F450533

General Info

Members Datasets Scaffolds Average Seq Length
471 244 942 120

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100179243|Ga0070689_1001792433
Length 146
Sequence MILRERLSRAEDQDXXXESLKESNAPMEKIRLSDKFASFTEHWRPKIVGELNGQEVKVVKFKGEFLWHHHEKEDEMFLVWRGRMRVEFRDHAIELEPGEFLIVPHGIEHRTVADEEVEVVLFEPAETKNTGNKSDDRFTAPAGVRI

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
165 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
187 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
242 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.67
Rhizosphere 94.27
Stem 0
Stem Tuber 0
Unclassified 29.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100179243 3300005340 Bacteria 1720
2 MBSR1b_contig_7426034 2162886012 Bacteria 1205
3 CNXas_1000118 3300000545 Bacteria 14285
4 Ga0065712_10182539 3300005290 Bacteria 1178
5 Ga0065715_10032146 3300005293 Unclassified 2499
6 Ga0065715_10159298 3300005293 Bacteria 1645
7 Ga0065715_10216071 3300005293 Unclassified 1292
8 Ga0065715_10322594 3300005293 Archaea 999
9 Ga0065707_10020784 3300005295 Unclassified 2266
10 Ga0065707_10097020 3300005295 Bacteria 3211
11 Ga0065707_10435570 3300005295 Bacteria 815
12 Ga0070658_10463010 3300005327 Unclassified 1093
13 Ga0070676_10001261 3300005328 Bacteria 12747
14 Ga0070676_10244929 3300005328 Bacteria 1194
15 Ga0070676_10704150 3300005328 Unclassified 738
16 Ga0070683_100017295 3300005329 Bacteria 6371
17 Ga0070683_100102876 3300005329 Unclassified 2690
18 Ga0070690_100045879 3300005330 Bacteria 2777
19 Ga0070690_100119262 3300005330 Bacteria 1769
20 Ga0070690_100123904 3300005330 Bacteria 1738
21 Ga0070670_100012155 3300005331 Bacteria 7365
22 Ga0070670_100174099 3300005331 Bacteria 1867
23 Ga0070677_10362238 3300005333 Unclassified 754
24 Ga0068869_100019956 3300005334 Bacteria 4589
25 Ga0068869_100044241 3300005334 Bacteria 3201
26 Ga0070666_10008581 3300005335 Bacteria 6351
27 Ga0070666_10039304 3300005335 Bacteria 3152
28 Ga0070666_10182145 3300005335 Bacteria 1474
29 Ga0070666_10373299 3300005335 Bacteria 1023
30 Ga0070680_100324963 3300005336 Archaea 1306
31 Ga0068868_100004994 3300005338 Bacteria 9319
32 Ga0068868_100020641 3300005338 Bacteria 4954
33 Ga0070660_100063552 3300005339 Unclassified 2870
34 Ga0070660_100376922 3300005339 Archaea 1171
35 Ga0070689_100017702 3300005340 Bacteria 5240
36 Ga0070687_100006863 3300005343 Unclassified 4700
37 Ga0070661_100016263 3300005344 Bacteria 5257
38 Ga0070661_100056285 3300005344 Unclassified 2881
39 Ga0070692_10002089 3300005345 Bacteria 7619
40 Ga0070668_100003157 3300005347 Bacteria 12145
41 Ga0070668_100042682 3300005347 Bacteria 3476
42 Ga0070668_100220507 3300005347 Bacteria 1564
43 Ga0070668_100356757 3300005347 Bacteria 1239
44 Ga0070669_100002625 3300005353 Bacteria 12995
45 Ga0070669_100004330 3300005353 Bacteria 10253
46 Ga0070675_100016943 3300005354 Bacteria 5787
47 Ga0070675_100136878 3300005354 Bacteria 2090
48 Ga0070671_100176624 3300005355 Bacteria 1807
49 Ga0070671_100498830 3300005355 Unclassified 1047
50 Ga0070671_100831257 3300005355 Unclassified 805
51 Ga0070674_100032279 3300005356 Unclassified 3477
52 Ga0070674_100220536 3300005356 Bacteria 1475
53 Ga0070674_101615187 3300005356 Unclassified 585
54 Ga0070673_100113899 3300005364 Unclassified 2246
55 Ga0070688_100030983 3300005365 Bacteria 3214
56 Ga0070688_100033881 3300005365 Bacteria 3089
57 Ga0070659_100005302 3300005366 Bacteria 9247
58 Ga0070659_100195844 3300005366 Archaea 1662
59 Ga0070659_100274204 3300005366 Bacteria 1402
60 Ga0070659_100896015 3300005366 Bacteria 775
61 Ga0070667_100027182 3300005367 Bacteria 4761
62 Ga0070667_100033446 3300005367 Unclassified 4297
63 Ga0070667_100107600 3300005367 Unclassified 2415
64 Ga0070667_100785854 3300005367 Bacteria 883
65 Ga0070667_101231633 3300005367 Unclassified 701
66 Ga0070703_10182838 3300005406 Bacteria 811
67 Ga0070703_10338637 3300005406 Unclassified 638
68 Ga0070701_10013674 3300005438 Unclassified 3698
69 Ga0070701_10447748 3300005438 Bacteria 828
70 Ga0070701_11027431 3300005438 Unclassified 576
71 Ga0070705_100098299 3300005440 Bacteria 1841
72 Ga0070705_101308786 3300005440 Unclassified 601
73 Ga0070700_100081525 3300005441 Bacteria 2090
74 Ga0070694_100147112 3300005444 Bacteria 1717
75 Ga0070694_100207440 3300005444 Unclassified 1464
76 Ga0070663_100145461 3300005455 Bacteria 1813
77 Ga0070663_100289455 3300005455 Bacteria 1308
78 Ga0070663_100666752 3300005455 Bacteria 881
79 Ga0070663_101022905 3300005455 Unclassified 719
80 Ga0070662_100013923 3300005457 Bacteria 5359
81 Ga0070662_100015252 3300005457 Bacteria 5143
82 Ga0070662_100207579 3300005457 Bacteria 1557
83 Ga0070662_100344046 3300005457 Bacteria 1221
84 Ga0070662_100405849 3300005457 Unclassified 1125
85 Ga0070662_100863611 3300005457 Bacteria 771
86 Ga0070681_10001036 3300005458 Bacteria 23580
87 Ga0068867_100024618 3300005459 Bacteria 4314
88 Ga0068867_100033433 3300005459 Unclassified 3724
89 Ga0068867_100673915 3300005459 Unclassified 910
