F450499

General Info

Members Datasets Scaffolds Average Seq Length
470 296 940 189

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2524023210|2524465867
Length 203
Sequence CMMLLAAPPAQAFQMNIETNLWLIRHAPVDGPKGVIHGPDAPADLGDEAALAALKARLPQGAFAICSPARRTRQTAAALGLTAAENAAFREQDFGAWTGRRHNDLAAELGDAYQAFWRSPANNRPPGGESFVDQIARAKQGLATLPAGDAVLVVHSGTIRAVLAIALDLQPGNALRFVIDPLSLTRIDRLADGWRVVAVNQKP

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
55 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
56 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
122 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
123 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
124 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
158 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
159 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
173 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
179 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
182 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
183 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
184 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
190 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
191 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
201 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
211 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
212 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
222 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
223 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
227 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
228 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
248 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
249 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
260 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
261 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
262 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
263 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
264 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
265 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
266 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
267 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
268 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
269 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
270 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
271 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
272 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
275 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
276 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
277 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
278 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
279 2791355199
280 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
281 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
282 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
283 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
284 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
285 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
286 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
287 2906610324
288 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
289 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
290 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
291 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
292 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
293 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
294 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
295 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
296 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.73
Metatranscriptomes 0
Isolates 4.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.4
Nodule 3.83
Rhizoplane 5.32
Rhizosphere 68.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10045266 3300003320 Bacteria 1700
2 JGI25404J52841_10006534 3300003659 Bacteria 2446
3 Ga0070658_10219361 3300005327 Bacteria 1608
4 Ga0070676_10417893 3300005328 Bacteria 936
5 Ga0070683_100670287 3300005329 Bacteria 993
6 Ga0070690_100210656 3300005330 Bacteria 1357
7 Ga0070680_100043924 3300005336 Bacteria 3631
