000504 3300025254 Bacteria 39653
156 Ga0209233_1023745 3300025261 Bacteria 1547
157 Ga0209455_1014302 3300025272 Bacteria 1801
158 Ga0209758_1000397 3300025297 Bacteria 75408
159 Ga0209758_1012427 3300025297 Bacteria 4766
160 Ga0209758_1046781 3300025297 Bacteria 1555
161 Ga0209256_1039131 3300025299 Bacteria 1222
162 Ga0207426_1004559 3300025302 Bacteria 6697
163 Ga0207697_10029371 3300025315 Bacteria 2250
164 Ga0207656_10538637 3300025321 Bacteria 594
165 Ga0207692_10260732 3300025898 Bacteria 1042
166 Ga0207642_10015129 3300025899 Bacteria 2866
167 Ga0207688_10018007 3300025901 Bacteria 3844
168 Ga0207688_10032608 3300025901 Bacteria 2880
169 Ga0207688_10049809 3300025901 Bacteria 2342
170 Ga0207688_10686322 3300025901 Bacteria 647
171 Ga0207647_10028494 3300025904 Bacteria 3625
172 Ga0207647_10130072 3300025904 Bacteria 1480
173 Ga0207699_10549739 3300025906 Bacteria 837
174 Ga0207645_10110455 3300025907 Bacteria 1780
175 Ga0207643_10463107 3300025908 Bacteria 808
176 Ga0207705_10759756 3300025909 Bacteria 753
177 Ga0207707_10030011 3300025912 Bacteria 4753
178 Ga0207695_10089410 3300025913 Bacteria 3097
179 Ga0207695_10364268 3300025913 Bacteria 1332
180 Ga0207671_10087876 3300025914 Bacteria 2338
181 Ga0207671_10183995 3300025914 Bacteria 1627
182 Ga0207671_10705974 3300025914 Bacteria 802
183 Ga0207693_10435983 3300025915 Bacteria 1024
184 Ga0207660_10002970 3300025917 Bacteria 11091
185 Ga0207657_10086589 3300025919 Bacteria 2622
186 Ga0207657_10090259 3300025919 Bacteria 2558
187 Ga0207657_10174026 3300025919 Bacteria 1743
188 Ga0207649_10040141 3300025920 Bacteria 2843
189 Ga0207652_10006476 3300025921 Bacteria 9441
190 Ga0207652_10200488 3300025921 Bacteria 1796
191 Ga0207681_10083858 3300025923 Bacteria 2257
192 Ga0207694_10067793 3300025924 Bacteria 2785
193 Ga0207694_10621508 3300025924 Bacteria 909
194 Ga0207687_10056909 3300025927 Bacteria 2744
195 Ga0207687_10702019 3300025927 Bacteria 859
196 Ga0207644_10056718 3300025931 Bacteria 2827
197 Ga0207690_10180002 3300025932 Bacteria 1591
198 Ga0207690_10238235 3300025932 Bacteria 1400
199 Ga0207706_10154681 3300025933 Bacteria 2017
200 Ga0207706_10168978 3300025933 Bacteria 1922
201 Ga0207709_10019822 3300025935 Bacteria 3786
202 Ga0207669_10086036 3300025937 Bacteria 2031
203 Ga0207669_10972288 3300025937 Bacteria 712
204 Ga0207704_10034064 3300025938 Bacteria 2903
205 Ga0207704_10074464 3300025938 Bacteria 2167
206 Ga0207704_10284265 3300025938 Bacteria 1259
207 Ga0207665_10919438 3300025939 Bacteria 694
208 Ga0207691_10024973 3300025940 Bacteria 5615
209 Ga0207691_10242946 3300025940 Bacteria 1556
210 Ga0207711_10160949 3300025941 Bacteria 2032
211 Ga0207711_10418556 3300025941 Bacteria 1246
212 Ga0207689_10180084 3300025942 Bacteria 1743
213 Ga0207661_10521936 3300025944 Bacteria 1086
214 Ga0207661_11003334 3300025944 Bacteria 769
215 Ga0207679_10273906 3300025945 Bacteria 1444
216 Ga0207679_11666532 3300025945 Bacteria 584
217 Ga0207667_10208015 3300025949 Bacteria 2006
218 Ga0207667_10663473 3300025949 Bacteria 1048
219 Ga0207712_10379438 3300025961 Bacteria 1183
220 Ga0207668_10038744 3300025972 Bacteria 3202
221 Ga0207668_10072864 3300025972 Bacteria 2459
222 Ga0207668_10121421 3300025972 Bacteria 1979
223 Ga0207668_10344712 3300025972 Bacteria 1244
224 Ga0207658_10452146 3300025986 Bacteria 1137
225 Ga0207677_10006245 3300026023 Bacteria 6516
226 Ga0207677_10253439 3300026023 Bacteria 1431
