F450636

General Info

Members Datasets Scaffolds Average Seq Length
471 242 942 146

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0147962|Ga0436364_0147962_10281_10808
Length 175
Sequence MASALDQVAPANYRAGPRRCGTPRTEGTAAVGKIPKMLQPHIDTAFPANVCLVGSVLPNGFAQVTPRGGTMVYDDDHIALWERGKGSTSANLTDGAKLTVYFRKPQLREEGILPKGGIARFYGRARIHKSGPVYEEVWRRLVQPEKDRDPEKKGFAVLVEVERAEDLDGAPLALD

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
83 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
135 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
136 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
137 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
138 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
141 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
143 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
164 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
165 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
166 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
167 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
168 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0.85
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.49
Rhizosphere 93.21
Stem 0
Stem Tuber 0
Unclassified 23.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0147962 3300037853 Bacteria 94522
2 Ga0065715_10847359 3300005293 Unclassified 593
3 Ga0065707_10217831 3300005295 Bacteria 1237
4 Ga0068869_100001900 3300005334 Bacteria 12563
5 Ga0070680_100106625 3300005336 Bacteria 2330
6 Ga0070692_10017062 3300005345 Bacteria 3464
7 Ga0070669_100145101 3300005353 Unclassified 1833
8 Ga0070671_101513490 3300005355 Unclassified 594
9 Ga0070674_101240519 3300005356 Unclassified 663
10 Ga0070688_100065584 3300005365 Bacteria 2308
11 Ga0070667_100290479 3300005367 Bacteria 1470
12 Ga0070703_10065301 3300005406 Bacteria 1201
13 Ga0070709_10005080 3300005434 Bacteria 7110
14 Ga0070709_10043815 3300005434 Bacteria 2769
15 Ga0070709_11586067 3300005434 Unclassified 533
16 Ga0070714_100005133 3300005435 Bacteria 9963
17 Ga0070714_100060923 3300005435 Bacteria 3240
18 Ga0070714_100157707 3300005435 Bacteria 2050
19 Ga0070714_100259797 3300005435 Bacteria 1608
20 Ga0070714_100682621 3300005435 Bacteria 990
21 Ga0070714_101139863 3300005435 Bacteria 760
22 Ga0070713_100053708 3300005436 Bacteria 3339
23 Ga0070713_100070465 3300005436 Bacteria 2951
24 Ga0070713_100145345 3300005436 Bacteria 2104
25 Ga0070713_100145370 3300005436 Bacteria 2104
26 Ga0070713_100179613 3300005436 Bacteria 1901
27 Ga0070713_100251392 3300005436 Bacteria 1612
28 Ga0070713_100483679 3300005436 Bacteria 1166
29 Ga0070713_100620603 3300005436 Bacteria 1028
30 Ga0070713_100753620 3300005436 Bacteria 932
31 Ga0070710_10004077 3300005437 Bacteria 6938
32 Ga0070710_10099830 3300005437 Bacteria 1726
33 Ga0070701_10344710 3300005438 Bacteria 929
34 Ga0070711_100007316 3300005439 Bacteria 6715
35 Ga0070711_100012860 3300005439 Bacteria 5242
36 Ga0070711_100060790 3300005439 Bacteria 2627
37 Ga0070711_100203290 3300005439 Bacteria 1530
38 Ga0070711_100378452 3300005439 Bacteria 1144
39 Ga0070705_100347681 3300005440 Unclassified 1080
40 Ga0070705_100617630 3300005440 Bacteria 841
41 Ga0070694_100160486 3300005444 Bacteria 1649
42 Ga0070662_100401641 3300005457 Bacteria 1131
43 Ga0070706_100006384 3300005467 Bacteria 11138
44 Ga0070706_101326742 3300005467 Bacteria 659
45 Ga0070706_101414881 3300005467 Bacteria 636
46 Ga0070707_100090407 3300005468 Bacteria 2963
47 Ga0070698_100979183 3300005471 Unclassified 793
48 Ga0070698_101116939 3300005471 Unclassified 737
49 Ga0070699_100012193 3300005518 Bacteria 7418
50 Ga0070699_100098725 3300005518 Bacteria 2558
51 Ga0070699_100121858 3300005518 Bacteria 2294
52 Ga0070699_100133022 3300005518 Unclassified 2193
53 Ga0070679_100514032 3300005530 Unclassified 1141
54 Ga0070697_100066157 3300005536 Bacteria 2955
55 Ga0070697_100605023 3300005536 Bacteria 964
56 Ga0070686_100500136 3300005544 Bacteria 943
57 Ga0070695_100004572 3300005545 Bacteria 8116
58 Ga0070695_100113713 3300005545 Bacteria 1841
59 Ga0070695_100902129 3300005545 Unclassified 714
60 Ga0070696_100010595 3300005546 Bacteria 6176
61 Ga0070696_100017125 3300005546 Bacteria 4891
62 Ga0070693_100017175 3300005547 Bacteria 3757
63 Ga0070693_101099307 3300005547 Unclassified 606
64 Ga0070665_100340247 3300005548 Bacteria 1505
65 Ga0068857_100158342 3300005577 Bacteria 2054
66 Ga0068856_100097158 3300005614 Bacteria 2934
67 Ga0068856_100226536 3300005614 Bacteria 1885
68 Ga0068852_102843479 3300005616 Unclassified 502
69 Ga0068859_100178312 3300005617 Bacteria 2207