8 Ga0070682_100154101 3300005337 Bacteria 1580
9 Ga0068868_100025016 3300005338 Bacteria 4535
10 Ga0070668_100047638 3300005347 Bacteria 3295
11 Ga0070668_100325790 3300005347 Bacteria 1294
12 Ga0070668_100465275 3300005347 Bacteria 1089
13 Ga0070669_100029683 3300005353 Bacteria 3943
14 Ga0070669_100292292 3300005353 Bacteria 1308
15 Ga0070671_100483111 3300005355 Bacteria 1064
16 Ga0070659_101219626 3300005366 Bacteria 666
17 Ga0070667_100274040 3300005367 Bacteria 1513
18 Ga0070667_100509150 3300005367 Bacteria 1104
19 Ga0070667_100679663 3300005367 Bacteria 951
20 Ga0070667_101007027 3300005367 Bacteria 777
21 Ga0070709_10250394 3300005434 Bacteria 1276
22 Ga0070714_100046252 3300005435 Bacteria 3691
23 Ga0070713_100133776 3300005436 Bacteria 2189
24 Ga0070663_100060164 3300005455 Bacteria 2731
25 Ga0070678_100060181 3300005456 Bacteria 2794
26 Ga0070678_100084386 3300005456 Bacteria 2417
27 Ga0070678_100654491 3300005456 Bacteria 943
28 Ga0070678_100785580 3300005456 Bacteria 863
29 Ga0070662_100033308 3300005457 Bacteria 3626
30 Ga0068867_100564534 3300005459 Bacteria 988
31 Ga0070706_100231545 3300005467 Bacteria 1725
32 Ga0070707_100102172 3300005468 Bacteria 2778
33 Ga0070679_100528258 3300005530 Bacteria 1124
34 Ga0070684_100936825 3300005535 Bacteria 812
35 Ga0068853_100074587 3300005539 Bacteria 2960
36 Ga0070672_100081150 3300005543 Bacteria 2600
37 Ga0070665_100014348 3300005548 Bacteria 7956
38 Ga0070665_100135295 3300005548 Bacteria 2466
39 Ga0068855_100459585 3300005563 Bacteria 1388
40 Ga0070664_100125868 3300005564 Bacteria 2248
41 Ga0068856_100257540 3300005614 Bacteria 1760
42 Ga0068852_100839882 3300005616 Bacteria 934
43 Ga0068852_101013416 3300005616 Bacteria 849
44 Ga0068859_100152805 3300005617 Bacteria 2384
45 Ga0068859_100625164 3300005617 Bacteria 1169
46 Ga0068864_101030781 3300005618 Bacteria 817
47 Ga0068861_100048762 3300005719 Bacteria 3203
48 Ga0068861_100108102 3300005719 Bacteria 2224
49 Ga0068861_100187451 3300005719 Bacteria 1726
50 Ga0068861_100233088 3300005719 Bacteria 1562
51 Ga0068858_100393573 3300005842 Bacteria 1331
52 Ga0068858_100441994 3300005842 Bacteria 1253
53 Ga0068860_100036438 3300005843 Bacteria 4713
54 Ga0068860_100101736 3300005843 Bacteria 2741
55 Ga0068860_100168421 3300005843 Bacteria 2115
56 Ga0068860_100368841 3300005843 Bacteria 1415
57 Ga0068862_100084221 3300005844 Bacteria 2762
58 Ga0068862_100161828 3300005844 Bacteria 1998
59 Ga0068862_100252688 3300005844 Bacteria 1607
60 Ga0068862_100391275 3300005844 Bacteria 1299
61 Ga0081455_10002785 3300005937 Bacteria 20594
62 Ga0081455_10005206 3300005937 Bacteria 14308
63 Ga0081455_10056015 3300005937 Bacteria 3350
64 Ga0081540_1001339 3300005983 Bacteria 21460
65 Ga0081540_1002098 3300005983 Bacteria 16595
66 Ga0081540_1006379 3300005983 Bacteria 8601
67 Ga0081540_1066706 3300005983 Bacteria 1685
68 Ga0075365_10005251 3300006038 Bacteria 6967
69 Ga0075365_10017857 3300006038 Bacteria 4351
70 Ga0075365_10107054 3300006038 Bacteria 1919
71 Ga0075365_10249426 3300006038 Bacteria 1247
72 Ga0075368_10047080 3300006042 Bacteria 1707
73 Ga0075368_10048249 3300006042 Bacteria 1687
74 Ga0075368_10053980 3300006042 Bacteria 1601
75 Ga0075368_10146900 3300006042 Bacteria 984
76 Ga0075363_100005356 3300006048 Bacteria 5700
77 Ga0075363_100005438 3300006048 Bacteria 5665
78 Ga0075363_100021066 3300006048 Bacteria 3278
79 Ga0075363_100443449 3300006048 Bacteria 766
80 Ga0075364_10121411 3300006051 Bacteria 1749
81 Ga0075362_10199847 3300006177 Bacteria 973
82 Ga0075362_10351353 3300006177 Bacteria 738
83 Ga0075367_10004454 3300006178 Bacteria 6842
84 Ga0075367_10030571 3300006178 Bacteria 3088
85 Ga0075367_10117532 3300006178 Bacteria 1636
86 Ga0075369_10138125 3300006186 Bacteria 1110
87 Ga0097621_100538293 3300006237 Bacteria 1062
88 Ga0075370_10085255 3300006353 Bacteria 1819
89 Ga0075370_10394326 3300006353 Bacteria 830
90 Ga0075428_100365481 3300006844 Bacteria 1548
91 Ga0075434_100166554 3300006871 Bacteria 2224
92 Ga0068865_100228952 3300006881 Bacteria 1457
93 Ga0068865_100497792 3300006881 Bacteria 1016
94 Ga0097620_100152820 3300006931 Bacteria 2384
95 Ga0097620_100625151 3300006931 Bacteria 1169