90 Ga0068867_101465968 3300005459 Bacteria 635
91 Ga0070685_10031803 3300005466 Unclassified 2951
92 Ga0070706_100258362 3300005467 Bacteria 1626
93 Ga0070679_100005830 3300005530 Bacteria 11426
94 Ga0070684_100169826 3300005535 Archaea 1981
95 Ga0070684_100383700 3300005535 Bacteria 1294
96 Ga0070697_100571583 3300005536 Bacteria 992
97 Ga0068853_100027626 3300005539 Unclassified 4768
98 Ga0068853_100450989 3300005539 Bacteria 1210
99 Ga0070672_100064552 3300005543 Bacteria 2893
100 Ga0070672_100076138 3300005543 Bacteria 2680
101 Ga0070672_100092373 3300005543 Bacteria 2443
102 Ga0070672_100638433 3300005543 Bacteria 929
103 Ga0070672_100808294 3300005543 Bacteria 825
104 Ga0070686_100090746 3300005544 Unclassified 2043
105 Ga0070686_100092230 3300005544 Bacteria 2028
106 Ga0070686_101021189 3300005544 Bacteria 679
107 Ga0070695_100024058 3300005545 Bacteria 3750
108 Ga0070695_100314533 3300005545 Bacteria 1162
109 Ga0070696_100026707 3300005546 Bacteria 3929
110 Ga0070693_100050488 3300005547 Unclassified 2378
111 Ga0070665_100000029 3300005548 Bacteria 342699
112 Ga0070665_100067616 3300005548 Unclassified 3583
113 Ga0070665_100273552 3300005548 Bacteria 1691
114 Ga0070704_100079759 3300005549 Bacteria 2406
115 Ga0070704_100680210 3300005549 Unclassified 911
116 Ga0070704_102094252 3300005549 Unclassified 526
117 Ga0068855_100017181 3300005563 Bacteria 8706
118 Ga0068855_100951168 3300005563 Unclassified 905
119 Ga0070664_100000800 3300005564 Bacteria 24260
120 Ga0070664_100250714 3300005564 Bacteria 1591
121 Ga0068857_100004231 3300005577 Bacteria 12095
122 Ga0068857_100419171 3300005577 Bacteria 1248
123 Ga0068854_100072346 3300005578 Unclassified 2524
124 Ga0068854_100329996 3300005578 Unclassified 1243
125 Ga0068856_100244566 3300005614 Unclassified 1809
126 Ga0068856_102268095 3300005614 Unclassified 551
127 Ga0070702_100345426 3300005615 Bacteria 1046
128 Ga0068852_100003640 3300005616 Bacteria 10796
129 Ga0068852_100397532 3300005616 Unclassified 1355
130 Ga0068852_100689347 3300005616 Archaea 1031
131 Ga0068859_100274474 3300005617 Bacteria 1778
132 Ga0068864_100500546 3300005618 Bacteria 1169
133 Ga0068866_10032368 3300005718 Unclassified 2528
134 Ga0068861_100005059 3300005719 Bacteria 8896
135 Ga0068861_100971372 3300005719 Bacteria 809
136 Ga0068861_101691930 3300005719 Unclassified 625
137 Ga0068851_10011996 3300005834 Unclassified 4077
138 Ga0068851_10026219 3300005834 Unclassified 2862
139 Ga0068851_10181947 3300005834 Bacteria 1165
140 Ga0068870_10035628 3300005840 Unclassified 2555
141 Ga0068870_10933139 3300005840 Archaea 615
142 Ga0068863_100016523 3300005841 Bacteria 7080
143 Ga0068863_100126271 3300005841 Bacteria 2440
144 Ga0068863_100305375 3300005841 Bacteria 1544
145 Ga0068863_100587165 3300005841 Bacteria 1102
146 Ga0068858_100028342 3300005842 Bacteria 5203
147 Ga0068858_100050236 3300005842 Bacteria 3859
148 Ga0068858_100243702 3300005842 Bacteria 1706
149 Ga0068858_101286311 3300005842 Unclassified 720
150 Ga0068860_100570157 3300005843 Unclassified 1135
151 Ga0068860_100707670 3300005843 Bacteria 1017
152 Ga0068860_100783574 3300005843 Bacteria 966
153 Ga0068862_100099603 3300005844 Bacteria 2541
154 Ga0068862_100240066 3300005844 Bacteria 1647
155 Ga0068862_100249403 3300005844 Bacteria 1617
156 Ga0068862_100932882 3300005844 Unclassified 855
157 Ga0081539_10000727 3300005985 Bacteria 66016
158 Ga0081539_10002432 3300005985 Bacteria 26284
159 Ga0070716_101339882 3300006173 Bacteria 580
160 Ga0070712_101178594 3300006175 Unclassified 666
161 Ga0097621_100074183 3300006237 Bacteria 2818
162 Ga0097621_100196088 3300006237 Unclassified 1751
163 Ga0097621_101257617 3300006237 Unclassified 698
164 Ga0068871_100582635 3300006358 Unclassified 1016
165 Ga0068871_101233254 3300006358 Unclassified 702
166 Ga0075428_100124074 3300006844 Bacteria 2811
167 Ga0075428_100355577 3300006844 Bacteria 1572
168 Ga0075428_101532038 3300006844 Unclassified 698
169 Ga0075430_100067925 3300006846 Bacteria 2991
170 Ga0075430_101679183 3300006846 Bacteria 521
171 Ga0075431_100049084 3300006847 Bacteria 4353
172 Ga0075431_100263027 3300006847 Unclassified 1750
173 Ga0075431_100481194 3300006847 Bacteria 1234
174 Ga0075433_10170880 3300006852 Bacteria 1934
175 Ga0075433_10201350 3300006852 Bacteria 1770
176 Ga0075433_10256199 3300006852 Bacteria 1552
177 Ga0075433_11184189 3300006852 Unclassified 663
178 Ga0075434_100005288 3300006871 Bacteria 11739
179 Ga0075434_100039254 3300006871 Bacteria 4691
180 Ga0075434_100067232 3300006871 Bacteria 3570
181 Ga0075434_100173265 3300006871 Unclassified 2178
182 Ga0075429_100063805 3300006880 Unclassified 3209
183 Ga0075429_100476382 3300006880 Bacteria 1094
184 Ga0075429_101479942 3300006880 Unclassified 591
185 Ga0068865_100012108 3300006881 Bacteria 5422
186 Ga0068865_100584775 3300006881 Bacteria 942
187 Ga0068865_100845300 3300006881 Unclassified 793
188 Ga0097620_100230240 3300006931 Bacteria 1941