70 Ga0068859_101699195 3300005617 Bacteria 697
71 Ga0068861_101068717 3300005719 Unclassified 774
72 Ga0068858_100367417 3300005842 Bacteria 1379
73 Ga0068858_100729633 3300005842 Bacteria 965
74 Ga0068858_100779659 3300005842 Bacteria 932
75 Ga0068860_100070131 3300005843 Bacteria 3332
76 Ga0068860_100668493 3300005843 Bacteria 1047
77 Ga0068862_100149917 3300005844 Bacteria 2075
78 Ga0068862_100623616 3300005844 Bacteria 1038
79 Ga0068862_101470084 3300005844 Unclassified 686
80 Ga0081540_1002692 3300005983 Bacteria 14453
81 Ga0070717_10000545 3300006028 Bacteria 23877
82 Ga0070717_10058366 3300006028 Bacteria 3191
83 Ga0070717_10219518 3300006028 Bacteria 1670
84 Ga0075432_10018355 3300006058 Bacteria 2386
85 Ga0070715_10310822 3300006163 Bacteria 847
86 Ga0070716_100000347 3300006173 Bacteria 18844
87 Ga0070716_100344789 3300006173 Bacteria 1052
88 Ga0070716_100925997 3300006173 Unclassified 684
89 Ga0070716_101034482 3300006173 Bacteria 651
90 Ga0070712_100004535 3300006175 Bacteria 8575
91 Ga0070712_100011652 3300006175 Bacteria 5584
92 Ga0070712_100012750 3300006175 Bacteria 5351
93 Ga0070712_100111454 3300006175 Bacteria 2043
94 Ga0070712_101018790 3300006175 Bacteria 717
95 Ga0070712_101272462 3300006175 Unclassified 641
96 Ga0070712_101811907 3300006175 Unclassified 534
97 Ga0075428_100159685 3300006844 Bacteria 2447
98 Ga0075428_100750223 3300006844 Unclassified 1038
99 Ga0075428_102223191 3300006844 Unclassified 566
100 Ga0075431_100371089 3300006847 Bacteria 1436
101 Ga0075433_10000232 3300006852 Bacteria 31768
102 Ga0075433_10125013 3300006852 Bacteria 2284
103 Ga0075433_10530909 3300006852 Bacteria 1035
104 Ga0075433_10870892 3300006852 Unclassified 786
105 Ga0075434_100083372 3300006871 Bacteria 3194
106 Ga0075434_100105946 3300006871 Bacteria 2821
107 Ga0075434_100256342 3300006871 Bacteria 1768
108 Ga0075434_100785380 3300006871 Unclassified 969
109 Ga0075429_100000579 3300006880 Bacteria 28173
110 Ga0075429_100363339 3300006880 Bacteria 1267
111 Ga0075429_100616600 3300006880 Bacteria 951
112 Ga0075436_100029823 3300006914 Bacteria 3752
113 Ga0075436_100056402 3300006914 Bacteria 2713
114 Ga0097620_100178329 3300006931 Bacteria 2207
115 Ga0097620_101698832 3300006931 Bacteria 697
116 Ga0075435_100023817 3300007076 Bacteria 4742
117 Ga0075435_100179169 3300007076 Bacteria 1791
118 Ga0075435_100199448 3300007076 Unclassified 1695
119 Ga0075435_100698670 3300007076 Unclassified 881
120 Ga0099794_10281465 3300007265 Bacteria 860
121 Ga0099795_10007851 3300007788 Bacteria 3007
122 Ga0099795_10076617 3300007788 Bacteria 1272
123 Ga0099795_10259022 3300007788 Bacteria 753
124 Ga0105240_11129228 3300009093 Bacteria 833
125 Ga0111539_10014848 3300009094 Bacteria 9712
126 Ga0111539_10286738 3300009094 Bacteria 1916
127 Ga0111539_11205076 3300009094 Bacteria 879
128 Ga0105245_10090671 3300009098 Bacteria 2812
129 Ga0105245_10250067 3300009098 Bacteria 1722
130 Ga0105247_10117129 3300009101 Bacteria 1721
131 Ga0105247_11608502 3300009101 Unclassified 534
132 Ga0114129_10000439 3300009147 Bacteria 49346
133 Ga0114129_10011803 3300009147 Bacteria 12428
134 Ga0114129_10152644 3300009147 Bacteria 3160
135 Ga0114129_10185882 3300009147 Bacteria 2824
136 Ga0114129_10800949 3300009147 Bacteria 1202
137 Ga0114129_12387697 3300009147 Unclassified 633
138 Ga0105243_11059635 3300009148 Bacteria 817
139 Ga0105243_12656111 3300009148 Unclassified 541
140 Ga0105241_10304712 3300009174 Bacteria 1368
141 Ga0105248_10044401 3300009177 Bacteria 4984
142 Ga0105248_11545793 3300009177 Unclassified 751
143 Ga0105248_12497642 3300009177 Unclassified 589
144 Ga0105238_10248494 3300009551 Bacteria 1757
145 Ga0105238_10402553 3300009551 Bacteria 1362
146 Ga0105249_10171307 3300009553 Bacteria 2105
147 Ga0105249_12392122 3300009553 Unclassified 601
148 Ga0099796_10034567 3300010159 Bacteria 1670
149 Ga0099796_10173861 3300010159 Bacteria 861
150 Ga0157373_10448965 3300013100 Unclassified 928
151 Ga0157370_11053640 3300013104 Unclassified 735
152 Ga0157369_11343159 3300013105 Bacteria 728
153 Ga0157374_10880964 3300013296 Unclassified 912
154 Ga0157374_11974056 3300013296 Unclassified 610
155 Ga0157378_11204640 3300013297 Bacteria 797
156 Ga0163162_10427410 3300013306 Bacteria 1457
157 Ga0157375_11754891 3300013308 Unclassified 735
158 Ga0157375_12049238 3300013308 Bacteria 680
159 Ga0157375_13424629 3300013308 Unclassified 528
160 Ga0163163_10072971 3300014325 Bacteria 3422
161 Ga0157380_13096314 3300014326 Unclassified 530
162 Ga0182008_10199156 3300014497 Bacteria 1018
163 Ga0157377_10645112 3300014745 Bacteria 761