96 Ga0099825_1038399 3300006941 Bacteria 1528
97 Ga0099824_1016972 3300006942 Bacteria 6452
98 Ga0099822_1020991 3300006943 Bacteria 6383
99 Ga0099794_10201529 3300007265 Bacteria 1019
100 Ga0099795_10025754 3300007788 Bacteria 1975
101 Ga0105251_10131543 3300009011 Bacteria 1134
102 Ga0105250_10113620 3300009092 Bacteria 1110
103 Ga0105240_10028049 3300009093 Bacteria 7362
104 Ga0111539_10238946 3300009094 Bacteria 2114
105 Ga0111539_10561171 3300009094 Bacteria 1330
106 Ga0105245_10084707 3300009098 Bacteria 2905
107 Ga0105247_10231087 3300009101 Bacteria 1256
108 Ga0105243_10076659 3300009148 Bacteria 2717
109 Ga0105242_10384230 3300009176 Bacteria 1306
110 Ga0105248_10677126 3300009177 Bacteria 1164
111 Ga0105248_10756207 3300009177 Bacteria 1097
112 Ga0105249_10044542 3300009553 Bacteria 4035
113 Ga0105249_10990182 3300009553 Bacteria 909
114 Ga0099796_10098822 3300010159 Bacteria 1095
115 Ga0099796_10298784 3300010159 Bacteria 682
116 Ga0105239_10320247 3300010375 Bacteria 1748
117 Ga0105239_10422660 3300010375 Bacteria 1510
118 Ga0105239_10788348 3300010375 Bacteria 1088
119 Ga0157370_10069457 3300013104 Bacteria 3327
120 Ga0157374_10873101 3300013296 Bacteria 917
121 Ga0157378_10070410 3300013297 Bacteria 3140
122 Ga0163162_10126279 3300013306 Bacteria 2664
123 Ga0163162_10216677 3300013306 Bacteria 2044
124 Ga0163162_10232701 3300013306 Bacteria 1973
125 Ga0163162_11045445 3300013306 Bacteria 924
126 Ga0157375_10845779 3300013308 Bacteria 1062
127 Ga0163163_10211348 3300014325 Bacteria 1989
128 Ga0163163_10600169 3300014325 Bacteria 1164
129 Ga0157380_10057177 3300014326 Bacteria 3105
130 Ga0157380_10331036 3300014326 Bacteria 1416
131 Ga0157380_11048011 3300014326 Bacteria 852
132 Ga0157377_10150462 3300014745 Bacteria 1438
133 Ga0157379_10360883 3300014968 Bacteria 1331
134 Ga0157376_10822188 3300014969 Bacteria 943
135 Ga0163161_10053621 3300017792 Bacteria 2925
136 Ga0163161_10054446 3300017792 Bacteria 2903
137 Ga0209233_1003872 3300025261 Bacteria 5205
138 Ga0209758_1010903 3300025297 Bacteria 5354
139 Ga0207642_10206718 3300025899 Bacteria 1088
140 Ga0207688_10051673 3300025901 Bacteria 2302
141 Ga0207688_10233426 3300025901 Bacteria 1111
142 Ga0207705_10185370 3300025909 Bacteria 1572
143 Ga0207684_10150476 3300025910 Bacteria 2003
144 Ga0207707_10025604 3300025912 Bacteria 5160
145 Ga0207695_10098414 3300025913 Bacteria 2924
146 Ga0207660_10199750 3300025917 Bacteria 1561
147 Ga0207662_10045729 3300025918 Bacteria 2588
148 Ga0207646_10122954 3300025922 Bacteria 2333
149 Ga0207681_10214958 3300025923 Bacteria 1484
150 Ga0207681_10281531 3300025923 Bacteria 1309
151 Ga0207694_10665715 3300025924 Bacteria 877
152 Ga0207659_10276288 3300025926 Bacteria 1372
153 Ga0207659_10636748 3300025926 Bacteria 911
154 Ga0207659_11087533 3300025926 Bacteria 688
155 Ga0207687_10106615 3300025927 Bacteria 2072
156 Ga0207687_10414672 3300025927 Bacteria 1110
157 Ga0207664_10059451 3300025929 Bacteria 3043
158 Ga0207690_10326914 3300025932 Bacteria 1207
159 Ga0207706_10070323 3300025933 Bacteria 3079
160 Ga0207686_10082885 3300025934 Bacteria 2098
161 Ga0207709_10078565 3300025935 Bacteria 2119
162 Ga0207669_10016906 3300025937 Bacteria 3725
163 Ga0207669_10124659 3300025937 Bacteria 1757
164 Ga0207704_10082048 3300025938 Bacteria 2087
165 Ga0207691_10024524 3300025940 Bacteria 5672
166 Ga0207691_10290183 3300025940 Bacteria 1407
167 Ga0207691_10327137 3300025940 Bacteria 1314
168 Ga0207689_10051839 3300025942 Bacteria 3383
169 Ga0207689_10512212 3300025942 Bacteria 1006
170 Ga0207679_10135446 3300025945 Bacteria 1983
171 Ga0207679_10689021 3300025945 Bacteria 926
172 Ga0207667_10044708 3300025949 Bacteria 4692
173 Ga0207712_10020528 3300025961 Bacteria 4327
174 Ga0207712_10093335 3300025961 Bacteria 2221
175 Ga0207712_10638239 3300025961 Bacteria 924
176 Ga0207668_10014219 3300025972 Bacteria 4922
177 Ga0207668_10023280 3300025972 Bacteria 3978
178 Ga0207668_10127253 3300025972 Bacteria 1939
179 Ga0207668_10206677 3300025972 Bacteria 1567
180 Ga0207668_10796005 3300025972 Bacteria 836
181 Ga0207640_10319885 3300025981 Bacteria 1235
182 Ga0207658_10745064 3300025986 Bacteria 887
183 Ga0207677_10214810 3300026023 Bacteria 1539
