F450521

General Info

Members Datasets Scaffolds Average Seq Length
471 300 942 261

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10030263|rootH1_100302635
Length 289
Sequence MPDLSSLDTPRNRILSILLLCLVLGIWQGSSAFLNIPAFILPSATAVAQGLWRGTMTGLYFHHGAVTLFEVLAGFALGGFLGLALGVAVALNRRFAYFIYPYIIMFQSMPKVALAPLFVLWFGLGVTSKIVTAALVAFFPMMINTISGLNSADRDRIDLIRSLGGSELQVFTMLRLPSALPFIMAGLEIAMALALIGTVVTEFLGAEAGLGMLMQSMNFVMDVAGSFSVLIILAIVGLVLNQLLIMIRHRVLFWERLGRGEPETNSEEIPTVSSKSPRKDFAPPPSTVP

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
139 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
140 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
141 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
176 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
249 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
267 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
279 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
280 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
281 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
282 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
285 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
286 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
287 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
288 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
289 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
290 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
291 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
292 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
293 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
294 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
295 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 641522639 Methylobacterium sp. 4-46 Isolate Nodule
299 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
300 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.7
Nodule 0.42
Rhizoplane 4.88
Rhizosphere 83.23
Stem 0
Stem Tuber 0
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10030263 3300003323 Bacteria 8112
2 JGI24751J29686_10008843 3300002459 Bacteria 2065
3 JGI25406J46586_10007467 3300003203 Bacteria 4989
4 rootH2_10170380 3300003320 Bacteria 1253
5 JGI25404J52841_10008615 3300003659 Bacteria 2175
6 Ga0065704_10174111 3300005289 Bacteria 1274
7 Ga0065715_10016214 3300005293 Bacteria 3755
8 Ga0070683_100061046 3300005329 Bacteria 3504
9 Ga0068869_100008648 3300005334 Bacteria 6577
10 Ga0068869_100341576 3300005334 Bacteria 1218
11 Ga0070680_100017779 3300005336 Bacteria 5609
12 Ga0070680_100047785 3300005336 Bacteria 3485
13 Ga0070680_100280543 3300005336 Bacteria 1412
14 Ga0070682_100024286 3300005337 Bacteria 3605
15 Ga0070660_100097575 3300005339 Bacteria 2325
16 Ga0070689_100067851 3300005340 Bacteria 2781
17 Ga0070689_100285092 3300005340 Bacteria 1371
18 Ga0070691_10023283 3300005341 Bacteria 2876
19 Ga0070691_10031750 3300005341 Bacteria 2478
20 Ga0070687_100176107 3300005343 Bacteria 1277
21 Ga0070668_100127219 3300005347 Bacteria 2042
22 Ga0070668_100186630 3300005347 Bacteria 1696
23 Ga0070668_100192491 3300005347 Bacteria 1671
24 Ga0070668_100498461 3300005347 Bacteria 1054
25 Ga0070669_100262699 3300005353 Bacteria 1378
26 Ga0070675_100442518 3300005354 Bacteria 1164
27 Ga0070674_100285865 3300005356 Bacteria 1309
28 Ga0070674_100365254 3300005356 Bacteria 1170
29 Ga0070688_100387045 3300005365 Bacteria 1032
30 Ga0070659_100155821 3300005366 Bacteria 1865
31 Ga0070667_100120287 3300005367 Bacteria 2284
32 Ga0070703_10001020 3300005406 Bacteria 8781
33 Ga0070709_10294802 3300005434 Bacteria 1183
34 Ga0070714_100056373 3300005435 Bacteria 3361
35 Ga0070713_100009276 3300005436 Bacteria 7032
36 Ga0070710_10016440 3300005437 Bacteria 3765
37 Ga0070701_10009021 3300005438 Bacteria 4350
38 Ga0070711_100096460 3300005439 Bacteria 2142
39 Ga0070705_100000048 3300005440 Bacteria 61670
40 Ga0070700_100026743 3300005441 Bacteria 3412
41 Ga0070700_100064082 3300005441 Bacteria 2327
42 Ga0070700_100068380 3300005441 Bacteria 2259
43 Ga0070694_100000996 3300005444 Bacteria 16075
44 Ga0070694_100061298 3300005444 Bacteria 2567
45 Ga0070694_100396959 3300005444 Bacteria 1079
46 Ga0070708_100015015 3300005445 Bacteria 6387
47 Ga0070708_100096475 3300005445 Bacteria 2701
48 Ga0070663_100006944 3300005455 Bacteria 6858
49 Ga0070678_100226400 3300005456 Bacteria 1557
50 Ga0070678_100342414 3300005456 Bacteria 1283
51 Ga0070662_100109673 3300005457 Bacteria 2101