164 Ga0157379_10810192 3300014968 Unclassified 884
165 Ga0157379_12152164 3300014968 Unclassified 553
166 Ga0157376_10336650 3300014969 Bacteria 1440
167 Ga0157376_11907244 3300014969 Unclassified 631
168 Ga0197907_10196163 3300020069 Bacteria 835
169 Ga0206355_1540933 3300020076 Bacteria 958
170 Ga0213874_10024148 3300021377 Bacteria 1702
171 Ga0213874_10052711 3300021377 Bacteria 1253
172 Ga0213874_10313376 3300021377 Unclassified 593
173 Ga0213876_10430874 3300021384 Bacteria 701
174 Ga0213875_10000285 3300021388 Bacteria 49377
175 Ga0213875_10005742 3300021388 Bacteria 6609
176 Ga0213871_10215450 3300021441 Unclassified 603
177 Ga0224712_10068939 3300022467 Bacteria 1431
178 Ga0224712_10089211 3300022467 Unclassified 1288
179 Ga0207653_10149327 3300025885 Unclassified 859
180 Ga0207653_10181197 3300025885 Bacteria 788
181 Ga0207692_10080266 3300025898 Bacteria 1743
182 Ga0207685_10384119 3300025905 Unclassified 716
183 Ga0207699_10019841 3300025906 Bacteria 3593
184 Ga0207699_10095806 3300025906 Bacteria 1872
185 Ga0207699_10101771 3300025906 Bacteria 1824
186 Ga0207699_10211002 3300025906 Unclassified 1321
187 Ga0207684_10005548 3300025910 Bacteria 11617
188 Ga0207684_10025273 3300025910 Bacteria 5061
189 Ga0207684_10076648 3300025910 Bacteria 2842
190 Ga0207684_11059234 3300025910 Bacteria 676
191 Ga0207707_10092783 3300025912 Bacteria 2638
192 Ga0207707_10887393 3300025912 Unclassified 738
193 Ga0207695_10849039 3300025913 Bacteria 793
194 Ga0207693_10000447 3300025915 Bacteria 37791
195 Ga0207693_10008167 3300025915 Bacteria 8578
196 Ga0207693_10017582 3300025915 Bacteria 5701
197 Ga0207693_10018553 3300025915 Bacteria 5539
198 Ga0207693_10062389 3300025915 Bacteria 2920
199 Ga0207693_10666788 3300025915 Unclassified 807
200 Ga0207693_11306462 3300025915 Bacteria 542
201 Ga0207663_10102583 3300025916 Unclassified 1925
202 Ga0207663_10310004 3300025916 Bacteria 1182
203 Ga0207663_10333029 3300025916 Bacteria 1144
204 Ga0207663_10895076 3300025916 Bacteria 709
205 Ga0207663_10966895 3300025916 Unclassified 682
206 Ga0207660_10854803 3300025917 Unclassified 742
207 Ga0207652_10296482 3300025921 Unclassified 1459
208 Ga0207652_10543376 3300025921 Bacteria 1044
209 Ga0207652_10707233 3300025921 Unclassified 899
210 Ga0207646_10004134 3300025922 Bacteria 15934
211 Ga0207646_10008583 3300025922 Bacteria 10212
212 Ga0207646_10026127 3300025922 Bacteria 5333
213 Ga0207681_10257326 3300025923 Bacteria 1365
214 Ga0207694_10291313 3300025924 Bacteria 1343
215 Ga0207659_10331628 3300025926 Bacteria 1258
216 Ga0207687_10221489 3300025927 Bacteria 1490
217 Ga0207700_10093740 3300025928 Bacteria 2377
218 Ga0207700_10099611 3300025928 Bacteria 2314
219 Ga0207700_10109574 3300025928 Bacteria 2219
220 Ga0207700_10125895 3300025928 Bacteria 2085
221 Ga0207700_10187499 3300025928 Bacteria 1736
222 Ga0207700_10194901 3300025928 Bacteria 1704
223 Ga0207700_10722386 3300025928 Bacteria 890
224 Ga0207664_10107013 3300025929 Bacteria 2320
225 Ga0207664_10138176 3300025929 Bacteria 2058
226 Ga0207664_10747461 3300025929 Unclassified 879
227 Ga0207706_10218048 3300025933 Bacteria 1671
228 Ga0207709_10148721 3300025935 Unclassified 1619
229 Ga0207665_10002068 3300025939 Bacteria 13533
230 Ga0207665_10009849 3300025939 Bacteria 6273
231 Ga0207665_10048791 3300025939 Bacteria 2843
232 Ga0207665_11159642 3300025939 Unclassified 616
233 Ga0207711_10049703 3300025941 Bacteria 3590
234 Ga0207689_10004553 3300025942 Bacteria 12547
235 Ga0207661_10202663 3300025944 Unclassified 1745
236 Ga0207651_11368148 3300025960 Bacteria 637
237 Ga0207712_10079098 3300025961 Bacteria 2387
238 Ga0207658_10303666 3300025986 Bacteria 1376
239 Ga0207677_10918139 3300026023 Unclassified 790
240 Ga0207703_10795722 3300026035 Bacteria 902
241 Ga0207708_10825551 3300026075 Bacteria 799
242 Ga0207702_10190329 3300026078 Bacteria 1895
243 Ga0207702_10225285 3300026078 Bacteria 1749
244 Ga0207702_10926133 3300026078 Unclassified 864
245 Ga0207641_12630351 3300026088 Unclassified 501
246 Ga0207648_10071874 3300026089 Bacteria 3015
247 Ga0207676_10653821 3300026095 Unclassified 1015
248 Ga0207675_100313000 3300026118 Bacteria 1531
249 Ga0207428_10002333 3300027907 Bacteria 18999
250 Ga0207428_10295685 3300027907 Bacteria 1199
251 Ga0268266_10792872 3300028379 Bacteria 915
252 Ga0268265_10045577 3300028380 Bacteria 3273
253 Ga0268265_11373178 3300028380 Unclassified 708
254 Ga0268264_10077197 3300028381 Bacteria 2836
255 Ga0265337_1010849 3300028556 Bacteria 3169
256 Ga0265338_10004795 3300028800 Bacteria 18074
257 Ga0265327_10111603 3300031251 Unclassified 1306