189 Ga0097620_100274455 3300006931 Bacteria 1778
190 Ga0111539_10087283 3300009094 Unclassified 3665
191 Ga0111539_10101028 3300009094 Bacteria 3386
192 Ga0111539_10288383 3300009094 Bacteria 1910
193 Ga0111539_10374166 3300009094 Bacteria 1658
194 Ga0111539_10860084 3300009094 Bacteria 1055
195 Ga0105245_10068278 3300009098 Unclassified 3221
196 Ga0105247_10791166 3300009101 Unclassified 723
197 Ga0114129_10006906 3300009147 Bacteria 16149
198 Ga0114129_10371539 3300009147 Bacteria 1890
199 Ga0114129_11351492 3300009147 Unclassified 881
200 Ga0114129_11922572 3300009147 Unclassified 717
201 Ga0105241_11386578 3300009174 Unclassified 672
202 Ga0105242_10936840 3300009176 Bacteria 869
203 Ga0105248_10009398 3300009177 Bacteria 10765
204 Ga0105248_10027137 3300009177 Bacteria 6371
205 Ga0105248_10445144 3300009177 Unclassified 1460
206 Ga0105248_11465606 3300009177 Bacteria 772
207 Ga0105248_13012096 3300009177 Unclassified 537
208 Ga0105237_10064083 3300009545 Bacteria 3672
209 Ga0105249_10004486 3300009553 Bacteria 12069
210 Ga0105249_10049393 3300009553 Bacteria 3837
211 Ga0105249_10273228 3300009553 Bacteria 1684
212 Ga0105249_10871037 3300009553 Unclassified 967
213 Ga0105239_10031594 3300010375 Bacteria 5821
214 Ga0105239_10055105 3300010375 Unclassified 4361
215 Ga0105246_10431769 3300011119 Unclassified 1102
216 Ga0105246_10870755 3300011119 Bacteria 805
217 Ga0157373_10911403 3300013100 Unclassified 653
218 Ga0157373_11305389 3300013100 Archaea 549
219 Ga0157371_10021790 3300013102 Bacteria 4700
220 Ga0157369_10627096 3300013105 Unclassified 1109
221 Ga0157374_10203454 3300013296 Bacteria 1939
222 Ga0157374_10847726 3300013296 Bacteria 931
223 Ga0157378_10119554 3300013297 Bacteria 2426
224 Ga0157378_10330548 3300013297 Unclassified 1483
225 Ga0163162_10006192 3300013306 Bacteria 11592
226 Ga0163162_10040881 3300013306 Bacteria 4638
227 Ga0163162_10254873 3300013306 Bacteria 1886
228 Ga0163162_10494104 3300013306 Bacteria 1354
229 Ga0163162_11004222 3300013306 Bacteria 943
230 Ga0157372_10531905 3300013307 Bacteria 1370
231 Ga0157375_10005648 3300013308 Bacteria 10891
232 Ga0157375_10050883 3300013308 Bacteria 4065
233 Ga0157375_10432505 3300013308 Bacteria 1482
234 Ga0157375_12717919 3300013308 Unclassified 592
235 Ga0157380_10006377 3300014326 Bacteria 8302
236 Ga0157377_10005554 3300014745 Bacteria 5936
237 Ga0157377_10024856 3300014745 Unclassified 3188
238 Ga0157377_10889013 3300014745 Unclassified 665
239 Ga0157379_10006375 3300014968 Bacteria 10161
240 Ga0157379_10123430 3300014968 Bacteria 2330
241 Ga0182007_10113705 3300015262 Bacteria 902
242 Ga0182005_1202134 3300015265 Bacteria 598
243 Ga0163161_10089878 3300017792 Bacteria 2272
244 Ga0163161_10150080 3300017792 Bacteria 1771
245 Ga0207673_1026463 3300025290 Archaea 795
246 Ga0207697_10008057 3300025315 Unclassified 4649
247 Ga0207656_10001072 3300025321 Bacteria 8953
248 Ga0207656_10045859 3300025321 Bacteria 1873
249 Ga0207653_10190085 3300025885 Bacteria 771
250 Ga0207682_10456982 3300025893 Unclassified 605
251 Ga0207642_10181007 3300025899 Unclassified 1148
252 Ga0207710_10603436 3300025900 Unclassified 573
253 Ga0207688_10035429 3300025901 Bacteria 2765
254 Ga0207680_10129835 3300025903 Unclassified 1660
255 Ga0207680_10238422 3300025903 Bacteria 1252
256 Ga0207680_10459148 3300025903 Unclassified 904
257 Ga0207647_10060039 3300025904 Unclassified 2325
258 Ga0207645_10001371 3300025907 Bacteria 20008
259 Ga0207645_10140417 3300025907 Bacteria 1574
260 Ga0207645_10532934 3300025907 Unclassified 796
261 Ga0207643_10002454 3300025908 Bacteria 10012
262 Ga0207684_10282756 3300025910 Bacteria 1431
263 Ga0207707_10008363 3300025912 Bacteria 8978
264 Ga0207671_10081196 3300025914 Bacteria 2431
265 Ga0207693_11028664 3300025915 Unclassified 628
266 Ga0207662_10004255 3300025918 Bacteria 7508
267 Ga0207657_10075184 3300025919 Archaea 2851
268 Ga0207657_10131184 3300025919 Bacteria 2054
269 Ga0207649_10001797 3300025920 Bacteria 12268
270 Ga0207649_10054738 3300025920 Unclassified 2484
271 Ga0207649_11259959 3300025920 Bacteria 585
272 Ga0207649_11652439 3300025920 Unclassified 507
273 Ga0207681_10006625 3300025923 Bacteria 7112
274 Ga0207650_10420592 3300025925 Bacteria 1109
275 Ga0207650_10424410 3300025925 Archaea 1104
276 Ga0207659_10025984 3300025926 Bacteria 3944
277 Ga0207659_10037803 3300025926 Bacteria 3354
278 Ga0207687_10105717 3300025927 Unclassified 2080
279 Ga0207644_10121180 3300025931 Bacteria 1991
280 Ga0207644_10782159 3300025931 Unclassified 798
281 Ga0207644_10795871 3300025931 Bacteria 791
282 Ga0207690_10043816 3300025932 Bacteria 2947
283 Ga0207690_10140047 3300025932 Bacteria 1781
284 Ga0207690_10566568 3300025932 Bacteria 925
285 Ga0207706_10000484 3300025933 Bacteria 42586
286 Ga0207706_10060568 3300025933 Unclassified 3333
287 Ga0207706_10320361 3300025933 Bacteria 1349
288 Ga0207706_10408727 3300025933 Unclassified 1176
289 Ga0207686_11068131 3300025934 Unclassified 657
290 Ga0207670_10107631 3300025936 Bacteria 2002