52 Ga0070662_100174322 3300005457 Bacteria 1691
53 Ga0070681_10090785 3300005458 Bacteria 3005
54 Ga0070681_10218219 3300005458 Bacteria 1823
55 Ga0070706_100000336 3300005467 Bacteria 56986
56 Ga0070707_100123200 3300005468 Bacteria 2517
57 Ga0070699_100000318 3300005518 Bacteria 46655
58 Ga0070699_100002614 3300005518 Bacteria 16088
59 Ga0070679_100070983 3300005530 Bacteria 3473
60 Ga0070684_100033357 3300005535 Bacteria 4395
61 Ga0070697_100013718 3300005536 Bacteria 6357
62 Ga0070697_100014699 3300005536 Bacteria 6147
63 Ga0070697_100489074 3300005536 Bacteria 1075
64 Ga0068853_100059587 3300005539 Bacteria 3298
65 Ga0068853_100281647 3300005539 Bacteria 1533
66 Ga0070695_100000762 3300005545 Bacteria 17297
67 Ga0070695_100016653 3300005545 Bacteria 4452
68 Ga0070695_100025990 3300005545 Bacteria 3620
69 Ga0070695_100246977 3300005545 Bacteria 1297
70 Ga0070695_100404225 3300005545 Bacteria 1036
71 Ga0070696_100002962 3300005546 Bacteria 11287
72 Ga0070696_100003034 3300005546 Bacteria 11150
73 Ga0070696_100494859 3300005546 Bacteria 972
74 Ga0070693_100036028 3300005547 Bacteria 2748
75 Ga0070704_100019379 3300005549 Bacteria 4370
76 Ga0068855_100083743 3300005563 Bacteria 3694
77 Ga0068856_100191129 3300005614 Bacteria 2061
78 Ga0068859_100001430 3300005617 Bacteria 24211
79 Ga0068859_100082362 3300005617 Bacteria 3260
80 Ga0068864_100022371 3300005618 Bacteria 5301
81 Ga0068863_100263573 3300005841 Bacteria 1666
82 Ga0068858_100259059 3300005842 Bacteria 1653
83 Ga0068860_100064130 3300005843 Bacteria 3490
84 Ga0068862_100002280 3300005844 Bacteria 17170
85 Ga0068862_100056128 3300005844 Bacteria 3374
86 Ga0068862_100463368 3300005844 Bacteria 1197
87 Ga0068862_100480413 3300005844 Bacteria 1176
88 Ga0081455_10097129 3300005937 Bacteria 2374
89 Ga0081540_1000035 3300005983 Bacteria 141244
90 Ga0081539_10010604 3300005985 Bacteria 7443
91 Ga0075365_10000903 3300006038 Bacteria 12451
92 Ga0075368_10004724 3300006042 Bacteria 4635
93 Ga0075368_10030562 3300006042 Bacteria 2086
94 Ga0075363_100003345 3300006048 Bacteria 6808
95 Ga0075364_10022292 3300006051 Bacteria 3998
96 Ga0075364_10170861 3300006051 Bacteria 1469
97 Ga0070712_100001095 3300006175 Bacteria 16336
98 Ga0075367_10006453 3300006178 Bacteria 5929
99 Ga0075367_10008135 3300006178 Bacteria 5416
100 Ga0075367_10023904 3300006178 Bacteria 3443
101 Ga0075367_10123902 3300006178 Bacteria 1594
102 Ga0097621_100376758 3300006237 Bacteria 1267
103 Ga0075428_100012736 3300006844 Bacteria 9351
104 Ga0075428_100205234 3300006844 Bacteria 2130
105 Ga0075430_100144252 3300006846 Bacteria 1983
106 Ga0075431_100092931 3300006847 Bacteria 3114
107 Ga0075431_100109478 3300006847 Bacteria 2851
108 Ga0075433_10425011 3300006852 Bacteria 1172
109 Ga0075434_100007383 3300006871 Bacteria 10177
110 Ga0075434_100468141 3300006871 Bacteria 1281
111 Ga0075429_100170395 3300006880 Bacteria 1907
112 Ga0075436_100087600 3300006914 Bacteria 2163
113 Ga0075436_100169387 3300006914 Bacteria 1542
114 Ga0075436_100185089 3300006914 Bacteria 1473
115 Ga0075436_100329182 3300006914 Bacteria 1098
116 Ga0097620_100001430 3300006931 Bacteria 24211
117 Ga0075435_100056148 3300007076 Bacteria 3182
118 Ga0099794_10000098 3300007265 Bacteria 32096
119 Ga0099795_10009773 3300007788 Bacteria 2797
120 Ga0105250_10132372 3300009092 Bacteria 1030
121 Ga0111539_10090256 3300009094 Bacteria 3601
122 Ga0111539_10259376 3300009094 Bacteria 2024
123 Ga0111539_10707839 3300009094 Bacteria 1172
124 Ga0105245_10244522 3300009098 Bacteria 1741
125 Ga0105245_10420616 3300009098 Bacteria 1339
126 Ga0105245_10581381 3300009098 Bacteria 1145
127 Ga0114129_10002927 3300009147 Bacteria 23882
128 Ga0114129_10042585 3300009147 Bacteria 6392
129 Ga0114129_10073914 3300009147 Bacteria 4749
130 Ga0114129_10088147 3300009147 Bacteria 4303
131 Ga0114129_10445936 3300009147 Bacteria 1698
132 Ga0105241_10471602 3300009174 Bacteria 1114
133 Ga0105242_10886820 3300009176 Bacteria 891
134 Ga0105248_10495695 3300009177 Bacteria 1377
135 Ga0105248_10524916 3300009177 Bacteria 1335
136 Ga0105237_10075050 3300009545 Bacteria 3373
137 Ga0105238_10032938 3300009551 Bacteria 5275
138 Ga0105238_10489449 3300009551 Unclassified 1230
139 Ga0105249_10000751 3300009553 Bacteria 29147
140 Ga0105249_10114582 3300009553 Bacteria 2553
141 Ga0105249_10140052 3300009553 Bacteria 2319
142 Ga0105249_10186135 3300009553 Bacteria 2023
143 Ga0105239_10288289 3300010375 Bacteria 1849