258 Ga0307408_101414628 3300031548 Unclassified 655
259 Ga0265313_10124662 3300031595 Bacteria 1121
260 Ga0373938_0169694 3300034957 Bacteria 590
261 Ga0373926_0220450 3300035083 Unclassified 732
262 Ga0373934_0040354 3300035086 Bacteria 1841
263 Ga0373940_0011307 3300035088 Bacteria 2118
264 Ga0373944_0085613 3300035089 Unclassified 1047
265 Ga0373949_0127588 3300035090 Bacteria 719
266 Ga0373949_0200382 3300035090 Bacteria 599
267 Ga0373951_0171481 3300035091 Bacteria 619
268 Ga0373923_0600560 3300035111 Unclassified 542
269 Ga0373932_0110173 3300035112 Bacteria 906
270 Ga0373936_0050119 3300035113 Bacteria 1688
271 Ga0373941_0015587 3300035115 Bacteria 2053
272 Ga0373941_0185643 3300035115 Bacteria 783
273 Ga0373945_0022337 3300035116 Bacteria 2178
274 Ga0373953_0022509 3300035117 Bacteria 2377
275 Ga0373956_0035075 3300035119 Bacteria 2211
276 Ga0373957_0025064 3300035120 Bacteria 2146
277 Ga0373957_0519441 3300035120 Unclassified 519
278 Ga0373943_0206808 3300035170 Bacteria 1088
279 Ga0373946_0017584 3300035171 Bacteria 2737
280 Ga0373946_0391275 3300035171 Unclassified 701
281 Ga0373955_0119507 3300035172 Bacteria 1531
282 Ga0373955_0217554 3300035172 Unclassified 1140
283 Ga0373955_0271536 3300035172 Bacteria 1019
284 Ga0373924_0063365 3300035410 Bacteria 1550
285 Ga0373935_0224705 3300035692 Bacteria 1305
286 Ga0373935_0465737 3300035692 Unclassified 914
287 Ga0373927_0043381 3300035695 Bacteria 2912
288 Ga0373927_0127210 3300035695 Bacteria 1664
289 Ga0373927_0363984 3300035695 Bacteria 953
290 Ga0373927_0733347 3300035695 Bacteria 653
291 Ga0373933_0004156 3300035724 Bacteria 7973
292 Ga0373933_0004882 3300035724 Bacteria 7320
293 Ga0373933_0010126 3300035724 Bacteria 5162
294 Ga0373933_0109736 3300035724 Bacteria 1720
295 Ga0373947_0119302 3300035725 Bacteria 1674
296 Ga0373947_0469722 3300035725 Bacteria 853
297 Ga0373947_0499433 3300035725 Bacteria 826
298 Ga0373937_0002270 3300036401 Bacteria 16048
299 Ga0373937_0018340 3300036401 Bacteria 6249
300 Ga0373937_0047121 3300036401 Plasmid 3943
301 Ga0373937_0072902 3300036401 Bacteria 3167
302 Ga0373937_0159370 3300036401 Bacteria 2115
303 Ga0373937_0630340 3300036401 Bacteria 1017
304 Ga0373937_1195495 3300036401 Unclassified 709
305 Ga0373925_0020376 3300037068 Bacteria 4827
306 Ga0373925_0167834 3300037068 Unclassified 1731
307 Ga0373925_0782749 3300037068 Bacteria 786
308 Ga0395900_0735116 3300037418 Bacteria 918
309 Ga0436364_0338464 3300037853 Bacteria 1007
310 Ga0436364_0429534 3300037853 Unclassified 783
311 Ga0436364_0719530 3300037853 Bacteria 3629
312 Ga0436364_0882052 3300037853 Bacteria 1668
313 Ga0436364_1051213 3300037853 Bacteria 751
314 Ga0436364_1125269 3300037853 Bacteria 1674
315 Ga0436364_1469704 3300037853 Unclassified 847
316 Ga0436364_1517600 3300037853 Bacteria 900
317 Ga0242420_076331 3300038996 Bacteria 687
318 Ga0436365_0169414 3300039437 Unclassified 798
319 Ga0436365_0933148 3300039437 Bacteria 3687
320 Ga0436365_1260167 3300039437 Bacteria 750
321 Ga0436365_1512532 3300039437 Unclassified 555
322 Ga0436365_1589881 3300039437 Bacteria 526
323 Ga0436360_0466940 3300039438 Bacteria 699
324 Ga0436360_1017659 3300039438 Unclassified 1560
325 Ga0436360_1033009 3300039438 Bacteria 614
326 Ga0436360_1238423 3300039438 Bacteria 640
327 Ga0436360_1350986 3300039438 Unclassified 935
328 Ga0436361_0312834 3300039447 Bacteria 1757
329 Ga0436361_0507059 3300039447 Bacteria 1001
330 Ga0436361_0544923 3300039447 Bacteria 1292
331 Ga0436361_0691693 3300039447 Bacteria 2391
332 Ga0436363_0387726 3300039450 Bacteria 771
333 Ga0436363_0670050 3300039450 Unclassified 616
334 Ga0436363_0741540 3300039450 Bacteria 1391
335 Ga0436363_1132125 3300039450 Bacteria 7414
336 Ga0436363_1527241 3300039450 Bacteria 567
337 Ga0436362_0164049 3300039453 Bacteria 658
338 Ga0436362_0568989 3300039453 Unclassified 638
339 Ga0436362_1192721 3300039453 Bacteria 1349
340 Ga0436362_1201755 3300039453 Unclassified 552
341 Ga0436362_1241537 3300039453 Bacteria 1272
342 Ga0439455_0120799 3300042012 Bacteria 734
343 Ga0439463_012209 3300042016 Unclassified 2110
344 Ga0439459_0003258 3300042438 Bacteria 2561
345 Ga0439464_0010929 3300042439 Bacteria 2400
346 Ga0439460_0000644 3300042461 Bacteria 7670
347 Ga0439460_0241899 3300042461 Unclassified 622
348 Ga0451577_0045108 3300042876 Bacteria 3946
349 Ga0451577_0092224 3300042876 Bacteria 2704
350 Ga0453683_0008632 3300044673 Bacteria 6833
351 Ga0453683_0586632 3300044673 Unclassified 726
352 Ga0466963_0085917 3300044694 Bacteria 2137
353 Ga0453684_0176823 3300044712 Unclassified 2509