227 Ga0207703_10386221 3300026035 Bacteria 1296
228 Ga0207703_10566306 3300026035 Bacteria 1072
229 Ga0207639_10680479 3300026041 Bacteria 953
230 Ga0207639_11035542 3300026041 Bacteria 769
231 Ga0207678_10025996 3300026067 Bacteria 5108
232 Ga0207678_10057202 3300026067 Bacteria 3355
233 Ga0207678_10267875 3300026067 Bacteria 1464
234 Ga0207708_10329303 3300026075 Bacteria 1248
235 Ga0207702_10034178 3300026078 Bacteria 4250
236 Ga0207702_10057327 3300026078 Bacteria 3310
237 Ga0207641_10102844 3300026088 Bacteria 2520
238 Ga0207648_10178981 3300026089 Bacteria 1876
239 Ga0207674_10036205 3300026116 Bacteria 5145
240 Ga0207674_10370101 3300026116 Bacteria 1385
241 Ga0207674_10569388 3300026116 Bacteria 1094
242 Ga0207674_11384409 3300026116 Bacteria 673
243 Ga0207675_100119359 3300026118 Bacteria 2494
244 Ga0207683_10064685 3300026121 Bacteria 3223
245 Ga0207683_10195472 3300026121 Bacteria 1838
246 Ga0207698_10054364 3300026142 Bacteria 3080
247 Ga0207698_10096476 3300026142 Bacteria 2437
248 Ga0207698_10517714 3300026142 Bacteria 1164
249 Ga0207698_10957333 3300026142 Bacteria 865
250 Ga0209389_1000071 3300027296 Bacteria 97411
251 Ga0209489_101361 3300027361 Bacteria 50193
252 Ga0209700_100011 3300027363 Bacteria 362159
253 Ga0209813_10059370 3300027866 Bacteria 1217
254 Ga0268266_10030997 3300028379 Bacteria 4541
255 Ga0268266_10085679 3300028379 Bacteria 2753
256 Ga0268266_10087698 3300028379 Bacteria 2723
257 Ga0268266_10901834 3300028379 Bacteria 855
258 Ga0268265_10072600 3300028380 Bacteria 2685
259 Ga0268265_10646713 3300028380 Bacteria 1016
260 Ga0268264_10000062 3300028381 Bacteria 302110
261 Ga0268264_10071734 3300028381 Bacteria 2935
262 Ga0307509_10013347 3300031507 Bacteria 9734
263 Ga0307508_10466591 3300031616 Bacteria 856
264 Ga0265314_10130427 3300031711 Bacteria 1569
265 Ga0307516_10076687 3300031730 Bacteria 3194
266 Ga0373926_0082136 3300035083 Bacteria 1193
267 Ga0373923_0459054 3300035111 Bacteria 618
268 Ga0373936_0076957 3300035113 Bacteria 1384
269 Ga0373941_0116719 3300035115 Bacteria 947
270 Ga0373962_0038138 3300035242 Bacteria 1344
271 Ga0373933_0006512 3300035724 Bacteria 6359
272 Ga0395900_0262484 3300037418 Bacteria 1724
273 Ga0395898_0050553 3300037466 Bacteria 4068
274 Ga0395905_0143767 3300037471 Bacteria 2244
275 Ga0395905_1513592 3300037471 Bacteria 575
276 Ga0395901_0387429 3300038443 Bacteria 1438
277 Ga0436365_0036157 3300039437 Bacteria 929
278 Ga0436365_0106947 3300039437 Bacteria 1002
279 Ga0436365_0644864 3300039437 Bacteria 733
280 Ga0436362_1007897 3300039453 Bacteria 632
281 Ga0451841_0162938 3300041498 Bacteria 1716
282 Ga0451855_0221263 3300041511 Bacteria 640
283 Ga0466965_0040955 3300044683 Bacteria 2281
284 Ga0466961_0218995 3300044693 Bacteria 1174
285 Ga0466963_0134129 3300044694 Bacteria 1712
286 Ga0466957_0052470 3300044842 Bacteria 2483
287 Ga0466957_0060530 3300044842 Bacteria 2322
288 Ga0466959_0100560 3300045049 Bacteria 2070
289 Ga0466967_0034220 3300045976 Bacteria 4310
290 Ga0466967_1970854 3300045976 Bacteria 581
291 Ga0495592_0011628 3300046454 Bacteria 6666
292 Ga0495603_0385892 3300046455 Bacteria 803
293 Ga0495591_114503 3300046458 Bacteria 661
294 Ga0495651_0165896 3300046462 Bacteria 1577
295 Ga0495653_0889228 3300046463 Bacteria 531
296 Ga0495639_0498669 3300046475 Bacteria 621
297 Ga0495584_0084482 3300046491 Bacteria 1599
298 Ga0495584_0145465 3300046491 Bacteria 1204