144 Ga0105239_10442705 3300010375 Bacteria 1473
145 Ga0105246_10019842 3300011119 Bacteria 4305
146 Ga0105246_10370061 3300011119 Bacteria 1181
147 Ga0157373_10033003 3300013100 Bacteria 3726
148 Ga0157373_10086097 3300013100 Bacteria 2214
149 Ga0157370_10119012 3300013104 Bacteria 2466
150 Ga0163162_10080402 3300013306 Bacteria 3327
151 Ga0157372_10060062 3300013307 Bacteria 4254
152 Ga0157372_10431333 3300013307 Bacteria 1536
153 Ga0157375_11030508 3300013308 Bacteria 961
154 Ga0163163_10575345 3300014325 Bacteria 1189
155 Ga0157380_10009180 3300014326 Bacteria 7075
156 Ga0157380_10426654 3300014326 Bacteria 1266
157 Ga0157379_10111389 3300014968 Bacteria 2458
158 Ga0157379_10683025 3300014968 Bacteria 963
159 Ga0213876_10018658 3300021384 Bacteria 3664
160 Ga0207653_10000522 3300025885 Bacteria 14587
161 Ga0207653_10053505 3300025885 Bacteria 1349
162 Ga0207692_10004999 3300025898 Bacteria 5278
163 Ga0207692_10194904 3300025898 Bacteria 1188
164 Ga0207699_10085497 3300025906 Bacteria 1967
165 Ga0207699_10121067 3300025906 Unclassified 1692
166 Ga0207684_10000320 3300025910 Bacteria 68296
167 Ga0207684_10247228 3300025910 Bacteria 1539
168 Ga0207654_10144497 3300025911 Bacteria 1521
169 Ga0207707_10040638 3300025912 Bacteria 4062
170 Ga0207707_10147066 3300025912 Bacteria 2060
171 Ga0207707_10411526 3300025912 Bacteria 1160
172 Ga0207693_10001127 3300025915 Bacteria 23971
173 Ga0207693_10004220 3300025915 Bacteria 12189
174 Ga0207663_10082925 3300025916 Bacteria 2105
175 Ga0207660_10009652 3300025917 Bacteria 6246
176 Ga0207660_10097166 3300025917 Bacteria 2194
177 Ga0207662_10062488 3300025918 Bacteria 2238
178 Ga0207662_10110676 3300025918 Bacteria 1712
179 Ga0207657_10356794 3300025919 Bacteria 1153
180 Ga0207652_10015359 3300025921 Bacteria 6218
181 Ga0207652_10129677 3300025921 Bacteria 2248
182 Ga0207646_10161913 3300025922 Unclassified 2019
183 Ga0207681_10017435 3300025923 Bacteria 4509
184 Ga0207659_10286751 3300025926 Bacteria 1348
185 Ga0207687_10383762 3300025927 Bacteria 1152
186 Ga0207664_10290285 3300025929 Bacteria 1437
187 Ga0207664_10421907 3300025929 Bacteria 1188
188 Ga0207706_10110530 3300025933 Bacteria 2418
189 Ga0207686_10206291 3300025934 Bacteria 1410
190 Ga0207670_10015752 3300025936 Bacteria 4526
191 Ga0207670_10038891 3300025936 Bacteria 3110
192 Ga0207670_10119846 3300025936 Bacteria 1911
193 Ga0207665_10023749 3300025939 Bacteria 4038
194 Ga0207665_10056473 3300025939 Bacteria 2650
195 Ga0207689_10004418 3300025942 Bacteria 12761
196 Ga0207689_10065081 3300025942 Bacteria 2999
197 Ga0207712_10004270 3300025961 Bacteria 9016
198 Ga0207668_10126846 3300025972 Bacteria 1942
199 Ga0207658_10059055 3300025986 Bacteria 2857
200 Ga0207639_10143117 3300026041 Bacteria 1994
201 Ga0207678_10007713 3300026067 Bacteria 9509
202 Ga0207678_10170146 3300026067 Bacteria 1860
203 Ga0207678_10179499 3300026067 Bacteria 1808
204 Ga0207708_10016632 3300026075 Bacteria 5534
205 Ga0207708_10075082 3300026075 Bacteria 2592
206 Ga0207702_10607828 3300026078 Unclassified 1073
207 Ga0207676_10009541 3300026095 Bacteria 6909
208 Ga0207674_10003304 3300026116 Bacteria 19830
209 Ga0207674_10067034 3300026116 Bacteria 3614
210 Ga0207675_100051119 3300026118 Bacteria 3856
211 Ga0207683_10248758 3300026121 Bacteria 1622
212 Ga0207683_10258397 3300026121 Bacteria 1590
213 Ga0207683_10316947 3300026121 Bacteria 1428
214 Ga0207698_10348074 3300026142 Bacteria 1399
215 Ga0209588_1000034 3300027671 Bacteria 66337
216 Ga0209813_10001864 3300027866 Bacteria 4755
217 Ga0209813_10002334 3300027866 Bacteria 4349
218 Ga0209813_10006899 3300027866 Bacteria 2817
219 Ga0268266_10298301 3300028379 Bacteria 1503
220 Ga0268265_10003738 3300028380 Bacteria 10821
221 Ga0268265_10052640 3300028380 Bacteria 3080
222 Ga0268264_10002460 3300028381 Bacteria 16280
223 Ga0268264_10146971 3300028381 Bacteria 2109
224 Ga0265337_1007685 3300028556 Bacteria 4008
225 Ga0265326_10010346 3300028558 Bacteria 2766
226 Ga0265319_1012611 3300028563 Bacteria 3407
227 Ga0265334_10005139 3300028573 Bacteria 5731
228 Ga0265318_10009835 3300028577 Bacteria 4191
229 Ga0265336_10008515 3300028666 Bacteria 3595
230 Ga0307515_10023773 3300028794 Bacteria 10718
231 Ga0265338_10000256 3300028800 Bacteria 97079
232 Ga0265324_10011262 3300029957 Bacteria 3414
233 Ga0265327_10066295 3300031251 Bacteria 1822
234 Ga0307509_10022774 3300031507 Bacteria 7051
235 Ga0265313_10014142 3300031595 Bacteria 4736