354 Ga0451576_0069094 3300045051 Bacteria 3676
355 Ga0451576_1308523 3300045051 Bacteria 755
356 Ga0466967_0058859 3300045976 Bacteria 3398
357 Ga0495592_0210668 3300046454 Bacteria 1305
358 Ga0495651_0603818 3300046462 Unclassified 692
359 Ga0495653_0170274 3300046463 Bacteria 1504
360 Ga0495662_0167386 3300046476 Unclassified 1083
361 Ga0495664_0001571 3300046477 Bacteria 12107
362 Ga0495608_0015989 3300046511 Bacteria 5194
363 Ga0495608_0106120 3300046511 Bacteria 1808
364 Ga0495608_0145863 3300046511 Unclassified 1510
365 Ga0495628_0095115 3300046516 Bacteria 2302
366 Ga0495640_0114530 3300046533 Bacteria 1758
367 Ga0495640_0191676 3300046533 Unclassified 1299
368 Ga0495587_0697471 3300046536 Unclassified 556
369 Ga0495645_0005031 3300046543 Bacteria 9060
370 Ga0495645_0445323 3300046543 Bacteria 818
371 Ga0495667_0005646 3300046559 Bacteria 8459
372 Ga0495667_0017256 3300046559 Bacteria 4877
373 Ga0495667_0027059 3300046559 Bacteria 3865
374 Ga0495667_0097962 3300046559 Bacteria 1899
375 Ga0495634_0073011 3300046642 Bacteria 2256
376 Ga0495635_0032328 3300046663 Bacteria 3630
377 Ga0495635_0150829 3300046663 Bacteria 1583
378 Ga0495659_0066950 3300046664 Bacteria 1339
379 Ga0495599_0013296 3300046678 Bacteria 5087
380 Ga0495599_0191425 3300046678 Unclassified 1258
381 Ga0495623_0034432 3300046679 Bacteria 3248
382 Ga0495623_0564041 3300046679 Unclassified 595
383 Ga0495646_0036663 3300046680 Bacteria 3037
384 Ga0495600_0272531 3300046809 Unclassified 1073
385 Ga0495604_0099205 3300047317 Bacteria 2144
386 Ga0495604_0163509 3300047317 Unclassified 1571
387 Ga0495680_0074087 3300047322 Bacteria 2586
388 Ga0495680_0094953 3300047322 Bacteria 2230
389 Ga0495680_0926992 3300047322 Bacteria 561
390 Ga0495684_0501997 3300047471 Unclassified 834
391 Ga0495684_0659490 3300047471 Bacteria 699
392 Ga0495602_0000326 3300048088 Bacteria 43949
393 Ga0495602_0067889 3300048088 Bacteria 3065
394 Ga0496104_0581911 3300048907 Bacteria 1030
395 Ga0496106_0215849 3300048909 Bacteria 1529
396 Ga0496106_1488431 3300048909 Unclassified 521
397 Ga0496108_0685184 3300048911 Bacteria 889
398 Ga0496111_0108597 3300048914 Bacteria 2043
399 Ga0496112_0053998 3300048915 Bacteria 3947
400 Ga0496113_0164554 3300048916 Bacteria 1754
401 Ga0501033_0101309 3300049570 Bacteria 2101
402 Ga0501037_1032047 3300049573 Bacteria 535
403 Ga0501038_0007677 3300049574 Bacteria 9948
404 Ga0501038_0832847 3300049574 Unclassified 684
405 Ga0501039_0013513 3300049575 Bacteria 6243
406 Ga0501040_0003967 3300049576 Bacteria 9614
407 Ga0501041_0002703 3300049577 Bacteria 10113
408 Ga0501042_0001217 3300049578 Bacteria 14951
409 Ga0501043_0629996 3300049579 Unclassified 789
410 Ga0501046_0001099 3300049580 Bacteria 26463
411 Ga0501047_1367820 3300049581 Unclassified 523
412 Ga0501048_0007026 3300049582 Bacteria 8551
413 Ga0501070_0592381 3300049586 Unclassified 884
414 Ga0501072_0791242 3300049588 Bacteria 743
415 Ga0501072_1097046 3300049588 Bacteria 619
416 Ga0501073_0127206 3300049589 Bacteria 1766
417 Ga0501074_0012504 3300049590 Bacteria 6171
418 Ga0501075_0023656 3300049591 Bacteria 4500
419 Ga0501076_0019325 3300049592 Bacteria 5207
420 Ga0501077_0085406 3300049593 Bacteria 2001
421 Ga0501079_0001143 3300049741 Bacteria 18539
422 Ga0501080_0083311 3300049742 Bacteria 2971
423 Ga0501081_0008941 3300049743 Bacteria 6510
424 Ga0501083_0058408 3300049744 Bacteria 2581
425 Ga0501044_0578609 3300049823 Unclassified 1018
426 Ga0501045_0000526 3300049824 Bacteria 23857
427 Ga0501045_0456010 3300049824 Unclassified 950
428 nmdc:mga05p37_116107_c1 3300050507 Bacteria 3290
429 nmdc:mga05p37_1164209_c1 3300050507 Unclassified 801
430 nmdc:mga05p37_120813_c1 3300050507 Bacteria 3218
431 nmdc:mga05p37_2058_c1 3300050507 Bacteria 23449
432 nmdc:mga05p37_313539_c1 3300050507 Bacteria 1859
433 nmdc:mga05p37_85086_c1 3300050507 Bacteria 3897
434 nmdc:mga09592_1008505_c1 3300050508 Bacteria 696
435 nmdc:mga09592_42514_c1 3300050508 Bacteria 3822
436 nmdc:mga0qj67_278595_c1 3300050509 Bacteria 1356
437 nmdc:mga06r32_1674863_c1 3300050510 Unclassified 573
438 nmdc:mga06r32_322438_c1 3300050510 Bacteria 1530
439 nmdc:mga06r32_322642_c1 3300050510 Bacteria 1530
440 nmdc:mga08y16_1344218_c1 3300050511 Unclassified 680
441 nmdc:mga08y16_535570_c1 3300050511 Bacteria 1186
442 nmdc:mga08y16_79739_c1 3300050511 Bacteria 3413
443 nmdc:mga0n895_126778_c1 3300050512 Bacteria 2577
444 nmdc:mga0n895_237339_c1 3300050512 Bacteria 1850
445 nmdc:mga0n895_354666_c1 3300050512 Bacteria 1486
446 nmdc:mga0n895_667371_c1 3300050512 Unclassified 1037
447 nmdc:mga0n895_87236_c1 3300050512 Bacteria 3118