291 Ga0207670_10698939 3300025936 Unclassified 839
292 Ga0207669_10074402 3300025937 Bacteria 2148
293 Ga0207669_10112575 3300025937 Bacteria 1827
294 Ga0207704_10075345 3300025938 Bacteria 2157
295 Ga0207704_10079219 3300025938 Bacteria 2116
296 Ga0207704_10398845 3300025938 Bacteria 1085
297 Ga0207691_10001559 3300025940 Bacteria 22752
298 Ga0207691_10003135 3300025940 Bacteria 16151
299 Ga0207691_10003727 3300025940 Bacteria 14793
300 Ga0207711_10291062 3300025941 Bacteria 1505
301 Ga0207711_10757049 3300025941 Archaea 905
302 Ga0207711_10825503 3300025941 Bacteria 863
303 Ga0207711_10955967 3300025941 Bacteria 796
304 Ga0207689_10006936 3300025942 Bacteria 9962
305 Ga0207661_10017772 3300025944 Bacteria 5270
306 Ga0207661_10143366 3300025944 Bacteria 2058
307 Ga0207661_10173907 3300025944 Unclassified 1876
308 Ga0207679_10002468 3300025945 Bacteria 11388
309 Ga0207679_10055572 3300025945 Bacteria 2919
310 Ga0207679_10135368 3300025945 Bacteria 1983
311 Ga0207667_10037180 3300025949 Bacteria 5206
312 Ga0207667_10109306 3300025949 Unclassified 2851
313 Ga0207667_10443528 3300025949 Unclassified 1319
314 Ga0207651_10080749 3300025960 Bacteria 2342
315 Ga0207651_10154230 3300025960 Bacteria 1792
316 Ga0207651_10694375 3300025960 Unclassified 896
317 Ga0207712_10103221 3300025961 Bacteria 2124
318 Ga0207712_10315702 3300025961 Bacteria 1287
319 Ga0207668_10014881 3300025972 Bacteria 4824
320 Ga0207668_10109364 3300025972 Bacteria 2070
321 Ga0207668_10119010 3300025972 Bacteria 1996
322 Ga0207668_11874404 3300025972 Bacteria 541
323 Ga0207640_10164827 3300025981 Bacteria 1644
324 Ga0207640_10792752 3300025981 Unclassified 820
325 Ga0207658_10140493 3300025986 Bacteria 1953
326 Ga0207658_10896858 3300025986 Bacteria 807
327 Ga0207658_11227741 3300025986 Unclassified 685
328 Ga0207677_10018795 3300026023 Bacteria 4156
329 Ga0207703_10265023 3300026035 Bacteria 1554
330 Ga0207703_10490914 3300026035 Bacteria 1152
331 Ga0207639_10043197 3300026041 Bacteria 3382
332 Ga0207639_10501673 3300026041 Bacteria 1109
333 Ga0207639_10789545 3300026041 Archaea 884
334 Ga0207678_10013268 3300026067 Bacteria 7230
335 Ga0207678_10786173 3300026067 Bacteria 840
336 Ga0207708_10001962 3300026075 Bacteria 15173
337 Ga0207708_10016265 3300026075 Bacteria 5590
338 Ga0207702_10261032 3300026078 Bacteria 1631
339 Ga0207641_10180664 3300026088 Unclassified 1932
340 Ga0207641_10904787 3300026088 Unclassified 876
341 Ga0207641_11438507 3300026088 Bacteria 691
342 Ga0207648_10115830 3300026089 Bacteria 2355
343 Ga0207648_10121015 3300026089 Bacteria 2302
344 Ga0207648_10183216 3300026089 Unclassified 1854
345 Ga0207676_10467238 3300026095 Bacteria 1192
346 Ga0207674_10001124 3300026116 Bacteria 34688
347 Ga0207674_10002079 3300026116 Bacteria 25379
348 Ga0207675_100000290 3300026118 Bacteria 48423
349 Ga0207675_100108521 3300026118 Bacteria 2618
350 Ga0207683_10137620 3300026121 Bacteria 2199
351 Ga0207698_10064512 3300026142 Unclassified 2871
352 Ga0207698_10488986 3300026142 Archaea 1195
353 Ga0207698_10652488 3300026142 Unclassified 1043
354 Ga0268266_10000109 3300028379 Bacteria 171899
355 Ga0268266_10909997 3300028379 Bacteria 851
356 Ga0268265_10185887 3300028380 Bacteria 1790
357 Ga0268265_10346630 3300028380 Bacteria 1354
358 Ga0268265_11031565 3300028380 Unclassified 814
359 Ga0268264_10073884 3300028381 Unclassified 2895
360 Ga0268264_10269538 3300028381 Bacteria 1590
361 Ga0265322_10000036 3300028654 Bacteria 79374
362 Ga0265332_10200668 3300031238 Unclassified 829
363 Ga0307513_10055591 3300031456 Bacteria 4234
364 Ga0307513_10261310 3300031456 Bacteria 1521
365 Ga0307509_10098663 3300031507 Bacteria 2965
366 Ga0307408_100008301 3300031548 Bacteria 6855
367 Ga0307508_10004206 3300031616 Bacteria 14153
368 Ga0265314_10259236 3300031711 Unclassified 994
369 Ga0307413_10785922 3300031824 Unclassified 799
370 Ga0307406_10013869 3300031901 Bacteria 4626
371 Ga0307407_10322674 3300031903 Unclassified 1084
372 Ga0307407_10504908 3300031903 Bacteria 887
373 Ga0307412_10322462 3300031911 Bacteria 1230
374 Ga0307409_100304270 3300031995 Bacteria 1485
375 Ga0307414_10232234 3300032004 Bacteria 1522
376 Ga0307411_11385947 3300032005 Unclassified 643
377 Ga0307415_101723473 3300032126 Unclassified 605
378 Ga0373936_0174460 3300035113 Unclassified 941
379 Ga0373956_0106914 3300035119 Bacteria 1301
380 Ga0373955_0055722 3300035172 Bacteria 2166
381 Ga0373961_0062624 3300035241 Bacteria 1133
382 Ga0373935_0181905 3300035692 Bacteria 1444
383 Ga0373937_0036157 3300036401 Bacteria 4499
384 Ga0373937_0213733 3300036401 Bacteria 1815
385 Ga0395905_1042997 3300037471 Bacteria 721
386 Ga0451833_0113083 3300041491 Unclassified 550
387 Ga0439450_125019 3300042008 Unclassified 664
388 Ga0451577_0000637 3300042876 Bacteria 55995
389 Ga0453684_0006282 3300044712 Bacteria 22728
390 Ga0451576_0017093 3300045051 Bacteria 7982
391 Ga0451576_0088130 3300045051 Bacteria 3228
392 Ga0451576_2190683 3300045051 Unclassified 567