184 Ga0207639_11015795 3300026041 Bacteria 777
185 Ga0207678_10033530 3300026067 Bacteria 4472
186 Ga0207678_10176575 3300026067 Bacteria 1824
187 Ga0207708_10079181 3300026075 Bacteria 2524
188 Ga0207708_10542770 3300026075 Bacteria 979
189 Ga0207648_10013362 3300026089 Bacteria 7642
190 Ga0207676_10457861 3300026095 Bacteria 1204
191 Ga0207676_10927825 3300026095 Bacteria 855
192 Ga0207675_100140615 3300026118 Bacteria 2293
193 Ga0207683_10073853 3300026121 Bacteria 3017
194 Ga0207683_10094874 3300026121 Bacteria 2659
195 Ga0207683_10303328 3300026121 Bacteria 1461
196 Ga0207683_10834440 3300026121 Bacteria 856
197 Ga0207698_10616272 3300026142 Bacteria 1071
198 Ga0207698_10671462 3300026142 Bacteria 1028
199 Ga0209589_1000005 3300027357 Bacteria 530958
200 Ga0209489_100005 3300027361 Bacteria 530958
201 Ga0209700_100006 3300027363 Bacteria 530958
202 Ga0209179_1090970 3300027512 Bacteria 677
203 Ga0209588_1063571 3300027671 Bacteria 1193
204 Ga0209813_10007473 3300027866 Bacteria 2725
205 Ga0209813_10014582 3300027866 Bacteria 2118
206 Ga0207428_10151497 3300027907 Bacteria 1765
207 Ga0207428_10164906 3300027907 Bacteria 1681
208 Ga0268266_10001136 3300028379 Bacteria 33101
209 Ga0268266_10003686 3300028379 Bacteria 15118
210 Ga0268265_10019321 3300028380 Bacteria 4733
211 Ga0268265_10179626 3300028380 Bacteria 1817
212 Ga0268265_10244967 3300028380 Bacteria 1584
213 Ga0268265_10300238 3300028380 Bacteria 1446
214 Ga0307515_10380994 3300028794 Bacteria 1043
215 Ga0307513_10208669 3300031456 Bacteria 1787
216 Ga0307513_10376127 3300031456 Bacteria 1161
217 Ga0307509_10098330 3300031507 Bacteria 2972
218 Ga0307509_10577631 3300031507 Bacteria 799
219 Ga0307508_10177357 3300031616 Bacteria 1734
220 Ga0307508_10355748 3300031616 Bacteria 1056
221 Ga0307516_10691819 3300031730 Bacteria 676
222 Ga0307413_10074429 3300031824 Bacteria 2151
223 Ga0307407_10642519 3300031903 Bacteria 794
224 Ga0307412_10231450 3300031911 Bacteria 1423
225 Ga0307409_100411552 3300031995 Bacteria 1295
226 Ga0307416_100553130 3300032002 Bacteria 1224
227 Ga0307414_10265459 3300032004 Bacteria 1435
228 Ga0307411_10075660 3300032005 Bacteria 2299
229 Ga0307411_10111973 3300032005 Bacteria 1955
230 Ga0307411_10628036 3300032005 Bacteria 927
231 Ga0307415_100187697 3300032126 Bacteria 1628
232 Ga0307415_100986976 3300032126 Bacteria 782
233 Ga0307415_101249752 3300032126 Bacteria 701
234 Ga0307510_10049365 3300033180 Bacteria 4476
235 Ga0373948_0085128 3300034817 Bacteria 727
236 Ga0373936_0025243 3300035113 Bacteria 2323
237 Ga0373945_0005116 3300035116 Bacteria 4186
238 Ga0373956_0061747 3300035119 Bacteria 1698
239 Ga0373943_0007942 3300035170 Bacteria 4763
240 Ga0373946_0007962 3300035171 Bacteria 3892
241 Ga0373955_0019278 3300035172 Bacteria 3406
242 Ga0373935_0000520 3300035692 Bacteria 20054
243 Ga0373927_0000046 3300035695 Bacteria 88401
244 Ga0373933_0000026 3300035724 Bacteria 90309
245 Ga0373933_0096806 3300035724 Bacteria 1827
246 Ga0373947_0001392 3300035725 Bacteria 14902
247 Ga0373947_0061190 3300035725 Bacteria 2288
248 Ga0373925_0009905 3300037068 Bacteria 6924
249 Ga0436365_0692305 3300039437 Bacteria 1350
250 Ga0451800_1251544 3300041459 Bacteria 657
251 Ga0451843_0965809 3300041509 Bacteria 779
252 Ga0495617_004633 3300046452 Bacteria 4976
253 Ga0495617_033605 3300046452 Bacteria 1721
254 Ga0495603_0000051 3300046455 Bacteria 50402
255 Ga0495603_0014105 3300046455 Bacteria 4834
256 Ga0495603_0029537 3300046455 Bacteria 3305
257 Ga0495603_0094660 3300046455 Bacteria 1745
258 Ga0495629_0000182 3300046459 Bacteria 56655
259 Ga0495638_0095091 3300046460 Bacteria 1790
260 Ga0495641_0006374 3300046461 Bacteria 7658
261 Ga0495641_0034489 3300046461 Bacteria 2392
262 Ga0495653_0155643 3300046463 Bacteria 1592
263 Ga0495650_0052332 3300046471 Bacteria 1677
264 Ga0495580_0004021 3300046472 Bacteria 12411
265 Ga0495582_0000137 3300046473 Bacteria 39425
266 Ga0495582_0070303 3300046473 Bacteria 1936
267 Ga0495605_0051219 3300046474 Bacteria 2011
268 Ga0495605_0105333 3300046474 Bacteria 1292
269 Ga0495639_0000047 3300046475 Bacteria 53940
270 Ga0495662_0001496 3300046476 Bacteria 11578
271 Ga0495664_0023753 3300046477 Bacteria 3558
272 Ga0495664_0036584 3300046477 Bacteria 2894