448 nmdc:mga0rr50_177756_c1 3300050513 Bacteria 1738
449 nmdc:mga0rr50_332472_c1 3300050513 Bacteria 1276
450 nmdc:mga0rr50_43279_c1 3300050513 Bacteria 3294
451 nmdc:mga0rr50_48219_c1 3300050513 Bacteria 3148
452 nmdc:mga08x19_25495_c1 3300050514 Bacteria 3683
453 nmdc:mga08x19_48797_c1 3300050514 Bacteria 2713
454 nmdc:mga08x19_59198_c1 3300050514 Bacteria 2479
455 nmdc:mga0a205_1033466_c1 3300050515 Unclassified 669
456 nmdc:mga0a205_424561_c1 3300050515 Bacteria 1191
457 nmdc:mga0a205_586353_c1 3300050515 Bacteria 969
458 nmdc:mga0a205_80262_c1 3300050515 Bacteria 3153
459 nmdc:mga0a205_9101_c1 3300050515 Bacteria 9061
460 Ga0495601_0001361 3300053077 Bacteria 13446
461 Ga0495601_0003988 3300053077 Bacteria 8496
462 Ga0495601_0761472 3300053077 Bacteria 616
463 Ga0495612_0006712 3300053078 Bacteria 4715
464 Ga0495595_0019947 3300053084 Bacteria 2913
465 Ga0495619_0004465 3300053085 Bacteria 8930
466 Ga0495619_0064887 3300053085 Bacteria 2435
467 Ga0495619_0212995 3300053085 Unclassified 1338
468 Ga0501084_0003212 3300054114 Bacteria 13234
469 Ga0501082_0000612 3300060353 Bacteria 31439
470 Ga0530510_0005685 3300061734 Bacteria 8638
471 Ga0530510_0238882 3300061734 Unclassified 1352
472 Ga0436364_0147962
473 Ga0065715_10847359
474 Ga0065707_10217831
475 Ga0068869_100001900
476 Ga0070680_100106625
477 Ga0070692_10017062
478 Ga0070669_100145101
479 Ga0070671_101513490
480 Ga0070674_101240519
481 Ga0070688_100065584
482 Ga0070667_100290479
483 Ga0070703_10065301
484 Ga0070709_10005080
485 Ga0070709_10043815
486 Ga0070709_11586067
487 Ga0070714_100005133
488 Ga0070714_100060923
489 Ga0070714_100157707
490 Ga0070714_100259797
491 Ga0070714_100682621
492 Ga0070714_101139863
493 Ga0070713_100053708
494 Ga0070713_100070465
495 Ga0070713_100145345
496 Ga0070713_100145370
497 Ga0070713_100179613
498 Ga0070713_100251392
499 Ga0070713_100483679
500 Ga0070713_100620603
501 Ga0070713_100753620
502 Ga0070710_10004077
503 Ga0070710_10099830
504 Ga0070701_10344710
505 Ga0070711_100007316
506 Ga0070711_100012860
507 Ga0070711_100060790
508 Ga0070711_100203290
509 Ga0070711_100378452
510 Ga0070705_100347681
511 Ga0070705_100617630
512 Ga0070694_100160486
513 Ga0070662_100401641
514 Ga0070706_100006384
515 Ga0070706_101326742
516 Ga0070706_101414881
517 Ga0070707_100090407
518 Ga0070698_100979183
519 Ga0070698_101116939
520 Ga0070699_100012193
521 Ga0070699_100098725
522 Ga0070699_100121858
523 Ga0070699_100133022
524 Ga0070679_100514032
525 Ga0070697_100066157
526 Ga0070697_100605023
527 Ga0070686_100500136
528 Ga0070695_100004572
529 Ga0070695_100113713
530 Ga0070695_100902129
531 Ga0070696_100010595
532 Ga0070696_100017125
533 Ga0070693_100017175
534 Ga0070693_101099307
535 Ga0070665_100340247
536 Ga0068857_100158342
537 Ga0068856_100097158
538 Ga0068856_100226536
539 Ga0068852_102843479
540 Ga0068859_100178312
541 Ga0068859_101699195
542 Ga0068861_101068717
543 Ga0068858_100367417
544 Ga0068858_100729633
545 Ga0068858_100779659
546 Ga0068860_100070131
547 Ga0068860_100668493
548 Ga0068862_100149917
549 Ga0068862_100623616
550 Ga0068862_101470084
551 Ga0081540_1002692
552 Ga0070717_10000545
553 Ga0070717_10058366
554 Ga0070717_10219518
555 Ga0075432_10018355
556 Ga0070715_10310822
557 Ga0070716_100000347
558 Ga0070716_100344789
559 Ga0070716_100925997
560 Ga0070716_101034482
561 Ga0070712_100004535
562 Ga0070712_100011652
563 Ga0070712_100012750
564 Ga0070712_100111454
565 Ga0070712_101018790
566 Ga0070712_101272462
567 Ga0070712_101811907
568 Ga0075428_100159685
569 Ga0075428_100750223
570 Ga0075428_102223191
571 Ga0075431_100371089
572 Ga0075433_10000232
573 Ga0075433_10125013
574 Ga0075433_10530909
575 Ga0075433_10870892
576 Ga0075434_100083372
577 Ga0075434_100105946
578 Ga0075434_100256342
579 Ga0075434_100785380
580 Ga0075429_100000579
581 Ga0075429_100363339
582 Ga0075429_100616600
583 Ga0075436_100029823
584 Ga0075436_100056402
585 Ga0097620_100178329
586 Ga0097620_101698832
587 Ga0075435_100023817
588 Ga0075435_100179169
589 Ga0075435_100199448
590 Ga0075435_100698670
591 Ga0099794_10281465
592 Ga0099795_10007851
593 Ga0099795_10076617
594 Ga0099795_10259022
595 Ga0105240_11129228
596 Ga0111539_10014848
597 Ga0111539_10286738
598 Ga0111539_11205076
599 Ga0105245_10090671
600 Ga0105245_10250067
601 Ga0105247_10117129
602 Ga0105247_11608502
603 Ga0114129_10000439
604 Ga0114129_10011803
605 Ga0114129_10152644
606 Ga0114129_10185882
607 Ga0114129_10800949
608 Ga0114129_12387697
609 Ga0105243_11059635
610 Ga0105243_12656111
611 Ga0105241_10304712
612 Ga0105248_10044401
613 Ga0105248_11545793
614 Ga0105248_12497642