236 Ga0307413_10120743 3300031824 Bacteria 1775
237 Ga0307409_100027606 3300031995 Bacteria 4026
238 Ga0307416_100017363 3300032002 Bacteria 5034
239 Ga0307411_10030462 3300032005 Bacteria 3307
240 Ga0307415_100043498 3300032126 Bacteria 2997
241 Ga0373940_0007292 3300035088 Bacteria 2490
242 Ga0373923_0000033 3300035111 Bacteria 20803
243 Ga0373936_0000008 3300035113 Bacteria 268505
244 Ga0373936_0000211 3300035113 Bacteria 19242
245 Ga0373945_0014700 3300035116 Bacteria 2626
246 Ga0373953_0007197 3300035117 Bacteria 3714
247 Ga0373943_0003301 3300035170 Bacteria 7327
248 Ga0373946_0004720 3300035171 Bacteria 4897
249 Ga0373955_0000845 3300035172 Bacteria 13115
250 Ga0373961_0085326 3300035241 Bacteria 1000
251 Ga0373962_0056074 3300035242 Bacteria 1146
252 Ga0373924_0003077 3300035410 Bacteria 5694
253 Ga0373931_0000551 3300035691 Bacteria 15400
254 Ga0373935_0000812 3300035692 Bacteria 16745
255 Ga0373927_0005682 3300035695 Bacteria 8562
256 Ga0373927_0242431 3300035695 Bacteria 1185
257 Ga0373933_0001256 3300035724 Bacteria 14975
258 Ga0373947_0000529 3300035725 Bacteria 22292
259 Ga0373947_0006653 3300035725 Bacteria 6709
260 Ga0373937_0000746 3300036401 Bacteria 28100
261 Ga0373937_0525028 3300036401 Bacteria 1125
262 Ga0373925_0000058 3300037068 Bacteria 122682
263 Ga0373925_0017563 3300037068 Bacteria 5188
264 Ga0242420_020096 3300038996 Bacteria 1186
265 Ga0436365_1575651 3300039437 Bacteria 3364
266 Ga0436360_0708046 3300039438 Bacteria 1028
267 Ga0451807_0956061 3300041486 Bacteria 1558
268 Ga0466965_0001110 3300044683 Bacteria 10504
269 Ga0466966_0021223 3300044684 Bacteria 4265
270 Ga0466963_0286034 3300044694 Bacteria 1159
271 Ga0466967_0117279 3300045976 Bacteria 2454
272 Ga0495592_0000298 3300046454 Bacteria 42312
273 Ga0495603_0048714 3300046455 Bacteria 2523
274 Ga0495603_0207177 3300046455 Bacteria 1133
275 Ga0495638_0163913 3300046460 Bacteria 1280
276 Ga0495651_0004236 3300046462 Bacteria 10994
277 Ga0495653_0000259 3300046463 Bacteria 42610
278 Ga0495662_0004769 3300046476 Bacteria 6796
279 Ga0495664_0000009 3300046477 Bacteria 289534
280 Ga0495594_0261712 3300046499 Bacteria 985
281 Ga0495608_0000199 3300046511 Bacteria 42582
282 Ga0495618_0000203 3300046514 Bacteria 42631
283 Ga0495628_0000012 3300046516 Bacteria 224162
284 Ga0495630_0000655 3300046517 Bacteria 25028
285 Ga0495652_0000587 3300046529 Bacteria 42494
286 Ga0495640_0001482 3300046533 Bacteria 18474
287 Ga0495587_0000033 3300046536 Bacteria 123885
288 Ga0495645_0000017 3300046543 Bacteria 156865
289 Ga0495667_0000179 3300046559 Bacteria 42848
290 Ga0495667_0055444 3300046559 Bacteria 2607
291 Ga0495634_0000407 3300046642 Bacteria 42447
292 Ga0495635_0000019 3300046663 Bacteria 193402
293 Ga0495588_0008897 3300046674 Bacteria 4622
294 Ga0495657_0000349 3300046675 Bacteria 42782
295 Ga0495599_0000024 3300046678 Bacteria 121388
296 Ga0495623_0000540 3300046679 Bacteria 25144
297 Ga0495646_0000095 3300046680 Bacteria 43349
298 Ga0495658_0038619 3300046683 Bacteria 2645
299 Ga0495613_0095890 3300046689 Bacteria 2145
300 Ga0495600_0000129 3300046809 Bacteria 42502
301 Ga0495581_0003545 3300047315 Bacteria 8960
302 Ga0495604_0000330 3300047317 Bacteria 42446
303 Ga0495604_0200142 3300047317 Bacteria 1386
304 Ga0495674_0000015 3300047319 Bacteria 224071
305 Ga0495672_0069318 3300047320 Bacteria 2002
306 Ga0495680_0001651 3300047322 Bacteria 23706
307 Ga0495675_0000858 3300047444 Bacteria 18544
308 Ga0495684_0000249 3300047471 Bacteria 42567
309 Ga0495593_0178599 3300047673 Bacteria 1069
310 Ga0495602_0000358 3300048088 Bacteria 42545
311 Ga0496100_0031429 3300048903 Bacteria 3301
312 Ga0496102_0002762 3300048905 Bacteria 14964
313 Ga0496102_0158850 3300048905 Bacteria 2126
314 Ga0496102_0351061 3300048905 Bacteria 1389
315 Ga0496103_0041236 3300048906 Bacteria 2838
316 Ga0496104_0041545 3300048907 Bacteria 4312
317 Ga0496104_0096965 3300048907 Bacteria 2821
318 Ga0496105_0030445 3300048908 Bacteria 4422
319 Ga0496106_0003189 3300048909 Bacteria 12265
320 Ga0496107_0059094 3300048910 Bacteria 2774
321 Ga0496107_0156844 3300048910 Bacteria 1686
322 Ga0496108_0218611 3300048911 Bacteria 1655
323 Ga0496108_0396905 3300048911 Bacteria 1205
324 Ga0496109_0028728 3300048912 Bacteria 4978
325 Ga0496109_0184328 3300048912 Bacteria 1961
326 Ga0496110_0040804 3300048913 Bacteria 4046
327 Ga0496111_0034418 3300048914 Bacteria 3617
328 Ga0496111_0175251 3300048914 Bacteria 1594