393 Ga0495592_0052898 3300046454 Bacteria 3013
394 Ga0495629_0314410 3300046459 Bacteria 1071
395 Ga0495638_0022593 3300046460 Bacteria 4128
396 Ga0495651_0008237 3300046462 Bacteria 7989
397 Ga0495580_0182398 3300046472 Bacteria 1449
398 Ga0495582_0418260 3300046473 Bacteria 773
399 Ga0495662_0346812 3300046476 Unclassified 730
400 Ga0495664_0070085 3300046477 Unclassified 2093
401 Ga0495618_0114219 3300046514 Bacteria 1729
402 Ga0495630_0055240 3300046517 Bacteria 2976
403 Ga0495652_0012089 3300046529 Bacteria 7800
404 Ga0495640_0682370 3300046533 Unclassified 617
405 Ga0495645_0267929 3300046543 Bacteria 1128
406 Ga0495599_0141625 3300046678 Bacteria 1492
407 Ga0495658_0013247 3300046683 Unclassified 4196
408 Ga0495669_0181278 3300046684 Bacteria 1004
409 Ga0495604_0336022 3300047317 Unclassified 1007
410 Ga0495674_0027447 3300047319 Bacteria 5204
411 Ga0495675_0025723 3300047444 Bacteria 3751
412 Ga0495602_0814244 3300048088 Unclassified 626
413 Ga0496100_0318719 3300048903 Bacteria 1167
414 Ga0496102_0026136 3300048905 Bacteria 5203
415 Ga0496102_1412920 3300048905 Unclassified 615
416 Ga0496103_0010941 3300048906 Bacteria 5370
417 Ga0496104_0718625 3300048907 Bacteria 906
418 Ga0496106_0063590 3300048909 Bacteria 2805
419 Ga0496106_0408254 3300048909 Bacteria 1092
420 Ga0496107_0049453 3300048910 Bacteria 3030
421 Ga0496108_0062923 3300048911 Bacteria 3124
422 Ga0496108_0171320 3300048911 Bacteria 1878
423 Ga0496109_0065261 3300048912 Bacteria 3332
424 Ga0496109_0565636 3300048912 Bacteria 1072
425 Ga0496110_0309711 3300048913 Bacteria 1438
426 Ga0496111_0011165 3300048914 Bacteria 6046
427 Ga0496112_0066209 3300048915 Bacteria 3565
428 Ga0496112_0192755 3300048915 Bacteria 1999
429 Ga0496112_0548576 3300048915 Bacteria 1090
430 Ga0496113_0075889 3300048916 Bacteria 2566
431 Ga0496113_1318331 3300048916 Unclassified 561
432 Ga0496114_0074744 3300048917 Bacteria 2853
433 Ga0496115_0000724 3300048918 Bacteria 24437
434 Ga0496115_0159850 3300048918 Bacteria 1862
435 Ga0501293_001991 3300049516 Unclassified 1544
436 Ga0501042_0065164 3300049578 Unclassified 2604
437 Ga0501048_0132463 3300049582 Bacteria 1762
438 Ga0501069_0276189 3300049585 Unclassified 983
439 Ga0501072_0772407 3300049588 Bacteria 753
440 Ga0501077_0337020 3300049593 Unclassified 962
441 Ga0501077_0564149 3300049593 Bacteria 731
442 Ga0501080_0258169 3300049742 Bacteria 1588
443 Ga0501035_1198129 3300049822 Unclassified 589
444 Ga0501045_0062926 3300049824 Unclassified 2723
445 nmdc:mga05p37_305290_c1 3300050507 Unclassified 1889
446 nmdc:mga05p37_54938_c1 3300050507 Unclassified 4899
447 nmdc:mga05p37_910469_c1 3300050507 Unclassified 947
448 nmdc:mga09592_75579_c1 3300050508 Bacteria 2864
449 nmdc:mga0qj67_1311972_c1 3300050509 Unclassified 560
450 nmdc:mga0qj67_22111_c1 3300050509 Bacteria 4882
451 nmdc:mga06r32_1316010_c1 3300050510 Unclassified 666
452 nmdc:mga06r32_285900_c1 3300050510 Bacteria 1636
453 nmdc:mga06r32_461496_c1 3300050510 Bacteria 1249
454 nmdc:mga06r32_493487_c1 3300050510 Bacteria 1202
455 nmdc:mga06r32_62573_c1 3300050510 Bacteria 3585
456 nmdc:mga06r32_734020_c1 3300050510 Bacteria 951
457 nmdc:mga08y16_165679_c1 3300050511 Bacteria 2296
458 nmdc:mga08y16_536303_c1 3300050511 Unclassified 1185
459 nmdc:mga08y16_883962_c1 3300050511 Unclassified 881
460 nmdc:mga0n895_1750690_c1 3300050512 Unclassified 583
461 nmdc:mga0n895_46075_c1 3300050512 Bacteria 3711
462 nmdc:mga0n895_5356_c1 3300050512 Bacteria 10699
463 nmdc:mga0a205_1032079_c1 3300050515 Unclassified 669
464 nmdc:mga0a205_108281_c1 3300050515 Bacteria 2677
465 nmdc:mga0a205_238151_c1 3300050515 Bacteria 1701
466 nmdc:mga0a205_567709_c1 3300050515 Bacteria 989
467 nmdc:mga0a205_58263_c1 3300050515 Bacteria 3730
468 Ga0495595_0025475 3300053084 Bacteria 2622
469 Ga0590071_025445 3300059421 Bacteria 1403
470 Ga0590075_203883 3300059424 Bacteria 524
471 Ga0530510_1206461 3300061734 Bacteria 580
472 Ga0070689_100179243
473 MBSR1b_contig_7426034
474 CNXas_1000118
475 Ga0065712_10182539
476 Ga0065715_10032146
477 Ga0065715_10159298
478 Ga0065715_10216071
479 Ga0065715_10322594
480 Ga0065707_10020784
481 Ga0065707_10097020
482 Ga0065707_10435570
483 Ga0070658_10463010
484 Ga0070676_10001261
485 Ga0070676_10244929
486 Ga0070676_10704150
487 Ga0070683_100017295
488 Ga0070683_100102876
489 Ga0070690_100045879
490 Ga0070690_100119262
491 Ga0070690_100123904
492 Ga0070670_100012155
493 Ga0070670_100174099
494 Ga0070677_10362238
495 Ga0068869_100019956
496 Ga0068869_100044241
497 Ga0070666_10008581
498 Ga0070666_10039304
499 Ga0070666_10182145
500 Ga0070666_10373299
501 Ga0070680_100324963
502 Ga0068868_100004994
503 Ga0068868_100020641
504 Ga0070660_100063552
505 Ga0070660_100376922
506 Ga0070689_100017702
507 Ga0070687_100006863
508 Ga0070661_100016263
509 Ga0070661_100056285
510 Ga0070692_10002089
511 Ga0070668_100003157
512 Ga0070668_100042682
513 Ga0070668_100220507
514 Ga0070668_100356757
515 Ga0070669_100002625
516 Ga0070669_100004330