273 Ga0495584_0004064 3300046491 Bacteria 7901
274 Ga0495584_0194861 3300046491 Bacteria 1030
275 Ga0495584_0480388 3300046491 Bacteria 633
276 Ga0495585_0108313 3300046492 Bacteria 1480
277 Ga0495585_0142961 3300046492 Bacteria 1252
278 Ga0495585_0255013 3300046492 Bacteria 874
279 Ga0495594_0001833 3300046499 Bacteria 11057
280 Ga0495594_0086654 3300046499 Bacteria 1752
281 Ga0495594_0346259 3300046499 Bacteria 846
282 Ga0495610_0027980 3300046512 Bacteria 2988
283 Ga0495628_0030327 3300046516 Bacteria 4379
284 Ga0495628_0242317 3300046516 Bacteria 1348
285 Ga0495630_0002625 3300046517 Bacteria 12446
286 Ga0495631_0028762 3300046518 Bacteria 2534
287 Ga0495631_0071846 3300046518 Bacteria 1495
288 Ga0495632_0261140 3300046519 Bacteria 774
289 Ga0495643_0243705 3300046522 Bacteria 842
290 Ga0495644_0024756 3300046523 Bacteria 2283
291 Ga0495644_0029810 3300046523 Bacteria 2061
292 Ga0495644_0057387 3300046523 Bacteria 1463
293 Ga0495648_0256060 3300046524 Bacteria 842
294 Ga0495663_0131087 3300046525 Bacteria 845
295 Ga0495642_0170544 3300046528 Bacteria 945
296 Ga0495652_0282650 3300046529 Bacteria 1214
297 Ga0495665_0001239 3300046531 Bacteria 13612
298 Ga0495640_0004375 3300046533 Bacteria 11274
299 Ga0495640_0555236 3300046533 Bacteria 696
300 Ga0495586_0056945 3300046535 Bacteria 2121
301 Ga0495598_0043977 3300046537 Bacteria 1317
302 Ga0495609_0166702 3300046538 Bacteria 931
303 Ga0495597_0080546 3300046542 Bacteria 1393
304 Ga0495622_0006199 3300046557 Bacteria 5554
305 Ga0495633_0122039 3300046558 Bacteria 1207
306 Ga0495656_0041903 3300046615 Bacteria 1915
307 Ga0495656_0526367 3300046615 Bacteria 629
308 Ga0495668_0058539 3300046616 Bacteria 2126
309 Ga0495668_0086728 3300046616 Bacteria 1717
310 Ga0495668_0114481 3300046616 Bacteria 1475
311 Ga0495668_0339589 3300046616 Bacteria 824
312 Ga0495668_0426280 3300046616 Bacteria 730
313 Ga0495634_0002221 3300046642 Bacteria 16276
314 Ga0495611_0016179 3300046648 Bacteria 3188
315 Ga0495611_0288483 3300046648 Bacteria 757
316 Ga0495625_0512308 3300046660 Bacteria 732
317 Ga0495635_0001455 3300046663 Bacteria 15846
318 Ga0495659_0017854 3300046664 Bacteria 2357
319 Ga0495661_0053274 3300046665 Bacteria 2434
320 Ga0495588_0009398 3300046674 Bacteria 4518
321 Ga0495588_0027119 3300046674 Bacteria 2862
322 Ga0495588_0163373 3300046674 Bacteria 1177
323 Ga0495646_0019779 3300046680 Bacteria 4258
324 Ga0495647_0000577 3300046681 Bacteria 10837
325 Ga0495658_0001786 3300046683 Bacteria 11096
326 Ga0495669_0031413 3300046684 Bacteria 2332
327 Ga0495669_0234091 3300046684 Bacteria 881
328 Ga0495613_0007297 3300046689 Bacteria 8233
329 Ga0495624_0000898 3300046690 Bacteria 23624
330 Ga0495670_0045161 3300046691 Bacteria 2199
331 Ga0495670_0183077 3300046691 Bacteria 1107
332 Ga0495670_0234735 3300046691 Bacteria 976
333 Ga0495671_0113078 3300046692 Bacteria 1326
334 Ga0495671_0306107 3300046692 Bacteria 764
335 Ga0495649_0186236 3300046694 Bacteria 1081
336 Ga0495589_0122209 3300046794 Bacteria 1253
337 Ga0495600_0243881 3300046809 Bacteria 1144
338 Ga0495660_0247325 3300046810 Bacteria 829
339 Ga0495660_0289536 3300046810 Bacteria 746
340 Ga0495581_0001056 3300047315 Bacteria 14926
341 Ga0495604_0084738 3300047317 Bacteria 2366
342 Ga0495636_0134339 3300047318 Bacteria 1102
343 Ga0495636_0228663 3300047318 Bacteria 855
344 Ga0495674_0010092 3300047319 Bacteria 8948
345 Ga0495672_0070210 3300047320 Bacteria 1985
346 Ga0495672_0194056 3300047320 Bacteria 1019
347 Ga0495676_0060784 3300047321 Bacteria 2959
348 Ga0495683_0163596 3300047323 Bacteria 1027
349 Ga0495683_0182600 3300047323 Bacteria 957
350 Ga0495677_0086461 3300047445 Bacteria 1179
351 Ga0495673_0018535 3300047469 Bacteria 3505
352 Ga0495684_0024347 3300047471 Bacteria 4661
353 Ga0495686_0390661 3300047472 Bacteria 749
354 Ga0495593_0000469 3300047673 Bacteria 22695
355 Ga0495614_0001926 3300048089 Bacteria 9106
356 Ga0495615_0044514 3300048090 Bacteria 1121
357 Ga0495615_0046473 3300048090 Bacteria 1103
358 Ga0496102_0101431 3300048905 Bacteria 2674
359 Ga0496102_0257586 3300048905 Bacteria 1645
360 Ga0496102_0637510 3300048905 Bacteria 989
361 Ga0496102_0832897 3300048905 Bacteria 845
362 Ga0496102_0861075 3300048905 Bacteria 828