299 Ga0495585_0206801 3300046492 Bacteria 997
300 Ga0495585_0407678 3300046492 Bacteria 654
301 Ga0495606_0046061 3300046507 Bacteria 2885
302 Ga0495606_0066349 3300046507 Bacteria 2289
303 Ga0495610_0081754 3300046512 Bacteria 1482
304 Ga0495616_0020973 3300046513 Bacteria 3547
305 Ga0495620_0055629 3300046515 Bacteria 1667
306 Ga0495628_0173443 3300046516 Bacteria 1634
307 Ga0495631_0101687 3300046518 Bacteria 1237
308 Ga0495637_0208783 3300046520 Bacteria 715
309 Ga0495643_0007658 3300046522 Bacteria 6927
310 Ga0495587_0222466 3300046536 Bacteria 1064
311 Ga0495621_0025226 3300046539 Bacteria 1995
312 Ga0495597_0019791 3300046542 Bacteria 3143
313 Ga0495645_0067616 3300046543 Bacteria 2580
314 Ga0495656_0002383 3300046615 Bacteria 6229
315 Ga0495656_0070043 3300046615 Bacteria 1555
316 Ga0495668_0054837 3300046616 Bacteria 2202
317 Ga0495661_0282626 3300046665 Bacteria 836
318 Ga0495657_0006376 3300046675 Bacteria 9236
319 Ga0495599_0037473 3300046678 Bacteria 3046
320 Ga0495623_0220071 3300046679 Bacteria 1082
321 Ga0495646_0052311 3300046680 Bacteria 2468
322 Ga0495669_0005989 3300046684 Bacteria 5069
323 Ga0495669_0533942 3300046684 Bacteria 571
324 Ga0495589_0086923 3300046794 Bacteria 1518
325 Ga0495660_0274285 3300046810 Bacteria 774
326 Ga0495581_0213202 3300047315 Bacteria 1129
327 Ga0495604_0018467 3300047317 Bacteria 5584
328 Ga0495604_0104405 3300047317 Bacteria 2077
329 Ga0495636_0106211 3300047318 Bacteria 1232
330 Ga0495674_0023946 3300047319 Bacteria 5618
331 Ga0495674_0375663 3300047319 Bacteria 1151
332 Ga0495676_1071430 3300047321 Bacteria 513
333 Ga0495680_0009568 3300047322 Bacteria 8708
334 Ga0495683_0120890 3300047323 Bacteria 1243
335 Ga0495687_121421 3300047443 Bacteria 942
336 Ga0495675_0001990 3300047444 Bacteria 12202
337 Ga0495677_0081899 3300047445 Bacteria 1210
338 Ga0495673_0012406 3300047469 Bacteria 4522
339 Ga0495602_0025242 3300048088 Bacteria 5752
340 Ga0495602_0426142 3300048088 Bacteria 941
341 Ga0495626_0196432 3300048091 Bacteria 829
342 Ga0496100_0046211 3300048903 Bacteria 2798
343 Ga0496100_0506398 3300048903 Bacteria 931
344 Ga0496100_0613545 3300048903 Bacteria 845
345 Ga0496101_0006357 3300048904 Bacteria 7606
346 Ga0496101_0097485 3300048904 Bacteria 2196
347 Ga0496101_0602812 3300048904 Bacteria 868
348 Ga0496102_0008883 3300048905 Bacteria 8624
349 Ga0496102_0442016 3300048905 Bacteria 1220
350 Ga0496102_0469504 3300048905 Bacteria 1179
351 Ga0496102_0553166 3300048905 Bacteria 1073
352 Ga0496102_0748930 3300048905 Bacteria 900
353 Ga0496103_0056066 3300048906 Bacteria 2445
354 Ga0496104_0022512 3300048907 Bacteria 5788
355 Ga0496104_0032686 3300048907 Bacteria 4843
356 Ga0496104_0380298 3300048907 Bacteria 1324
357 Ga0496105_0056016 3300048908 Bacteria 3255
358 Ga0496105_0178821 3300048908 Bacteria 1737
359 Ga0496105_0213427 3300048908 Bacteria 1572
360 Ga0496106_0817185 3300048909 Bacteria 739
361 Ga0496106_1144503 3300048909 Bacteria 608
362 Ga0496107_0010867 3300048910 Bacteria 6334
363 Ga0496107_0093745 3300048910 Bacteria 2196
364 Ga0496107_0361032 3300048910 Bacteria 1081
365 Ga0496107_0404270 3300048910 Bacteria 1015
366 Ga0496108_0097054 3300048911 Bacteria 2511
367 Ga0496108_0132595 3300048911 Bacteria 2141
368 Ga0496108_0177150 3300048911 Bacteria 1846
369 Ga0496108_0479952 3300048911 Bacteria 1086
370 Ga0496108_0942457 3300048911 Bacteria 739
371 Ga0496109_0036252 3300048912 Bacteria 4452