329 Ga0496112_0614510 3300048915 Bacteria 1018
330 Ga0496113_0254912 3300048916 Bacteria 1401
331 Ga0496115_0020042 3300048918 Bacteria 5153
332 Ga0496115_0041299 3300048918 Bacteria 3670
333 Ga0496119_0003124 3300048922 Bacteria 17450
334 Ga0496121_0001096 3300048924 Bacteria 47791
335 Ga0496121_0053291 3300048924 Bacteria 3390
336 Ga0496121_0249138 3300048924 Bacteria 1233
337 Ga0496124_0160159 3300048927 Bacteria 1755
338 Ga0496126_0003732 3300048929 Bacteria 18985
339 Ga0501032_0000005 3300049569 Bacteria 262926
340 Ga0501032_0104590 3300049569 Bacteria 1875
341 Ga0501033_0002556 3300049570 Bacteria 15371
342 Ga0501033_0030257 3300049570 Bacteria 4068
343 Ga0501034_0000027 3300049571 Bacteria 260512
344 Ga0501034_0000119 3300049571 Bacteria 144440
345 Ga0501034_0000295 3300049571 Bacteria 88435
346 Ga0501034_0178568 3300049571 Bacteria 2088
347 Ga0501034_0184651 3300049571 Bacteria 2049
348 Ga0501036_0000217 3300049572 Bacteria 38514
349 Ga0501036_0045887 3300049572 Bacteria 3700
350 Ga0501036_0057223 3300049572 Bacteria 3303
351 Ga0501037_0000125 3300049573 Bacteria 71187
352 Ga0501037_0025039 3300049573 Bacteria 4410
353 Ga0501037_0044516 3300049573 Bacteria 3259
354 Ga0501037_0127459 3300049573 Bacteria 1826
355 Ga0501038_0000053 3300049574 Bacteria 94583
356 Ga0501038_0032227 3300049574 Bacteria 4625
357 Ga0501039_0051645 3300049575 Bacteria 3181
358 Ga0501039_0094232 3300049575 Bacteria 2334
359 Ga0501039_0173463 3300049575 Bacteria 1695
360 Ga0501039_0212016 3300049575 Bacteria 1523
361 Ga0501040_0176441 3300049576 Bacteria 1514
362 Ga0501041_0119814 3300049577 Bacteria 1635
363 Ga0501043_0000011 3300049579 Bacteria 198958
364 Ga0501043_0073965 3300049579 Bacteria 2676
365 Ga0501043_0121623 3300049579 Bacteria 2047
366 Ga0501046_0034453 3300049580 Bacteria 4085
367 Ga0501046_0122318 3300049580 Bacteria 1979
368 Ga0501046_0168273 3300049580 Bacteria 1646
369 Ga0501047_0000382 3300049581 Bacteria 49844
370 Ga0501047_0059087 3300049581 Bacteria 3702
371 Ga0501048_0000031 3300049582 Bacteria 65561
372 Ga0501048_0026361 3300049582 Bacteria 4232
373 Ga0501048_0029455 3300049582 Bacteria 3982
374 Ga0501048_0091076 3300049582 Bacteria 2151
375 Ga0501067_0076325 3300049583 Bacteria 1857
376 Ga0501067_0164255 3300049583 Bacteria 1236
377 Ga0501067_0185751 3300049583 Bacteria 1158
378 Ga0501068_0142747 3300049584 Bacteria 1501
379 Ga0501070_0005422 3300049586 Bacteria 10887
380 Ga0501070_0062129 3300049586 Bacteria 3094
381 Ga0501071_0080372 3300049587 Bacteria 2384
382 Ga0501072_0006385 3300049588 Bacteria 8980
383 Ga0501072_0023869 3300049588 Bacteria 4752
384 Ga0501074_0008609 3300049590 Bacteria 7389
385 Ga0501074_0119260 3300049590 Bacteria 1886
386 Ga0501075_0086030 3300049591 Bacteria 2382
387 Ga0501075_0166331 3300049591 Bacteria 1683
388 Ga0501076_0024932 3300049592 Bacteria 4627
389 Ga0501076_0140233 3300049592 Bacteria 1964
390 Ga0501077_0004621 3300049593 Bacteria 8361
391 Ga0501079_0066565 3300049741 Bacteria 2780
392 Ga0501079_0073438 3300049741 Bacteria 2644
393 Ga0501079_0186908 3300049741 Bacteria 1617
394 Ga0501080_0000478 3300049742 Bacteria 31148
395 Ga0501080_0008686 3300049742 Bacteria 9224
396 Ga0501080_0041373 3300049742 Bacteria 4294
397 Ga0501080_0048573 3300049742 Bacteria 3949
398 Ga0501080_0470926 3300049742 Bacteria 1125
399 Ga0501081_0023728 3300049743 Bacteria 4113
400 Ga0501081_0028223 3300049743 Bacteria 3786
401 Ga0501081_0028572 3300049743 Bacteria 3764
402 Ga0501081_0079268 3300049743 Bacteria 2297
403 Ga0501083_0002087 3300049744 Bacteria 13749
404 Ga0501083_0026964 3300049744 Bacteria 3968
405 Ga0501083_0156047 3300049744 Bacteria 1494
406 Ga0501044_0001546 3300049823 Bacteria 26990
407 Ga0501044_0083486 3300049823 Bacteria 3230
408 Ga0501044_0212584 3300049823 Bacteria 1888
409 Ga0501044_0278539 3300049823 Bacteria 1607
410 Ga0501044_0280042 3300049823 Bacteria 1601
411 Ga0501045_0071928 3300049824 Bacteria 2546
412 Ga0501045_0107784 3300049824 Bacteria 2064
413 nmdc:mga03n38_139742_c1 3300050490 Bacteria 1208
414 nmdc:mga03n38_6247_c1 3300050490 Bacteria 4124
415 nmdc:mga00v17_150699_c1 3300050491 Bacteria 1494
416 nmdc:mga0yw44_133501_c1 3300050492 Bacteria 1609
417 nmdc:mga0yw44_3013_c1 3300050492 Bacteria 7359
418 nmdc:mga06z11_3038_c1 3300050494 Bacteria 6456
419 nmdc:mga06z11_667_c1 3300050494 Bacteria 12487
420 nmdc:mga06z11_812_c1 3300050494 Bacteria 11421
421 nmdc:mga06z11_94358_c1 3300050494 Bacteria 1630
422 nmdc:mga04h51_27441_c1 3300050495 Bacteria 1769