615 Ga0105238_10248494
616 Ga0105238_10402553
617 Ga0105249_10171307
618 Ga0105249_12392122
619 Ga0099796_10034567
620 Ga0099796_10173861
621 Ga0157373_10448965
622 Ga0157370_11053640
623 Ga0157369_11343159
624 Ga0157374_10880964
625 Ga0157374_11974056
626 Ga0157378_11204640
627 Ga0163162_10427410
628 Ga0157375_11754891
629 Ga0157375_12049238
630 Ga0157375_13424629
631 Ga0163163_10072971
632 Ga0157380_13096314
633 Ga0182008_10199156
634 Ga0157377_10645112
635 Ga0157379_10810192
636 Ga0157379_12152164
637 Ga0157376_10336650
638 Ga0157376_11907244
639 Ga0197907_10196163
640 Ga0206355_1540933
641 Ga0213874_10024148
642 Ga0213874_10052711
643 Ga0213874_10313376
644 Ga0213876_10430874
645 Ga0213875_10000285
646 Ga0213875_10005742
647 Ga0213871_10215450
648 Ga0224712_10068939
649 Ga0224712_10089211
650 Ga0207653_10149327
651 Ga0207653_10181197
652 Ga0207692_10080266
653 Ga0207685_10384119
654 Ga0207699_10019841
655 Ga0207699_10095806
656 Ga0207699_10101771
657 Ga0207699_10211002
658 Ga0207684_10005548
659 Ga0207684_10025273
660 Ga0207684_10076648
661 Ga0207684_11059234
662 Ga0207707_10092783
663 Ga0207707_10887393
664 Ga0207695_10849039
665 Ga0207693_10000447
666 Ga0207693_10008167
667 Ga0207693_10017582
668 Ga0207693_10018553
669 Ga0207693_10062389
670 Ga0207693_10666788
671 Ga0207693_11306462
672 Ga0207663_10102583
673 Ga0207663_10310004
674 Ga0207663_10333029
675 Ga0207663_10895076
676 Ga0207663_10966895
677 Ga0207660_10854803
678 Ga0207652_10296482
679 Ga0207652_10543376
680 Ga0207652_10707233
681 Ga0207646_10004134
682 Ga0207646_10008583
683 Ga0207646_10026127
684 Ga0207681_10257326
685 Ga0207694_10291313
686 Ga0207659_10331628
687 Ga0207687_10221489
688 Ga0207700_10093740
689 Ga0207700_10099611
690 Ga0207700_10109574
691 Ga0207700_10125895
692 Ga0207700_10187499
693 Ga0207700_10194901
694 Ga0207700_10722386
695 Ga0207664_10107013
696 Ga0207664_10138176
697 Ga0207664_10747461
698 Ga0207706_10218048
699 Ga0207709_10148721
700 Ga0207665_10002068
701 Ga0207665_10009849
702 Ga0207665_10048791
703 Ga0207665_11159642
704 Ga0207711_10049703
705 Ga0207689_10004553
706 Ga0207661_10202663
707 Ga0207651_11368148
708 Ga0207712_10079098
709 Ga0207658_10303666
710 Ga0207677_10918139
711 Ga0207703_10795722
712 Ga0207708_10825551
713 Ga0207702_10190329
714 Ga0207702_10225285
715 Ga0207702_10926133
716 Ga0207641_12630351
717 Ga0207648_10071874
718 Ga0207676_10653821
719 Ga0207675_100313000
720 Ga0207428_10002333
721 Ga0207428_10295685
722 Ga0268266_10792872
723 Ga0268265_10045577
724 Ga0268265_11373178
725 Ga0268264_10077197
726 Ga0265337_1010849
727 Ga0265338_10004795
728 Ga0265327_10111603
729 Ga0307408_101414628
730 Ga0265313_10124662
731 Ga0373938_0169694
732 Ga0373926_0220450
733 Ga0373934_0040354
734 Ga0373940_0011307
735 Ga0373944_0085613
736 Ga0373949_0127588
737 Ga0373949_0200382
738 Ga0373951_0171481
739 Ga0373923_0600560
740 Ga0373932_0110173
741 Ga0373936_0050119
742 Ga0373941_0015587
743 Ga0373941_0185643
744 Ga0373945_0022337
745 Ga0373953_0022509
746 Ga0373956_0035075
747 Ga0373957_0025064
748 Ga0373957_0519441
749 Ga0373943_0206808
750 Ga0373946_0017584
751 Ga0373946_0391275
752 Ga0373955_0119507
753 Ga0373955_0217554
754 Ga0373955_0271536
755 Ga0373924_0063365
756 Ga0373935_0224705
757 Ga0373935_0465737
758 Ga0373927_0043381
759 Ga0373927_0127210
760 Ga0373927_0363984
761 Ga0373927_0733347
762 Ga0373933_0004156
763 Ga0373933_0004882
764 Ga0373933_0010126
765 Ga0373933_0109736
766 Ga0373947_0119302
767 Ga0373947_0469722
768 Ga0373947_0499433
769 Ga0373937_0002270
770 Ga0373937_0018340
771 Ga0373937_0047121
772 Ga0373937_0072902
773 Ga0373937_0159370
774 Ga0373937_0630340
775 Ga0373937_1195495
776 Ga0373925_0020376
777 Ga0373925_0167834
778 Ga0373925_0782749
779 Ga0395900_0735116
780 Ga0436364_0338464
781 Ga0436364_0429534
782 Ga0436364_0719530
783 Ga0436364_0882052
784 Ga0436364_1051213
785 Ga0436364_1125269
786 Ga0436364_1469704
787 Ga0436364_1517600
788 Ga0242420_076331
789 Ga0436365_0169414
790 Ga0436365_0933148
791 Ga0436365_1260167
792 Ga0436365_1512532
793 Ga0436365_1589881
794 Ga0436360_0466940
795 Ga0436360_1017659
796 Ga0436360_1033009
797 Ga0436360_1238423
798 Ga0436360_1350986
799 Ga0436361_0312834
800 Ga0436361_0507059
801 Ga0436361_0544923
802 Ga0436361_0691693
803 Ga0436363_0387726
804 Ga0436363_0670050
805 Ga0436363_0741540
806 Ga0436363_1132125
807 Ga0436363_1527241
808 Ga0436362_0164049
809 Ga0436362_0568989
810 Ga0436362_1192721
811 Ga0436362_1201755
812 Ga0436362_1241537
813 Ga0439455_0120799
814 Ga0439463_012209
815 Ga0439459_0003258
816 Ga0439464_0010929
817 Ga0439460_0000644