372 Ga0496109_0057065 3300048912 Bacteria 3563
373 Ga0496109_0148019 3300048912 Bacteria 2197
374 Ga0496109_0257642 3300048912 Bacteria 1643
375 Ga0496110_0073782 3300048913 Bacteria 3028
376 Ga0496110_0096965 3300048913 Bacteria 2642
377 Ga0496110_0788208 3300048913 Bacteria 854
378 Ga0496111_0787791 3300048914 Bacteria 688
379 Ga0496112_0059641 3300048915 Bacteria 3760
380 Ga0496112_0089722 3300048915 Bacteria 3042
381 Ga0496112_0111781 3300048915 Bacteria 2701
382 Ga0496113_0056130 3300048916 Bacteria 2955
383 Ga0496113_0094797 3300048916 Bacteria 2306
384 Ga0496113_0119486 3300048916 Bacteria 2059
385 Ga0496114_0018066 3300048917 Bacteria 5698
386 Ga0496114_0068067 3300048917 Bacteria 2988
387 Ga0496114_0208339 3300048917 Bacteria 1714
388 Ga0496114_0789993 3300048917 Bacteria 828
389 Ga0496115_0005876 3300048918 Bacteria 8943
390 Ga0496115_0051866 3300048918 Bacteria 3289
391 Ga0496115_0595314 3300048918 Bacteria 880
392 Ga0496117_0089425 3300048920 Bacteria 1989
393 Ga0496117_0486455 3300048920 Bacteria 602
394 Ga0496118_0114755 3300048921 Bacteria 1775
395 Ga0496119_0193380 3300048922 Bacteria 1058
396 Ga0496119_0286540 3300048922 Bacteria 817
397 Ga0496120_0192072 3300048923 Bacteria 995
398 Ga0496121_0461794 3300048924 Bacteria 816
399 Ga0496122_0108668 3300048925 Bacteria 1829
400 Ga0496123_0129564 3300048926 Bacteria 1401
401 Ga0496124_0088048 3300048927 Bacteria 2539
402 Ga0496125_0000406 3300048928 Bacteria 80645
403 Ga0496125_0110895 3300048928 Bacteria 1987
404 Ga0496126_0006203 3300048929 Bacteria 13374
405 Ga0496126_0196194 3300048929 Bacteria 1707
406 Ga0496126_0412291 3300048929 Bacteria 1094
407 Ga0496126_0525813 3300048929 Bacteria 942
408 Ga0495682_0184062 3300049460 Bacteria 742
409 Ga0501036_0520952 3300049572 Bacteria 989
410 Ga0501044_1336491 3300049823 Bacteria 583
411 nmdc:mga00v17_329433_c1 3300050491 Bacteria 992
412 nmdc:mga0yw44_208388_c1 3300050492 Bacteria 1293
413 nmdc:mga0yw44_218144_c1 3300050492 Bacteria 1263
414 nmdc:mga0yw44_253640_c2 3300050492 Bacteria 808
415 nmdc:mga0k408_25821_c1 3300050493 Bacteria 3329
416 nmdc:mga0k408_273286_c1 3300050493 Bacteria 1009
417 nmdc:mga06z11_88739_c1 3300050494 Bacteria 1675
418 nmdc:mga04h51_269668_c1 3300050495 Bacteria 687
419 nmdc:mga07m45_26301_c1 3300050496 Bacteria 3198
420 nmdc:mga07m45_27519_c2 3300050496 Bacteria 2425
421 nmdc:mga07m45_334605_c1 3300050496 Bacteria 880
422 Ga0500635_0065717 3300053080 Bacteria 1276
423 Ga0500635_0129699 3300053080 Bacteria 950
424 Ga0495595_0096068 3300053084 Bacteria 1426
425 Ga0495619_0120492 3300053085 Bacteria 1799
426 Ga0500647_0013581 3300053091 Bacteria 3685
427 Ga0500651_0002919 3300053093 Bacteria 9190
428 Ga0500651_0103520 3300053093 Bacteria 1743
429 Ga0500566_0000649 3300053094 Bacteria 19469
430 Ga0500566_0087986 3300053094 Bacteria 1720
431 Ga0500566_0481873 3300053094 Bacteria 537
432 Ga0500640_114548 3300053095 Bacteria 1091
433 Ga0500640_169523 3300053095 Bacteria 807
434 Ga0500554_007074 3300053102 Bacteria 2561
435 Ga0500557_000059 3300053105 Bacteria 45905
436 Ga0500569_001483 3300053109 Bacteria 4443
437 Ga0500572_021497 3300053111 Bacteria 1709
438 Ga0500572_065239 3300053111 Bacteria 1114
439 Ga0500591_177274 3300053115 Bacteria 777
440 Ga0500595_000434 3300053119 Bacteria 26047
441 Ga0500595_001755 3300053119 Bacteria 11291
442 Ga0500614_025785 3300053123 Bacteria 1400
443 Ga0500614_108688 3300053123 Bacteria 806