517 Ga0070675_100016943
518 Ga0070675_100136878
519 Ga0070671_100176624
520 Ga0070671_100498830
521 Ga0070671_100831257
522 Ga0070674_100032279
523 Ga0070674_100220536
524 Ga0070674_101615187
525 Ga0070673_100113899
526 Ga0070688_100030983
527 Ga0070688_100033881
528 Ga0070659_100005302
529 Ga0070659_100195844
530 Ga0070659_100274204
531 Ga0070659_100896015
532 Ga0070667_100027182
533 Ga0070667_100033446
534 Ga0070667_100107600
535 Ga0070667_100785854
536 Ga0070667_101231633
537 Ga0070703_10182838
538 Ga0070703_10338637
539 Ga0070701_10013674
540 Ga0070701_10447748
541 Ga0070701_11027431
542 Ga0070705_100098299
543 Ga0070705_101308786
544 Ga0070700_100081525
545 Ga0070694_100147112
546 Ga0070694_100207440
547 Ga0070663_100145461
548 Ga0070663_100289455
549 Ga0070663_100666752
550 Ga0070663_101022905
551 Ga0070662_100013923
552 Ga0070662_100015252
553 Ga0070662_100207579
554 Ga0070662_100344046
555 Ga0070662_100405849
556 Ga0070662_100863611
557 Ga0070681_10001036
558 Ga0068867_100024618
559 Ga0068867_100033433
560 Ga0068867_100673915
561 Ga0068867_101465968
562 Ga0070685_10031803
563 Ga0070706_100258362
564 Ga0070679_100005830
565 Ga0070684_100169826
566 Ga0070684_100383700
567 Ga0070697_100571583
568 Ga0068853_100027626
569 Ga0068853_100450989
570 Ga0070672_100064552
571 Ga0070672_100076138
572 Ga0070672_100092373
573 Ga0070672_100638433
574 Ga0070672_100808294
575 Ga0070686_100090746
576 Ga0070686_100092230
577 Ga0070686_101021189
578 Ga0070695_100024058
579 Ga0070695_100314533
580 Ga0070696_100026707
581 Ga0070693_100050488
582 Ga0070665_100000029
583 Ga0070665_100067616
584 Ga0070665_100273552
585 Ga0070704_100079759
586 Ga0070704_100680210
587 Ga0070704_102094252
588 Ga0068855_100017181
589 Ga0068855_100951168
590 Ga0070664_100000800
591 Ga0070664_100250714
592 Ga0068857_100004231
593 Ga0068857_100419171
594 Ga0068854_100072346
595 Ga0068854_100329996
596 Ga0068856_100244566
597 Ga0068856_102268095
598 Ga0070702_100345426
599 Ga0068852_100003640
600 Ga0068852_100397532
601 Ga0068852_100689347
602 Ga0068859_100274474
603 Ga0068864_100500546
604 Ga0068866_10032368
605 Ga0068861_100005059
606 Ga0068861_100971372
607 Ga0068861_101691930
608 Ga0068851_10011996
609 Ga0068851_10026219
610 Ga0068851_10181947
611 Ga0068870_10035628
612 Ga0068870_10933139
613 Ga0068863_100016523
614 Ga0068863_100126271
615 Ga0068863_100305375
616 Ga0068863_100587165
617 Ga0068858_100028342
618 Ga0068858_100050236
619 Ga0068858_100243702
620 Ga0068858_101286311
621 Ga0068860_100570157
622 Ga0068860_100707670
623 Ga0068860_100783574
624 Ga0068862_100099603
625 Ga0068862_100240066
626 Ga0068862_100249403
627 Ga0068862_100932882
628 Ga0081539_10000727
629 Ga0081539_10002432
630 Ga0070716_101339882
631 Ga0070712_101178594
632 Ga0097621_100074183
633 Ga0097621_100196088
634 Ga0097621_101257617
635 Ga0068871_100582635
636 Ga0068871_101233254
637 Ga0075428_100124074
638 Ga0075428_100355577
639 Ga0075428_101532038
640 Ga0075430_100067925
641 Ga0075430_101679183
642 Ga0075431_100049084
643 Ga0075431_100263027
644 Ga0075431_100481194
645 Ga0075433_10170880
646 Ga0075433_10201350
647 Ga0075433_10256199
648 Ga0075433_11184189
649 Ga0075434_100005288
650 Ga0075434_100039254
651 Ga0075434_100067232
652 Ga0075434_100173265
653 Ga0075429_100063805
654 Ga0075429_100476382
655 Ga0075429_101479942
656 Ga0068865_100012108
657 Ga0068865_100584775
658 Ga0068865_100845300
659 Ga0097620_100230240
660 Ga0097620_100274455
661 Ga0111539_10087283
662 Ga0111539_10101028
663 Ga0111539_10288383
664 Ga0111539_10374166
665 Ga0111539_10860084
666 Ga0105245_10068278
667 Ga0105247_10791166
668 Ga0114129_10006906
669 Ga0114129_10371539
670 Ga0114129_11351492
671 Ga0114129_11922572
672 Ga0105241_11386578
673 Ga0105242_10936840
674 Ga0105248_10009398
675 Ga0105248_10027137
676 Ga0105248_10445144
677 Ga0105248_11465606
678 Ga0105248_13012096
679 Ga0105237_10064083
680 Ga0105249_10004486
681 Ga0105249_10049393
682 Ga0105249_10273228
683 Ga0105249_10871037
684 Ga0105239_10031594
685 Ga0105239_10055105
686 Ga0105246_10431769
687 Ga0105246_10870755
688 Ga0157373_10911403
689 Ga0157373_11305389
690 Ga0157371_10021790
691 Ga0157369_10627096
692 Ga0157374_10203454
693 Ga0157374_10847726
694 Ga0157378_10119554
695 Ga0157378_10330548
696 Ga0163162_10006192
697 Ga0163162_10040881
698 Ga0163162_10254873
699 Ga0163162_10494104
700 Ga0163162_11004222
701 Ga0157372_10531905
702 Ga0157375_10005648
703 Ga0157375_10050883
704 Ga0157375_10432505
705 Ga0157375_12717919
706 Ga0157380_10006377
707 Ga0157377_10005554
708 Ga0157377_10024856
709 Ga0157377_10889013
710 Ga0157379_10006375
711 Ga0157379_10123430
712 Ga0182007_10113705
713 Ga0182005_1202134
714 Ga0163161_10089878
715 Ga0163161_10150080
716 Ga0207673_1026463
717 Ga0207697_10008057
718 Ga0207656_10001072
719 Ga0207656_10045859
720 Ga0207653_10190085
721 Ga0207682_10456982
722 Ga0207642_10181007
723 Ga0207710_10603436
724 Ga0207688_10035429
725 Ga0207680_10129835
726 Ga0207680_10238422
727 Ga0207680_10459148