423 nmdc:mga04h51_3639_c1 3300050495 Bacteria 3766
424 nmdc:mga04h51_7991_c1 3300050495 Bacteria 2817
425 nmdc:mga07m45_9621_c1 3300050496 Bacteria 5023
426 nmdc:mga05p37_112175_c1 3300050507 Bacteria 3353
427 nmdc:mga05p37_177294_c1 3300050507 Bacteria 2596
428 nmdc:mga05p37_58181_c1 3300050507 Bacteria 4760
429 nmdc:mga05p37_89013_c1 3300050507 Bacteria 3804
430 nmdc:mga09592_240638_c1 3300050508 Bacteria 1568
431 nmdc:mga0qj67_219044_c1 3300050509 Bacteria 1545
432 nmdc:mga06r32_23541_c1 3300050510 Bacteria 5700
433 nmdc:mga06r32_258764_c1 3300050510 Bacteria 1728
434 nmdc:mga08y16_24625_c1 3300050511 Bacteria 6352
435 nmdc:mga08y16_470253_c1 3300050511 Bacteria 1280
436 nmdc:mga0n895_529003_c1 3300050512 Bacteria 1186
437 nmdc:mga0n895_675698_c1 3300050512 Bacteria 1030
438 nmdc:mga0n895_7034_c1 3300050512 Bacteria 9611
439 nmdc:mga0rr50_114885_c1 3300050513 Bacteria 2135
440 nmdc:mga08x19_309392_c1 3300050514 Bacteria 1098
441 nmdc:mga08x19_315499_c1 3300050514 Bacteria 1087
442 nmdc:mga08x19_99888_c1 3300050514 Bacteria 1924
443 nmdc:mga0a205_446078_c1 3300050515 Bacteria 1154
444 nmdc:mga0sz30_97377_c1 3300050516 Bacteria 1283
445 Ga0495601_0000024 3300053077 Bacteria 133160
446 Ga0495612_0000190 3300053078 Bacteria 26158
447 Ga0500610_0173872 3300053079 Bacteria 1061
448 Ga0495595_0000089 3300053084 Bacteria 42657
449 Ga0495619_0000034 3300053085 Bacteria 129851
450 Ga0500578_0137183 3300053086 Bacteria 1531
451 Ga0500583_0003738 3300053092 Bacteria 4852
452 Ga0500651_0000742 3300053093 Bacteria 15931
453 Ga0500566_0049278 3300053094 Bacteria 2413
454 Ga0500641_0096836 3300053096 Bacteria 1263
455 Ga0500556_0143626 3300053104 Bacteria 939
456 Ga0500595_002811 3300053119 Bacteria 8368
457 Ga0500595_007883 3300053119 Bacteria 4385
458 Ga0500614_002837 3300053123 Bacteria 3807
459 Ga0500658_0215942 3300053134 Bacteria 879
460 Ga0500590_073350 3300053148 Bacteria 1697
461 Ga0500627_0151860 3300053158 Bacteria 1046
462 Ga0500636_0056287 3300053177 Bacteria 2304
463 Ga0501084_0116762 3300054114 Bacteria 2243
464 Ga0501084_0850749 3300054114 Bacteria 768
465 Ga0501082_0000027 3300060353 Bacteria 100915
466 Ga0501082_0075282 3300060353 Bacteria 2908
467 Ga0501082_0223271 3300060353 Bacteria 1639
468 Ga0501082_0419013 3300060353 Bacteria 1169
469 641641083 641522639 Bacteria 7737025
470 643600692 643348564 Bacteria 8839022
471 8006985679 8006984368 Bacteria 9651211
472 rootH1_10030263
473 JGI24751J29686_10008843
474 JGI25406J46586_10007467
475 rootH2_10170380
476 JGI25404J52841_10008615
477 Ga0065704_10174111
478 Ga0065715_10016214
479 Ga0070683_100061046
480 Ga0068869_100008648
481 Ga0068869_100341576
482 Ga0070680_100017779
483 Ga0070680_100047785
484 Ga0070680_100280543
485 Ga0070682_100024286
486 Ga0070660_100097575
487 Ga0070689_100067851
488 Ga0070689_100285092
489 Ga0070691_10023283
490 Ga0070691_10031750
491 Ga0070687_100176107
492 Ga0070668_100127219
493 Ga0070668_100186630
494 Ga0070668_100192491
495 Ga0070668_100498461
496 Ga0070669_100262699
497 Ga0070675_100442518
498 Ga0070674_100285865
499 Ga0070674_100365254
500 Ga0070688_100387045
501 Ga0070659_100155821
502 Ga0070667_100120287
503 Ga0070703_10001020
504 Ga0070709_10294802
505 Ga0070714_100056373
506 Ga0070713_100009276
507 Ga0070710_10016440
508 Ga0070701_10009021
509 Ga0070711_100096460
510 Ga0070705_100000048
511 Ga0070700_100026743
512 Ga0070700_100064082
513 Ga0070700_100068380
514 Ga0070694_100000996
515 Ga0070694_100061298
516 Ga0070694_100396959
517 Ga0070708_100015015
518 Ga0070708_100096475
519 Ga0070663_100006944
520 Ga0070678_100226400
521 Ga0070678_100342414
522 Ga0070662_100109673
523 Ga0070662_100174322
524 Ga0070681_10090785
525 Ga0070681_10218219
526 Ga0070706_100000336
527 Ga0070707_100123200
528 Ga0070699_100000318
529 Ga0070699_100002614
530 Ga0070679_100070983
531 Ga0070684_100033357
532 Ga0070697_100013718
533 Ga0070697_100014699
534 Ga0070697_100489074
535 Ga0068853_100059587
536 Ga0068853_100281647
537 Ga0070695_100000762
538 Ga0070695_100016653
539 Ga0070695_100025990
540 Ga0070695_100246977
541 Ga0070695_100404225
542 Ga0070696_100002962
543 Ga0070696_100003034
544 Ga0070696_100494859
545 Ga0070693_100036028
546 Ga0070704_100019379
547 Ga0068855_100083743
548 Ga0068856_100191129
549 Ga0068859_100001430
550 Ga0068859_100082362
551 Ga0068864_100022371
552 Ga0068863_100263573
553 Ga0068858_100259059
554 Ga0068860_100064130
555 Ga0068862_100002280