363 Ga0496103_0396319 3300048906 Bacteria 887
364 Ga0496104_1010717 3300048907 Bacteria 735
365 Ga0496106_0000358 3300048909 Bacteria 32366
366 Ga0496106_0126786 3300048909 Bacteria 1999
367 Ga0496106_0194535 3300048909 Bacteria 1613
368 Ga0496107_0365094 3300048910 Bacteria 1074
369 Ga0496107_0495666 3300048910 Bacteria 906
370 Ga0496109_0081549 3300048912 Bacteria 2981
371 Ga0496109_0238740 3300048912 Bacteria 1710
372 Ga0496110_0179915 3300048913 Bacteria 1920
373 Ga0496110_0202851 3300048913 Bacteria 1802
374 Ga0496110_0784853 3300048913 Bacteria 857
375 Ga0496111_0077955 3300048914 Bacteria 2416
376 Ga0496111_0098257 3300048914 Bacteria 2150
377 Ga0496112_0088806 3300048915 Bacteria 3059
378 Ga0496112_0366426 3300048915 Bacteria 1382
379 Ga0496113_0039748 3300048916 Bacteria 3464
380 Ga0496113_0184683 3300048916 Bacteria 1653
381 Ga0496113_0331517 3300048916 Bacteria 1220
382 Ga0496117_0051494 3300048920 Bacteria 2910
383 Ga0496118_0000618 3300048921 Bacteria 58468
384 Ga0496118_0350650 3300048921 Bacteria 787
385 Ga0496119_0087910 3300048922 Bacteria 1773
386 Ga0496119_0284892 3300048922 Bacteria 820
387 Ga0496121_0000212 3300048924 Bacteria 127508
388 Ga0496121_0000265 3300048924 Bacteria 109251
389 Ga0496121_0079161 3300048924 Bacteria 2610
390 Ga0496121_0307400 3300048924 Bacteria 1073
391 Ga0496124_0000861 3300048927 Bacteria 49579
392 Ga0496124_0144288 3300048927 Bacteria 1875
393 Ga0496125_0007310 3300048928 Bacteria 11757
394 Ga0496125_0165690 3300048928 Bacteria 1494
395 Ga0496125_0545821 3300048928 Bacteria 643
396 Ga0496126_0005496 3300048929 Bacteria 14446
397 Ga0496126_0020062 3300048929 Bacteria 6563
398 Ga0496126_0123865 3300048929 Bacteria 2239
399 Ga0496126_0173996 3300048929 Bacteria 1832
400 Ga0496126_0229389 3300048929 Bacteria 1556
401 Ga0496126_0367596 3300048929 Bacteria 1173
402 Ga0496126_0493565 3300048929 Bacteria 979
403 Ga0501038_0454028 3300049574 Bacteria 985
404 Ga0501041_0258599 3300049577 Bacteria 1095
405 nmdc:mga03683_284341_c1 3300050489 Bacteria 773
406 nmdc:mga03683_56612_c1 3300050489 Bacteria 1648
407 nmdc:mga03n38_317992_c1 3300050490 Bacteria 840
408 nmdc:mga03n38_7185_c1 3300050490 Bacteria 3924
409 nmdc:mga00v17_119244_c1 3300050491 Bacteria 1679
410 nmdc:mga00v17_149882_c1 3300050491 Bacteria 1498
411 nmdc:mga00v17_82216_c1 3300050491 Bacteria 2012
412 nmdc:mga0yw44_40766_c1 3300050492 Bacteria 2761
413 nmdc:mga0yw44_452810_c1 3300050492 Bacteria 870
414 nmdc:mga0yw44_54872_c1 3300050492 Bacteria 2423
415 nmdc:mga0yw44_758431_c1 3300050492 Bacteria 659
416 nmdc:mga0k408_176400_c2 3300050493 Bacteria 919
417 nmdc:mga0k408_199112_c1 3300050493 Bacteria 1195
418 nmdc:mga06z11_26385_c1 3300050494 Bacteria 2764
419 nmdc:mga06z11_330647_c1 3300050494 Bacteria 910
420 nmdc:mga06z11_8297_c1 3300050494 Bacteria 4324
421 nmdc:mga04h51_5206_c1 3300050495 Bacteria 3301
422 nmdc:mga07m45_313138_c1 3300050496 Bacteria 912
423 nmdc:mga07m45_55223_c1 3300050496 Bacteria 2245
424 nmdc:mga09592_450515_c1 3300050508 Bacteria 1110
425 nmdc:mga08y16_214839_c1 3300050511 Bacteria 1991
426 nmdc:mga08y16_636696_c1 3300050511 Bacteria 1072
427 nmdc:mga0n895_105724_c1 3300050512 Bacteria 2827
428 nmdc:mga0sz30_48619_c2 3300050516 Bacteria 1384
429 Ga0500635_0024067 3300053080 Bacteria 1907
430 Ga0500646_0044103 3300053090 Bacteria 1265
431 Ga0500641_0091160 3300053096 Bacteria 1301
432 Ga0500562_033486 3300053108 Bacteria 1358
433 Ga0500595_002442 3300053119 Bacteria 9222
434 Ga0500595_056000 3300053119 Bacteria 1206
435 Ga0500595_057448 3300053119 Bacteria 1185
436 Ga0500658_0076628 3300053134 Bacteria 1422
437 Ga0500658_0103297 3300053134 Bacteria 1246
438 Ga0500568_0153429 3300053139 Bacteria 852
439 Ga0500577_0141265 3300053142 Bacteria 1016
440 Ga0500577_0235735 3300053142 Bacteria 794
441 Ga0500588_0122921 3300053146 Bacteria 917
442 Ga0500604_0082824 3300053151 Bacteria 1039
443 Ga0500604_0094900 3300053151 Bacteria 978
444 Ga0500636_0413415 3300053177 Bacteria 622
445 Ga0500637_0070637 3300053178 Bacteria 2008
446 Ga0500645_030482 3300053730 Bacteria 1622
447 Ga0501082_0222673 3300060353 Bacteria 1642
448 Ga0530510_0326911 3300061734 Bacteria 1150
449 2524465867 2524023210 Bacteria 9029266