444 Ga0500642_0000198 3300053130 Bacteria 24594
445 Ga0500642_0011489 3300053130 Bacteria 3169
446 Ga0500658_0093320 3300053134 Bacteria 1305
447 Ga0500559_0019181 3300053136 Bacteria 2890
448 Ga0500559_0193400 3300053136 Bacteria 959
449 Ga0500577_0016351 3300053142 Bacteria 2337
450 Ga0500590_067548 3300053148 Bacteria 1784
451 Ga0500590_186243 3300053148 Bacteria 895
452 Ga0500603_014473 3300053150 Bacteria 1843
453 Ga0500619_079060 3300053154 Bacteria 1102
454 Ga0500620_061243 3300053155 Bacteria 1281
455 Ga0500630_107056 3300053159 Bacteria 1263
456 Ga0500638_010369 3300053162 Bacteria 4078
457 Ga0500638_072961 3300053162 Bacteria 1639
458 Ga0500639_017821 3300053163 Bacteria 3747
459 Ga0500636_0418565 3300053177 Bacteria 616
460 Ga0500636_0439103 3300053177 Bacteria 594
461 Ga0500637_0000350 3300053178 Bacteria 17499
462 Ga0500637_0458293 3300053178 Bacteria 644
463 Ga0500576_149692 3300053725 Bacteria 874
464 Ga0500625_010358 3300053729 Bacteria 4190
465 Ga0500609_010113 3300053731 Bacteria 1270
466 Ga0500596_000269 3300053735 Bacteria 9174
467 Ga0500601_000461 3300053737 Bacteria 6575
468 Ga0500661_002975 3300055283 Bacteria 3183
469 Ga0466962_0042204 3300061719 Bacteria 2183
470 2879128393 2879127579 Bacteria 8294491
471 2879143662 2879142872 Bacteria 8267021
472 Ga0501038_0468335
473 JGI24742J22300_10026646
474 JGI25153J46596_10001817
475 JGI25160J50197_1004970
476 Ga0055542_1009281
477 Ga0070658_10042636
478 Ga0070676_10814688
479 Ga0070683_100246386
480 Ga0070690_100983441
481 Ga0070670_100716912
482 Ga0070666_10224342
483 Ga0070682_100984567
484 Ga0068868_100026570
485 Ga0068868_100369071
486 Ga0070660_100124048
487 Ga0070660_100217128
488 Ga0070660_100628357
489 Ga0070689_101064919
490 Ga0070661_100019746
491 Ga0070661_100088768
492 Ga0070692_10093065
493 Ga0070668_100148366
494 Ga0070668_100700083
495 Ga0070669_100103680
496 Ga0070669_100284067
497 Ga0070673_100939578
498 Ga0070659_100687166
499 Ga0070659_101186400
500 Ga0070667_100118667
501 Ga0070710_10416692
502 Ga0070700_100298167
503 Ga0070663_100038050
504 Ga0070663_100067133
505 Ga0070663_100083860
506 Ga0070678_100061221
507 Ga0070678_100091144
508 Ga0070678_100288290
509 Ga0070662_100252749
510 Ga0070681_10680085
511 Ga0068867_100174577
512 Ga0070685_10097717
513 Ga0070706_100213771
514 Ga0070698_100153847
515 Ga0070679_100122418
516 Ga0070679_100607297
517 Ga0070684_100148682
518 Ga0070684_100352584
519 Ga0070697_100378352
520 Ga0068853_100212816
521 Ga0068853_100502508
522 Ga0070672_100125245
523 Ga0070672_100424113
524 Ga0070686_100081777
525 Ga0070665_100166813
526 Ga0070665_100225223
527 Ga0068855_100453562
528 Ga0068855_100772458
529 Ga0070664_100518719
530 Ga0070664_101064820
531 Ga0068857_100042105
532 Ga0068857_100111902
533 Ga0068854_100239340
534 Ga0068856_102128524
535 Ga0070702_100059143
536 Ga0068852_100060160
537 Ga0068852_100154455
538 Ga0068852_100437279
539 Ga0068852_100490570
540 Ga0068864_100099893
541 Ga0068866_10123645
542 Ga0068861_100071784
543 Ga0068851_10474413
544 Ga0068863_100050335
545 Ga0068863_100834914
546 Ga0068858_100599462
547 Ga0068860_100013777
548 Ga0068860_100075655
549 Ga0068860_101969189
550 Ga0068862_101221118
551 Ga0081540_1056227
552 Ga0075365_10051816
553 Ga0075365_10221836
554 Ga0075368_10200275
555 Ga0075368_10292418
556 Ga0075363_100078972
557 Ga0075364_10384816
558 Ga0075364_10538702
559 Ga0070716_101049562
560 Ga0070712_101369806
561 Ga0075367_10022518