818 Ga0439460_0241899
819 Ga0451577_0045108
820 Ga0451577_0092224
821 Ga0453683_0008632
822 Ga0453683_0586632
823 Ga0466963_0085917
824 Ga0453684_0176823
825 Ga0451576_0069094
826 Ga0451576_1308523
827 Ga0466967_0058859
828 Ga0495592_0210668
829 Ga0495651_0603818
830 Ga0495653_0170274
831 Ga0495662_0167386
832 Ga0495664_0001571
833 Ga0495608_0015989
834 Ga0495608_0106120
835 Ga0495608_0145863
836 Ga0495628_0095115
837 Ga0495640_0114530
838 Ga0495640_0191676
839 Ga0495587_0697471
840 Ga0495645_0005031
841 Ga0495645_0445323
842 Ga0495667_0005646
843 Ga0495667_0017256
844 Ga0495667_0027059
845 Ga0495667_0097962
846 Ga0495634_0073011
847 Ga0495635_0032328
848 Ga0495635_0150829
849 Ga0495659_0066950
850 Ga0495599_0013296
851 Ga0495599_0191425
852 Ga0495623_0034432
853 Ga0495623_0564041
854 Ga0495646_0036663
855 Ga0495600_0272531
856 Ga0495604_0099205
857 Ga0495604_0163509
858 Ga0495680_0074087
859 Ga0495680_0094953
860 Ga0495680_0926992
861 Ga0495684_0501997
862 Ga0495684_0659490
863 Ga0495602_0000326
864 Ga0495602_0067889
865 Ga0496104_0581911
866 Ga0496106_0215849
867 Ga0496106_1488431
868 Ga0496108_0685184
869 Ga0496111_0108597
870 Ga0496112_0053998
871 Ga0496113_0164554
872 Ga0501033_0101309
873 Ga0501037_1032047
874 Ga0501038_0007677
875 Ga0501038_0832847
876 Ga0501039_0013513
877 Ga0501040_0003967
878 Ga0501041_0002703
879 Ga0501042_0001217
880 Ga0501043_0629996
881 Ga0501046_0001099
882 Ga0501047_1367820
883 Ga0501048_0007026
884 Ga0501070_0592381
885 Ga0501072_0791242
886 Ga0501072_1097046
887 Ga0501073_0127206
888 Ga0501074_0012504
889 Ga0501075_0023656
890 Ga0501076_0019325
891 Ga0501077_0085406
892 Ga0501079_0001143
893 Ga0501080_0083311
894 Ga0501081_0008941
895 Ga0501083_0058408
896 Ga0501044_0578609
897 Ga0501045_0000526
898 Ga0501045_0456010
899 nmdc:mga05p37_116107_c1
900 nmdc:mga05p37_1164209_c1
901 nmdc:mga05p37_120813_c1
902 nmdc:mga05p37_2058_c1
903 nmdc:mga05p37_313539_c1
904 nmdc:mga05p37_85086_c1
905 nmdc:mga09592_1008505_c1
906 nmdc:mga09592_42514_c1
907 nmdc:mga0qj67_278595_c1
908 nmdc:mga06r32_1674863_c1
909 nmdc:mga06r32_322438_c1
910 nmdc:mga06r32_322642_c1
911 nmdc:mga08y16_1344218_c1
912 nmdc:mga08y16_535570_c1
913 nmdc:mga08y16_79739_c1
914 nmdc:mga0n895_126778_c1
915 nmdc:mga0n895_237339_c1
916 nmdc:mga0n895_354666_c1
917 nmdc:mga0n895_667371_c1
918 nmdc:mga0n895_87236_c1
919 nmdc:mga0rr50_177756_c1
920 nmdc:mga0rr50_332472_c1
921 nmdc:mga0rr50_43279_c1
922 nmdc:mga0rr50_48219_c1
923 nmdc:mga08x19_25495_c1
924 nmdc:mga08x19_48797_c1
925 nmdc:mga08x19_59198_c1
926 nmdc:mga0a205_1033466_c1
927 nmdc:mga0a205_424561_c1
928 nmdc:mga0a205_586353_c1
929 nmdc:mga0a205_80262_c1
930 nmdc:mga0a205_9101_c1
931 Ga0495601_0001361
932 Ga0495601_0003988
933 Ga0495601_0761472
934 Ga0495612_0006712
935 Ga0495595_0019947
936 Ga0495619_0004465
937 Ga0495619_0064887
938 Ga0495619_0212995
939 Ga0501084_0003212
940 Ga0501082_0000612
941 Ga0530510_0005685
942 Ga0530510_0238882

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

38

132

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kq2-assembly1.cif.gz_A 1.98 a resolution crystal structure of group a streptococcus h111a hupz-v5-his6 0.8407 4 137
7kq2-assembly1.cif.gz_A 1.98 a resolution crystal structure of group a streptococcus h111a hupz-v5-his6 0.8279 4 137
7kpz-assembly1.cif.gz_A 1.70 a resolution crystal structure of group a streptococcus hupz-v5-his6 0.8218 4 143
2q9k-assembly1.cif.gz_A-2 crystal structure of a putative oxidoreductase (exig_1997) from exiguobacterium sibiricum 255-15 at 1.59 a resolution 0.82 1 137
7kpz-assembly1.cif.gz_A 1.70 a resolution crystal structure of group a streptococcus hupz-v5-his6 0.8043 4 143
ID Description Score Start End Superfamily
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.828 4 137 2.30.110.10
2htdA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8216 1 135 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8093 4 137 2.30.110.10
2q9kA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7969 1 137 2.30.110.10
af_Q57730_15_149_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7932 4 137 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A537S4G7-F1-model_v4 Pyridoxamine 5'-phosphate oxidase putative domain-containing protein 0.9708 1 143
AF-A0A2V6WUG9-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9695 1 142
AF-A0A537S4G7-F1-model_v4 Pyridoxamine 5'-phosphate oxidase putative domain-containing protein 0.9642 1 143
AF-A0A382X6T1-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9572 4 143
AF-A0A2V6WUG9-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9563 1 142

Map