450 2513673299 2513237098 Bacteria 9902361
451 2513863602 2513237137 Bacteria 9558895
452 2723848844 2721755755 Bacteria 8322773
453 2793078841
454 2876817809 2876808645 Bacteria 8824342
455 2879116815 2879110137 Bacteria 8907982
456 2885378573 2885374607 Bacteria 8927485
457 2885387310 2885383462 Bacteria 9473874
458 2889034468 2889033259 Bacteria 9099371
459 2903774352 2903768456 Bacteria 9749579
460 2904692707 2904690495 Bacteria 9412302
461 2906612412
462 2906636759 2906635258 Bacteria 8601019
463 2906663454 2906660503 Bacteria 8595048
464 2908757653 2908756301 Bacteria 8864324
465 2935633043 2935630451 Bacteria 8169952
466 2941509655 2941507105 Bacteria 8166816
467 2941517484 2941515067 Bacteria 8166720
468 2941526563 2941523033 Bacteria 8169134
469 8006992960 8006984368 Bacteria 9651211
470 8056689813 8056681323 Bacteria 8472857
471 rootH2_10045266
472 JGI25404J52841_10006534
473 Ga0070658_10219361
474 Ga0070676_10417893
475 Ga0070683_100670287
476 Ga0070690_100210656
477 Ga0070680_100043924
478 Ga0070682_100154101
479 Ga0068868_100025016
480 Ga0070668_100047638
481 Ga0070668_100325790
482 Ga0070668_100465275
483 Ga0070669_100029683
484 Ga0070669_100292292
485 Ga0070671_100483111
486 Ga0070659_101219626
487 Ga0070667_100274040
488 Ga0070667_100509150
489 Ga0070667_100679663
490 Ga0070667_101007027
491 Ga0070709_10250394
492 Ga0070714_100046252
493 Ga0070713_100133776
494 Ga0070663_100060164
495 Ga0070678_100060181
496 Ga0070678_100084386
497 Ga0070678_100654491
498 Ga0070678_100785580
499 Ga0070662_100033308
500 Ga0068867_100564534
501 Ga0070706_100231545
502 Ga0070707_100102172
503 Ga0070679_100528258
504 Ga0070684_100936825
505 Ga0068853_100074587
506 Ga0070672_100081150
507 Ga0070665_100014348
508 Ga0070665_100135295
509 Ga0068855_100459585
510 Ga0070664_100125868
511 Ga0068856_100257540
512 Ga0068852_100839882
513 Ga0068852_101013416
514 Ga0068859_100152805
515 Ga0068859_100625164
516 Ga0068864_101030781
517 Ga0068861_100048762
518 Ga0068861_100108102
519 Ga0068861_100187451
520 Ga0068861_100233088
521 Ga0068858_100393573
522 Ga0068858_100441994
523 Ga0068860_100036438
524 Ga0068860_100101736
525 Ga0068860_100168421
526 Ga0068860_100368841
527 Ga0068862_100084221
528 Ga0068862_100161828
529 Ga0068862_100252688
530 Ga0068862_100391275
531 Ga0081455_10002785
532 Ga0081455_10005206
533 Ga0081455_10056015
534 Ga0081540_1001339
535 Ga0081540_1002098
536 Ga0081540_1006379
537 Ga0081540_1066706
538 Ga0075365_10005251
539 Ga0075365_10017857
540 Ga0075365_10107054
541 Ga0075365_10249426
542 Ga0075368_10047080
543 Ga0075368_10048249
544 Ga0075368_10053980
545 Ga0075368_10146900
546 Ga0075363_100005356
547 Ga0075363_100005438
548 Ga0075363_100021066
549 Ga0075363_100443449
550 Ga0075364_10121411
551 Ga0075362_10199847
552 Ga0075362_10351353
553 Ga0075367_10004454
554 Ga0075367_10030571
555 Ga0075367_10117532
556 Ga0075369_10138125
557 Ga0097621_100538293
558 Ga0075370_10085255
559 Ga0075370_10394326
560 Ga0075428_100365481
561 Ga0075434_100166554
562 Ga0068865_100228952
563 Ga0068865_100497792
564 Ga0097620_100152820
565 Ga0097620_100625151
566 Ga0099825_1038399
567 Ga0099824_1016972
568 Ga0099822_1020991
569 Ga0099794_10201529
570 Ga0099795_10025754
571 Ga0105251_10131543
572 Ga0105250_10113620
573 Ga0105240_10028049
574 Ga0111539_10238946
575 Ga0111539_10561171
576 Ga0105245_10084707
577 Ga0105247_10231087
578 Ga0105243_10076659
579 Ga0105242_10384230
580 Ga0105248_10677126
581 Ga0105248_10756207
582 Ga0105249_10044542
583 Ga0105249_10990182
584 Ga0099796_10098822
585 Ga0099796_10298784
586 Ga0105239_10320247
587 Ga0105239_10422660
588 Ga0105239_10788348
589 Ga0157370_10069457
590 Ga0157374_10873101
591 Ga0157378_10070410
592 Ga0163162_10126279
593 Ga0163162_10216677
594 Ga0163162_10232701
595 Ga0163162_11045445
596 Ga0157375_10845779
597 Ga0163163_10211348
598 Ga0163163_10600169
599 Ga0157380_10057177
600 Ga0157380_10331036
601 Ga0157380_11048011
602 Ga0157377_10150462
603 Ga0157379_10360883
604 Ga0157376_10822188
605 Ga0163161_10053621
606 Ga0163161_10054446
607 Ga0209233_1003872
608 Ga0209758_1010903
609 Ga0207642_10206718
610 Ga0207688_10051673
611 Ga0207688_10233426
612 Ga0207705_10185370
613 Ga0207684_10150476