556 Ga0068862_100056128
557 Ga0068862_100463368
558 Ga0068862_100480413
559 Ga0081455_10097129
560 Ga0081540_1000035
561 Ga0081539_10010604
562 Ga0075365_10000903
563 Ga0075368_10004724
564 Ga0075368_10030562
565 Ga0075363_100003345
566 Ga0075364_10022292
567 Ga0075364_10170861
568 Ga0070712_100001095
569 Ga0075367_10006453
570 Ga0075367_10008135
571 Ga0075367_10023904
572 Ga0075367_10123902
573 Ga0097621_100376758
574 Ga0075428_100012736
575 Ga0075428_100205234
576 Ga0075430_100144252
577 Ga0075431_100092931
578 Ga0075431_100109478
579 Ga0075433_10425011
580 Ga0075434_100007383
581 Ga0075434_100468141
582 Ga0075429_100170395
583 Ga0075436_100087600
584 Ga0075436_100169387
585 Ga0075436_100185089
586 Ga0075436_100329182
587 Ga0097620_100001430
588 Ga0075435_100056148
589 Ga0099794_10000098
590 Ga0099795_10009773
591 Ga0105250_10132372
592 Ga0111539_10090256
593 Ga0111539_10259376
594 Ga0111539_10707839
595 Ga0105245_10244522
596 Ga0105245_10420616
597 Ga0105245_10581381
598 Ga0114129_10002927
599 Ga0114129_10042585
600 Ga0114129_10073914
601 Ga0114129_10088147
602 Ga0114129_10445936
603 Ga0105241_10471602
604 Ga0105242_10886820
605 Ga0105248_10495695
606 Ga0105248_10524916
607 Ga0105237_10075050
608 Ga0105238_10032938
609 Ga0105238_10489449
610 Ga0105249_10000751
611 Ga0105249_10114582
612 Ga0105249_10140052
613 Ga0105249_10186135
614 Ga0105239_10288289
615 Ga0105239_10442705
616 Ga0105246_10019842
617 Ga0105246_10370061
618 Ga0157373_10033003
619 Ga0157373_10086097
620 Ga0157370_10119012
621 Ga0163162_10080402
622 Ga0157372_10060062
623 Ga0157372_10431333
624 Ga0157375_11030508
625 Ga0163163_10575345
626 Ga0157380_10009180
627 Ga0157380_10426654
628 Ga0157379_10111389
629 Ga0157379_10683025
630 Ga0213876_10018658
631 Ga0207653_10000522
632 Ga0207653_10053505
633 Ga0207692_10004999
634 Ga0207692_10194904
635 Ga0207699_10085497
636 Ga0207699_10121067
637 Ga0207684_10000320
638 Ga0207684_10247228
639 Ga0207654_10144497
640 Ga0207707_10040638
641 Ga0207707_10147066
642 Ga0207707_10411526
643 Ga0207693_10001127
644 Ga0207693_10004220
645 Ga0207663_10082925
646 Ga0207660_10009652
647 Ga0207660_10097166
648 Ga0207662_10062488
649 Ga0207662_10110676
650 Ga0207657_10356794
651 Ga0207652_10015359
652 Ga0207652_10129677
653 Ga0207646_10161913
654 Ga0207681_10017435
655 Ga0207659_10286751
656 Ga0207687_10383762
657 Ga0207664_10290285
658 Ga0207664_10421907
659 Ga0207706_10110530
660 Ga0207686_10206291
661 Ga0207670_10015752
662 Ga0207670_10038891
663 Ga0207670_10119846
664 Ga0207665_10023749
665 Ga0207665_10056473
666 Ga0207689_10004418
667 Ga0207689_10065081
668 Ga0207712_10004270
669 Ga0207668_10126846
670 Ga0207658_10059055
671 Ga0207639_10143117
672 Ga0207678_10007713
673 Ga0207678_10170146
674 Ga0207678_10179499
675 Ga0207708_10016632
676 Ga0207708_10075082
677 Ga0207702_10607828
678 Ga0207676_10009541
679 Ga0207674_10003304
680 Ga0207674_10067034
681 Ga0207675_100051119
682 Ga0207683_10248758
683 Ga0207683_10258397
684 Ga0207683_10316947
685 Ga0207698_10348074
686 Ga0209588_1000034
687 Ga0209813_10001864
688 Ga0209813_10002334
689 Ga0209813_10006899
690 Ga0268266_10298301
691 Ga0268265_10003738
692 Ga0268265_10052640
693 Ga0268264_10002460
694 Ga0268264_10146971
695 Ga0265337_1007685
696 Ga0265326_10010346
697 Ga0265319_1012611
698 Ga0265334_10005139
699 Ga0265318_10009835
700 Ga0265336_10008515
701 Ga0307515_10023773
702 Ga0265338_10000256
703 Ga0265324_10011262
704 Ga0265327_10066295
705 Ga0307509_10022774
706 Ga0265313_10014142
707 Ga0307413_10120743
708 Ga0307409_100027606
709 Ga0307416_100017363
710 Ga0307411_10030462
711 Ga0307415_100043498
712 Ga0373940_0007292
713 Ga0373923_0000033
714 Ga0373936_0000008
715 Ga0373936_0000211
716 Ga0373945_0014700
717 Ga0373953_0007197
718 Ga0373943_0003301
719 Ga0373946_0004720
720 Ga0373955_0000845
721 Ga0373961_0085326
722 Ga0373962_0056074
723 Ga0373924_0003077
724 Ga0373931_0000551
725 Ga0373935_0000812
726 Ga0373927_0005682
727 Ga0373927_0242431
728 Ga0373933_0001256
729 Ga0373947_0000529
730 Ga0373947_0006653
731 Ga0373937_0000746
732 Ga0373937_0525028
733 Ga0373925_0000058
734 Ga0373925_0017563
735 Ga0242420_020096
736 Ga0436365_1575651
737 Ga0436360_0708046
738 Ga0451807_0956061
739 Ga0466965_0001110
740 Ga0466966_0021223
741 Ga0466963_0286034
742 Ga0466967_0117279
743 Ga0495592_0000298
744 Ga0495603_0048714
745 Ga0495603_0207177
746 Ga0495638_0163913
747 Ga0495651_0004236
748 Ga0495653_0000259
749 Ga0495662_0004769