562 Ga0075369_10007655
563 Ga0075366_10336117
564 Ga0097621_100482259
565 Ga0075370_10119323
566 Ga0075428_101478971
567 Ga0068865_100136750
568 Ga0099825_1022278
569 Ga0099823_1052736
570 Ga0099795_10241677
571 Ga0105240_10022674
572 Ga0105240_10035222
573 Ga0105240_10211606
574 Ga0105245_10537651
575 Ga0105245_10970585
576 Ga0105247_10255979
577 Ga0105247_10289237
578 Ga0105243_10123694
579 Ga0105241_10052443
580 Ga0105242_10360619
581 Ga0105242_10369049
582 Ga0105242_11876096
583 Ga0105248_10165974
584 Ga0105248_10224779
585 Ga0105248_10942837
586 Ga0105237_10007349
587 Ga0105237_10229541
588 Ga0105237_10813793
589 Ga0105238_10052679
590 Ga0099796_10084105
591 Ga0105239_10074689
592 Ga0105239_10121848
593 Ga0105239_10131807
594 Ga0105239_10157338
595 Ga0105239_10189605
596 Ga0105239_10265335
597 Ga0105239_10277620
598 Ga0105246_10019599
599 Ga0105246_10044908
600 Ga0105246_10225818
601 Ga0157369_10005855
602 Ga0157369_10034938
603 Ga0157374_10124093
604 Ga0157378_10126933
605 Ga0163162_10774164
606 Ga0163162_11600677
607 Ga0157372_10609977
608 Ga0157372_10691059
609 Ga0157372_10718634
610 Ga0157375_10172799
611 Ga0157375_11679217
612 Ga0163163_10101301
613 Ga0163163_10579226
614 Ga0163163_10922164
615 Ga0157380_10437491
616 Ga0157377_10434172
617 Ga0157379_10034672
618 Ga0157379_10075490
619 Ga0157379_10930802
620 Ga0157379_11065139
621 Ga0157376_10630855
622 Ga0163161_10032768
623 Ga0163161_10201152
624 Ga0163161_10656104
625 Ga0214544_1022172
626 Ga0209148_1000504
627 Ga0209233_1023745
628 Ga0209455_1014302
629 Ga0209758_1000397
630 Ga0209758_1012427
631 Ga0209758_1046781
632 Ga0209256_1039131
633 Ga0207426_1004559
634 Ga0207697_10029371
635 Ga0207656_10538637
636 Ga0207692_10260732
637 Ga0207642_10015129
638 Ga0207688_10018007
639 Ga0207688_10032608
640 Ga0207688_10049809
641 Ga0207688_10686322
642 Ga0207647_10028494
643 Ga0207647_10130072
644 Ga0207699_10549739
645 Ga0207645_10110455
646 Ga0207643_10463107
647 Ga0207705_10759756
648 Ga0207707_10030011
649 Ga0207695_10089410
650 Ga0207695_10364268
651 Ga0207671_10087876
652 Ga0207671_10183995
653 Ga0207671_10705974
654 Ga0207693_10435983
655 Ga0207660_10002970
656 Ga0207657_10086589
657 Ga0207657_10090259
658 Ga0207657_10174026
659 Ga0207649_10040141
660 Ga0207652_10006476
661 Ga0207652_10200488
662 Ga0207681_10083858
663 Ga0207694_10067793
664 Ga0207694_10621508
665 Ga0207687_10056909
666 Ga0207687_10702019
667 Ga0207644_10056718
668 Ga0207690_10180002
669 Ga0207690_10238235
670 Ga0207706_10154681
671 Ga0207706_10168978
672 Ga0207709_10019822
673 Ga0207669_10086036
674 Ga0207669_10972288
675 Ga0207704_10034064
676 Ga0207704_10074464
677 Ga0207704_10284265
678 Ga0207665_10919438
679 Ga0207691_10024973
680 Ga0207691_10242946
681 Ga0207711_10160949
682 Ga0207711_10418556
683 Ga0207689_10180084
684 Ga0207661_10521936
685 Ga0207661_11003334
686 Ga0207679_10273906
687 Ga0207679_11666532
688 Ga0207667_10208015
689 Ga0207667_10663473
690 Ga0207712_10379438
691 Ga0207668_10038744
692 Ga0207668_10072864
693 Ga0207668_10121421
694 Ga0207668_10344712
695 Ga0207658_10452146
696 Ga0207677_10006245
697 Ga0207677_10253439
698 Ga0207703_10386221
699 Ga0207703_10566306
700 Ga0207639_10680479
701 Ga0207639_11035542
702 Ga0207678_10025996
703 Ga0207678_10057202
704 Ga0207678_10267875
705 Ga0207708_10329303
706 Ga0207702_10034178
707 Ga0207702_10057327
708 Ga0207641_10102844
709 Ga0207648_10178981
710 Ga0207674_10036205