728 Ga0207647_10060039
729 Ga0207645_10001371
730 Ga0207645_10140417
731 Ga0207645_10532934
732 Ga0207643_10002454
733 Ga0207684_10282756
734 Ga0207707_10008363
735 Ga0207671_10081196
736 Ga0207693_11028664
737 Ga0207662_10004255
738 Ga0207657_10075184
739 Ga0207657_10131184
740 Ga0207649_10001797
741 Ga0207649_10054738
742 Ga0207649_11259959
743 Ga0207649_11652439
744 Ga0207681_10006625
745 Ga0207650_10420592
746 Ga0207650_10424410
747 Ga0207659_10025984
748 Ga0207659_10037803
749 Ga0207687_10105717
750 Ga0207644_10121180
751 Ga0207644_10782159
752 Ga0207644_10795871
753 Ga0207690_10043816
754 Ga0207690_10140047
755 Ga0207690_10566568
756 Ga0207706_10000484
757 Ga0207706_10060568
758 Ga0207706_10320361
759 Ga0207706_10408727
760 Ga0207686_11068131
761 Ga0207670_10107631
762 Ga0207670_10698939
763 Ga0207669_10074402
764 Ga0207669_10112575
765 Ga0207704_10075345
766 Ga0207704_10079219
767 Ga0207704_10398845
768 Ga0207691_10001559
769 Ga0207691_10003135
770 Ga0207691_10003727
771 Ga0207711_10291062
772 Ga0207711_10757049
773 Ga0207711_10825503
774 Ga0207711_10955967
775 Ga0207689_10006936
776 Ga0207661_10017772
777 Ga0207661_10143366
778 Ga0207661_10173907
779 Ga0207679_10002468
780 Ga0207679_10055572
781 Ga0207679_10135368
782 Ga0207667_10037180
783 Ga0207667_10109306
784 Ga0207667_10443528
785 Ga0207651_10080749
786 Ga0207651_10154230
787 Ga0207651_10694375
788 Ga0207712_10103221
789 Ga0207712_10315702
790 Ga0207668_10014881
791 Ga0207668_10109364
792 Ga0207668_10119010
793 Ga0207668_11874404
794 Ga0207640_10164827
795 Ga0207640_10792752
796 Ga0207658_10140493
797 Ga0207658_10896858
798 Ga0207658_11227741
799 Ga0207677_10018795
800 Ga0207703_10265023
801 Ga0207703_10490914
802 Ga0207639_10043197
803 Ga0207639_10501673
804 Ga0207639_10789545
805 Ga0207678_10013268
806 Ga0207678_10786173
807 Ga0207708_10001962
808 Ga0207708_10016265
809 Ga0207702_10261032
810 Ga0207641_10180664
811 Ga0207641_10904787
812 Ga0207641_11438507
813 Ga0207648_10115830
814 Ga0207648_10121015
815 Ga0207648_10183216
816 Ga0207676_10467238
817 Ga0207674_10001124
818 Ga0207674_10002079
819 Ga0207675_100000290
820 Ga0207675_100108521
821 Ga0207683_10137620
822 Ga0207698_10064512
823 Ga0207698_10488986
824 Ga0207698_10652488
825 Ga0268266_10000109
826 Ga0268266_10909997
827 Ga0268265_10185887
828 Ga0268265_10346630
829 Ga0268265_11031565
830 Ga0268264_10073884
831 Ga0268264_10269538
832 Ga0265322_10000036
833 Ga0265332_10200668
834 Ga0307513_10055591
835 Ga0307513_10261310
836 Ga0307509_10098663
837 Ga0307408_100008301
838 Ga0307508_10004206
839 Ga0265314_10259236
840 Ga0307413_10785922
841 Ga0307406_10013869
842 Ga0307407_10322674
843 Ga0307407_10504908
844 Ga0307412_10322462
845 Ga0307409_100304270
846 Ga0307414_10232234
847 Ga0307411_11385947
848 Ga0307415_101723473
849 Ga0373936_0174460
850 Ga0373956_0106914
851 Ga0373955_0055722
852 Ga0373961_0062624
853 Ga0373935_0181905
854 Ga0373937_0036157
855 Ga0373937_0213733
856 Ga0395905_1042997
857 Ga0451833_0113083
858 Ga0439450_125019
859 Ga0451577_0000637
860 Ga0453684_0006282
861 Ga0451576_0017093
862 Ga0451576_0088130
863 Ga0451576_2190683
864 Ga0495592_0052898
865 Ga0495629_0314410
866 Ga0495638_0022593
867 Ga0495651_0008237
868 Ga0495580_0182398
869 Ga0495582_0418260
870 Ga0495662_0346812
871 Ga0495664_0070085
872 Ga0495618_0114219
873 Ga0495630_0055240
874 Ga0495652_0012089
875 Ga0495640_0682370
876 Ga0495645_0267929
877 Ga0495599_0141625
878 Ga0495658_0013247
879 Ga0495669_0181278
880 Ga0495604_0336022
881 Ga0495674_0027447
882 Ga0495675_0025723
883 Ga0495602_0814244
884 Ga0496100_0318719
885 Ga0496102_0026136
886 Ga0496102_1412920
887 Ga0496103_0010941
888 Ga0496104_0718625
889 Ga0496106_0063590
890 Ga0496106_0408254
891 Ga0496107_0049453
892 Ga0496108_0062923
893 Ga0496108_0171320
894 Ga0496109_0065261
895 Ga0496109_0565636
896 Ga0496110_0309711
897 Ga0496111_0011165
898 Ga0496112_0066209
899 Ga0496112_0192755
900 Ga0496112_0548576
901 Ga0496113_0075889
902 Ga0496113_1318331
903 Ga0496114_0074744
904 Ga0496115_0000724
905 Ga0496115_0159850
906 Ga0501293_001991
907 Ga0501042_0065164
908 Ga0501048_0132463
909 Ga0501069_0276189
910 Ga0501072_0772407
911 Ga0501077_0337020
912 Ga0501077_0564149
913 Ga0501080_0258169
914 Ga0501035_1198129
915 Ga0501045_0062926
916 nmdc:mga05p37_305290_c1
917 nmdc:mga05p37_54938_c1
918 nmdc:mga05p37_910469_c1
919 nmdc:mga09592_75579_c1
920 nmdc:mga0qj67_1311972_c1
921 nmdc:mga0qj67_22111_c1
922 nmdc:mga06r32_1316010_c1
923 nmdc:mga06r32_285900_c1
924 nmdc:mga06r32_461496_c1
925 nmdc:mga06r32_493487_c1
926 nmdc:mga06r32_62573_c1
927 nmdc:mga06r32_734020_c1
928 nmdc:mga08y16_165679_c1
929 nmdc:mga08y16_536303_c1
930 nmdc:mga08y16_883962_c1
931 nmdc:mga0n895_1750690_c1
932 nmdc:mga0n895_46075_c1
933 nmdc:mga0n895_5356_c1
934 nmdc:mga0a205_1032079_c1
935 nmdc:mga0a205_108281_c1
936 nmdc:mga0a205_238151_c1
937 nmdc:mga0a205_567709_c1
938 nmdc:mga0a205_58263_c1
939 Ga0495595_0025475
940 Ga0590071_025445
941 Ga0590075_203883
942 Ga0530510_1206461