750 Ga0495664_0000009
751 Ga0495594_0261712
752 Ga0495608_0000199
753 Ga0495618_0000203
754 Ga0495628_0000012
755 Ga0495630_0000655
756 Ga0495652_0000587
757 Ga0495640_0001482
758 Ga0495587_0000033
759 Ga0495645_0000017
760 Ga0495667_0000179
761 Ga0495667_0055444
762 Ga0495634_0000407
763 Ga0495635_0000019
764 Ga0495588_0008897
765 Ga0495657_0000349
766 Ga0495599_0000024
767 Ga0495623_0000540
768 Ga0495646_0000095
769 Ga0495658_0038619
770 Ga0495613_0095890
771 Ga0495600_0000129
772 Ga0495581_0003545
773 Ga0495604_0000330
774 Ga0495604_0200142
775 Ga0495674_0000015
776 Ga0495672_0069318
777 Ga0495680_0001651
778 Ga0495675_0000858
779 Ga0495684_0000249
780 Ga0495593_0178599
781 Ga0495602_0000358
782 Ga0496100_0031429
783 Ga0496102_0002762
784 Ga0496102_0158850
785 Ga0496102_0351061
786 Ga0496103_0041236
787 Ga0496104_0041545
788 Ga0496104_0096965
789 Ga0496105_0030445
790 Ga0496106_0003189
791 Ga0496107_0059094
792 Ga0496107_0156844
793 Ga0496108_0218611
794 Ga0496108_0396905
795 Ga0496109_0028728
796 Ga0496109_0184328
797 Ga0496110_0040804
798 Ga0496111_0034418
799 Ga0496111_0175251
800 Ga0496112_0614510
801 Ga0496113_0254912
802 Ga0496115_0020042
803 Ga0496115_0041299
804 Ga0496119_0003124
805 Ga0496121_0001096
806 Ga0496121_0053291
807 Ga0496121_0249138
808 Ga0496124_0160159
809 Ga0496126_0003732
810 Ga0501032_0000005
811 Ga0501032_0104590
812 Ga0501033_0002556
813 Ga0501033_0030257
814 Ga0501034_0000027
815 Ga0501034_0000119
816 Ga0501034_0000295
817 Ga0501034_0178568
818 Ga0501034_0184651
819 Ga0501036_0000217
820 Ga0501036_0045887
821 Ga0501036_0057223
822 Ga0501037_0000125
823 Ga0501037_0025039
824 Ga0501037_0044516
825 Ga0501037_0127459
826 Ga0501038_0000053
827 Ga0501038_0032227
828 Ga0501039_0051645
829 Ga0501039_0094232
830 Ga0501039_0173463
831 Ga0501039_0212016
832 Ga0501040_0176441
833 Ga0501041_0119814
834 Ga0501043_0000011
835 Ga0501043_0073965
836 Ga0501043_0121623
837 Ga0501046_0034453
838 Ga0501046_0122318
839 Ga0501046_0168273
840 Ga0501047_0000382
841 Ga0501047_0059087
842 Ga0501048_0000031
843 Ga0501048_0026361
844 Ga0501048_0029455
845 Ga0501048_0091076
846 Ga0501067_0076325
847 Ga0501067_0164255
848 Ga0501067_0185751
849 Ga0501068_0142747
850 Ga0501070_0005422
851 Ga0501070_0062129
852 Ga0501071_0080372
853 Ga0501072_0006385
854 Ga0501072_0023869
855 Ga0501074_0008609
856 Ga0501074_0119260
857 Ga0501075_0086030
858 Ga0501075_0166331
859 Ga0501076_0024932
860 Ga0501076_0140233
861 Ga0501077_0004621
862 Ga0501079_0066565
863 Ga0501079_0073438
864 Ga0501079_0186908
865 Ga0501080_0000478
866 Ga0501080_0008686
867 Ga0501080_0041373
868 Ga0501080_0048573
869 Ga0501080_0470926
870 Ga0501081_0023728
871 Ga0501081_0028223
872 Ga0501081_0028572
873 Ga0501081_0079268
874 Ga0501083_0002087
875 Ga0501083_0026964
876 Ga0501083_0156047
877 Ga0501044_0001546
878 Ga0501044_0083486
879 Ga0501044_0212584
880 Ga0501044_0278539
881 Ga0501044_0280042
882 Ga0501045_0071928
883 Ga0501045_0107784
884 nmdc:mga03n38_139742_c1
885 nmdc:mga03n38_6247_c1
886 nmdc:mga00v17_150699_c1
887 nmdc:mga0yw44_133501_c1
888 nmdc:mga0yw44_3013_c1
889 nmdc:mga06z11_3038_c1
890 nmdc:mga06z11_667_c1
891 nmdc:mga06z11_812_c1
892 nmdc:mga06z11_94358_c1
893 nmdc:mga04h51_27441_c1
894 nmdc:mga04h51_3639_c1
895 nmdc:mga04h51_7991_c1
896 nmdc:mga07m45_9621_c1
897 nmdc:mga05p37_112175_c1
898 nmdc:mga05p37_177294_c1
899 nmdc:mga05p37_58181_c1
900 nmdc:mga05p37_89013_c1
901 nmdc:mga09592_240638_c1
902 nmdc:mga0qj67_219044_c1
903 nmdc:mga06r32_23541_c1
904 nmdc:mga06r32_258764_c1
905 nmdc:mga08y16_24625_c1
906 nmdc:mga08y16_470253_c1
907 nmdc:mga0n895_529003_c1
908 nmdc:mga0n895_675698_c1
909 nmdc:mga0n895_7034_c1
910 nmdc:mga0rr50_114885_c1
911 nmdc:mga08x19_309392_c1
912 nmdc:mga08x19_315499_c1
913 nmdc:mga08x19_99888_c1
914 nmdc:mga0a205_446078_c1
915 nmdc:mga0sz30_97377_c1
916 Ga0495601_0000024
917 Ga0495612_0000190
918 Ga0500610_0173872
919 Ga0495595_0000089
920 Ga0495619_0000034
921 Ga0500578_0137183
922 Ga0500583_0003738
923 Ga0500651_0000742
924 Ga0500566_0049278
925 Ga0500641_0096836
926 Ga0500556_0143626
927 Ga0500595_002811
928 Ga0500595_007883
929 Ga0500614_002837
930 Ga0500658_0215942
931 Ga0500590_073350
932 Ga0500627_0151860
933 Ga0500636_0056287
934 Ga0501084_0116762
935 Ga0501084_0850749
936 Ga0501082_0000027
937 Ga0501082_0075282
938 Ga0501082_0223271
939 Ga0501082_0419013
940 641641083
941 643600692
942 8006985679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

78

252

0.89

Map