711 Ga0207674_10370101
712 Ga0207674_10569388
713 Ga0207674_11384409
714 Ga0207675_100119359
715 Ga0207683_10064685
716 Ga0207683_10195472
717 Ga0207698_10054364
718 Ga0207698_10096476
719 Ga0207698_10517714
720 Ga0207698_10957333
721 Ga0209389_1000071
722 Ga0209489_101361
723 Ga0209700_100011
724 Ga0209813_10059370
725 Ga0268266_10030997
726 Ga0268266_10085679
727 Ga0268266_10087698
728 Ga0268266_10901834
729 Ga0268265_10072600
730 Ga0268265_10646713
731 Ga0268264_10000062
732 Ga0268264_10071734
733 Ga0307509_10013347
734 Ga0307508_10466591
735 Ga0265314_10130427
736 Ga0307516_10076687
737 Ga0373926_0082136
738 Ga0373923_0459054
739 Ga0373936_0076957
740 Ga0373941_0116719
741 Ga0373962_0038138
742 Ga0373933_0006512
743 Ga0395900_0262484
744 Ga0395898_0050553
745 Ga0395905_0143767
746 Ga0395905_1513592
747 Ga0395901_0387429
748 Ga0436365_0036157
749 Ga0436365_0106947
750 Ga0436365_0644864
751 Ga0436362_1007897
752 Ga0451841_0162938
753 Ga0451855_0221263
754 Ga0466965_0040955
755 Ga0466961_0218995
756 Ga0466963_0134129
757 Ga0466957_0052470
758 Ga0466957_0060530
759 Ga0466959_0100560
760 Ga0466967_0034220
761 Ga0466967_1970854
762 Ga0495592_0011628
763 Ga0495603_0385892
764 Ga0495591_114503
765 Ga0495651_0165896
766 Ga0495653_0889228
767 Ga0495639_0498669
768 Ga0495584_0084482
769 Ga0495584_0145465
770 Ga0495585_0206801
771 Ga0495585_0407678
772 Ga0495606_0046061
773 Ga0495606_0066349
774 Ga0495610_0081754
775 Ga0495616_0020973
776 Ga0495620_0055629
777 Ga0495628_0173443
778 Ga0495631_0101687
779 Ga0495637_0208783
780 Ga0495643_0007658
781 Ga0495587_0222466
782 Ga0495621_0025226
783 Ga0495597_0019791
784 Ga0495645_0067616
785 Ga0495656_0002383
786 Ga0495656_0070043
787 Ga0495668_0054837
788 Ga0495661_0282626
789 Ga0495657_0006376
790 Ga0495599_0037473
791 Ga0495623_0220071
792 Ga0495646_0052311
793 Ga0495669_0005989
794 Ga0495669_0533942
795 Ga0495589_0086923
796 Ga0495660_0274285
797 Ga0495581_0213202
798 Ga0495604_0018467
799 Ga0495604_0104405
800 Ga0495636_0106211
801 Ga0495674_0023946
802 Ga0495674_0375663
803 Ga0495676_1071430
804 Ga0495680_0009568
805 Ga0495683_0120890
806 Ga0495687_121421
807 Ga0495675_0001990
808 Ga0495677_0081899
809 Ga0495673_0012406
810 Ga0495602_0025242
811 Ga0495602_0426142
812 Ga0495626_0196432
813 Ga0496100_0046211
814 Ga0496100_0506398
815 Ga0496100_0613545
816 Ga0496101_0006357
817 Ga0496101_0097485
818 Ga0496101_0602812
819 Ga0496102_0008883
820 Ga0496102_0442016
821 Ga0496102_0469504
822 Ga0496102_0553166
823 Ga0496102_0748930
824 Ga0496103_0056066
825 Ga0496104_0022512
826 Ga0496104_0032686
827 Ga0496104_0380298
828 Ga0496105_0056016
829 Ga0496105_0178821
830 Ga0496105_0213427
831 Ga0496106_0817185
832 Ga0496106_1144503
833 Ga0496107_0010867
834 Ga0496107_0093745
835 Ga0496107_0361032
836 Ga0496107_0404270
837 Ga0496108_0097054
838 Ga0496108_0132595
839 Ga0496108_0177150
840 Ga0496108_0479952
841 Ga0496108_0942457
842 Ga0496109_0036252
843 Ga0496109_0057065
844 Ga0496109_0148019
845 Ga0496109_0257642
846 Ga0496110_0073782
847 Ga0496110_0096965
848 Ga0496110_0788208
849 Ga0496111_0787791
850 Ga0496112_0059641
851 Ga0496112_0089722
852 Ga0496112_0111781
853 Ga0496113_0056130
854 Ga0496113_0094797
855 Ga0496113_0119486
856 Ga0496114_0018066
857 Ga0496114_0068067
858 Ga0496114_0208339
859 Ga0496114_0789993
860 Ga0496115_0005876
861 Ga0496115_0051866
862 Ga0496115_0595314
863 Ga0496117_0089425
864 Ga0496117_0486455
865 Ga0496118_0114755