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

55

123

0.9

PF02311

AraC_binding

AraC-like ligand binding domain

55

136

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.9979 4 98
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.9205 4 98
2i45-assembly4.cif.gz_H crystal structure of protein nmb1881 from neisseria meningitidis 0.9201 2 99
2i45-assembly3.cif.gz_E crystal structure of protein nmb1881 from neisseria meningitidis 0.9188 2 99
4xfh-assembly1.cif.gz_A cysteine dioxygenase variant - y157f at ph 6.2 with cysteine 0.9153 18 98
ID Description Score Start End Superfamily
3d82C00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.969 1 95 2.60.120.10
3d82C00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9193 1 95 2.60.120.10
af_P76555_101_233_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9001 26 98 2.60.120.10
2i45I00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.896 3 99 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8887 28 98 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A848VMC2-F1-model_v4 Cupin domain-containing protein 0.9994 2 119 GO:0030145
AF-A0A1Y1RV67-F1-model_v4 Cupin type-2 domain-containing protein 0.9983 1 119
AF-A0A537BVB2-F1-model_v4 Cupin domain-containing protein 0.9975 5 93
AF-A0A2E8XNB7-F1-model_v4 Cupin type-2 domain-containing protein 0.9972 1 119
AF-A0A2E8FKN9-F1-model_v4 Mannose-6-phosphate isomerase 0.9969 2 119 GO:0016853

Map