866 Ga0496119_0193380
867 Ga0496119_0286540
868 Ga0496120_0192072
869 Ga0496121_0461794
870 Ga0496122_0108668
871 Ga0496123_0129564
872 Ga0496124_0088048
873 Ga0496125_0000406
874 Ga0496125_0110895
875 Ga0496126_0006203
876 Ga0496126_0196194
877 Ga0496126_0412291
878 Ga0496126_0525813
879 Ga0495682_0184062
880 Ga0501036_0520952
881 Ga0501044_1336491
882 nmdc:mga00v17_329433_c1
883 nmdc:mga0yw44_208388_c1
884 nmdc:mga0yw44_218144_c1
885 nmdc:mga0yw44_253640_c2
886 nmdc:mga0k408_25821_c1
887 nmdc:mga0k408_273286_c1
888 nmdc:mga06z11_88739_c1
889 nmdc:mga04h51_269668_c1
890 nmdc:mga07m45_26301_c1
891 nmdc:mga07m45_27519_c2
892 nmdc:mga07m45_334605_c1
893 Ga0500635_0065717
894 Ga0500635_0129699
895 Ga0495595_0096068
896 Ga0495619_0120492
897 Ga0500647_0013581
898 Ga0500651_0002919
899 Ga0500651_0103520
900 Ga0500566_0000649
901 Ga0500566_0087986
902 Ga0500566_0481873
903 Ga0500640_114548
904 Ga0500640_169523
905 Ga0500554_007074
906 Ga0500557_000059
907 Ga0500569_001483
908 Ga0500572_021497
909 Ga0500572_065239
910 Ga0500591_177274
911 Ga0500595_000434
912 Ga0500595_001755
913 Ga0500614_025785
914 Ga0500614_108688
915 Ga0500642_0000198
916 Ga0500642_0011489
917 Ga0500658_0093320
918 Ga0500559_0019181
919 Ga0500559_0193400
920 Ga0500577_0016351
921 Ga0500590_067548
922 Ga0500590_186243
923 Ga0500603_014473
924 Ga0500619_079060
925 Ga0500620_061243
926 Ga0500630_107056
927 Ga0500638_010369
928 Ga0500638_072961
929 Ga0500639_017821
930 Ga0500636_0418565
931 Ga0500636_0439103
932 Ga0500637_0000350
933 Ga0500637_0458293
934 Ga0500576_149692
935 Ga0500625_010358
936 Ga0500609_010113
937 Ga0500596_000269
938 Ga0500601_000461
939 Ga0500661_002975
940 Ga0466962_0042204
941 2879128393
942 2879143662

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10027

DUF2269

Predicted integral membrane protein (DUF2269)

39

188

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4iar-assembly1.cif.gz_A crystal structure of the chimeric protein of 5-ht1b-bril in complex with ergotamine (psi community target) 0.7112 11 146
7jh6-assembly4.cif.gz_D de novo designed two-domain di-zn(ii) and porphyrin-binding protein 0.6399 4 153
6y07-assembly1.cif.gz_A designing a granulopoietic protein by topological rescaffolding 1: sohair 0.6355 7 153
6iwb-assembly1.cif.gz_A crystal structure of a computationally designed protein (ld3) in complex with bcl-2 0.6337 15 151
1y4c-assembly1.cif.gz_A designed helical protein fusion mbp 0.6243 7 146
ID Description Score Start End Superfamily
af_Q9ZT73_453_564_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.8031 80 151 1.20.58.390
af_A0A0R0IJL1_639_753_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7899 78 152 1.20.140.150
af_A0A0R0GPA9_387_501_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7581 80 152 1.20.140.150
2yfaB01 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.7217 14 153 1.20.1440.210
2yfaB01 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.6957 14 153 1.20.1440.210
ID Description Score Start End GO Terms
AF-A0A0Q7PJL4-F1-model_v4 DUF2269 domain-containing protein 0.9791 2 154 GO:0016020
AF-A0A6M7XXB4-F1-model_v4 DUF2269 domain-containing protein 0.9775 1 154 GO:0016020
AF-J1TB95-F1-model_v4 Putative integral membrane protein 0.9724 3 154 GO:0016020
AF-A0A562PN92-F1-model_v4 Putative membrane protein 0.972 1 154 GO:0016020
AF-A0A1R4G6I8-F1-model_v4 Integral membrane protein 0.9711 3 155 GO:0016020

Map