614 Ga0207707_10025604
615 Ga0207695_10098414
616 Ga0207660_10199750
617 Ga0207662_10045729
618 Ga0207646_10122954
619 Ga0207681_10214958
620 Ga0207681_10281531
621 Ga0207694_10665715
622 Ga0207659_10276288
623 Ga0207659_10636748
624 Ga0207659_11087533
625 Ga0207687_10106615
626 Ga0207687_10414672
627 Ga0207664_10059451
628 Ga0207690_10326914
629 Ga0207706_10070323
630 Ga0207686_10082885
631 Ga0207709_10078565
632 Ga0207669_10016906
633 Ga0207669_10124659
634 Ga0207704_10082048
635 Ga0207691_10024524
636 Ga0207691_10290183
637 Ga0207691_10327137
638 Ga0207689_10051839
639 Ga0207689_10512212
640 Ga0207679_10135446
641 Ga0207679_10689021
642 Ga0207667_10044708
643 Ga0207712_10020528
644 Ga0207712_10093335
645 Ga0207712_10638239
646 Ga0207668_10014219
647 Ga0207668_10023280
648 Ga0207668_10127253
649 Ga0207668_10206677
650 Ga0207668_10796005
651 Ga0207640_10319885
652 Ga0207658_10745064
653 Ga0207677_10214810
654 Ga0207639_11015795
655 Ga0207678_10033530
656 Ga0207678_10176575
657 Ga0207708_10079181
658 Ga0207708_10542770
659 Ga0207648_10013362
660 Ga0207676_10457861
661 Ga0207676_10927825
662 Ga0207675_100140615
663 Ga0207683_10073853
664 Ga0207683_10094874
665 Ga0207683_10303328
666 Ga0207683_10834440
667 Ga0207698_10616272
668 Ga0207698_10671462
669 Ga0209589_1000005
670 Ga0209489_100005
671 Ga0209700_100006
672 Ga0209179_1090970
673 Ga0209588_1063571
674 Ga0209813_10007473
675 Ga0209813_10014582
676 Ga0207428_10151497
677 Ga0207428_10164906
678 Ga0268266_10001136
679 Ga0268266_10003686
680 Ga0268265_10019321
681 Ga0268265_10179626
682 Ga0268265_10244967
683 Ga0268265_10300238
684 Ga0307515_10380994
685 Ga0307513_10208669
686 Ga0307513_10376127
687 Ga0307509_10098330
688 Ga0307509_10577631
689 Ga0307508_10177357
690 Ga0307508_10355748
691 Ga0307516_10691819
692 Ga0307413_10074429
693 Ga0307407_10642519
694 Ga0307412_10231450
695 Ga0307409_100411552
696 Ga0307416_100553130
697 Ga0307414_10265459
698 Ga0307411_10075660
699 Ga0307411_10111973
700 Ga0307411_10628036
701 Ga0307415_100187697
702 Ga0307415_100986976
703 Ga0307415_101249752
704 Ga0307510_10049365
705 Ga0373948_0085128
706 Ga0373936_0025243
707 Ga0373945_0005116
708 Ga0373956_0061747
709 Ga0373943_0007942
710 Ga0373946_0007962
711 Ga0373955_0019278
712 Ga0373935_0000520
713 Ga0373927_0000046
714 Ga0373933_0000026
715 Ga0373933_0096806
716 Ga0373947_0001392
717 Ga0373947_0061190
718 Ga0373925_0009905
719 Ga0436365_0692305
720 Ga0451800_1251544
721 Ga0451843_0965809
722 Ga0495617_004633
723 Ga0495617_033605
724 Ga0495603_0000051
725 Ga0495603_0014105
726 Ga0495603_0029537
727 Ga0495603_0094660
728 Ga0495629_0000182
729 Ga0495638_0095091
730 Ga0495641_0006374
731 Ga0495641_0034489
732 Ga0495653_0155643
733 Ga0495650_0052332
734 Ga0495580_0004021
735 Ga0495582_0000137
736 Ga0495582_0070303
737 Ga0495605_0051219
738 Ga0495605_0105333
739 Ga0495639_0000047
740 Ga0495662_0001496
741 Ga0495664_0023753
742 Ga0495664_0036584
743 Ga0495584_0004064
744 Ga0495584_0194861
745 Ga0495584_0480388
746 Ga0495585_0108313
747 Ga0495585_0142961
748 Ga0495585_0255013
749 Ga0495594_0001833
750 Ga0495594_0086654
751 Ga0495594_0346259
752 Ga0495610_0027980
753 Ga0495628_0030327
754 Ga0495628_0242317
755 Ga0495630_0002625
756 Ga0495631_0028762
757 Ga0495631_0071846
758 Ga0495632_0261140
759 Ga0495643_0243705
760 Ga0495644_0024756
761 Ga0495644_0029810
762 Ga0495644_0057387
763 Ga0495648_0256060
764 Ga0495663_0131087
765 Ga0495642_0170544
766 Ga0495652_0282650
767 Ga0495665_0001239
768 Ga0495640_0004375
769 Ga0495640_0555236
770 Ga0495586_0056945
771 Ga0495598_0043977
772 Ga0495609_0166702
773 Ga0495597_0080546
774 Ga0495622_0006199
775 Ga0495633_0122039
776 Ga0495656_0041903
777 Ga0495656_0526367
778 Ga0495668_0058539
779 Ga0495668_0086728
780 Ga0495668_0114481
781 Ga0495668_0339589
782 Ga0495668_0426280
783 Ga0495634_0002221
784 Ga0495611_0016179
785 Ga0495611_0288483
786 Ga0495625_0512308
787 Ga0495635_0001455
788 Ga0495659_0017854
789 Ga0495661_0053274
790 Ga0495588_0009398
791 Ga0495588_0027119
792 Ga0495588_0163373
793 Ga0495646_0019779
794 Ga0495647_0000577
795 Ga0495658_0001786
796 Ga0495669_0031413
797 Ga0495669_0234091
798 Ga0495613_0007297
799 Ga0495624_0000898
800 Ga0495670_0045161
801 Ga0495670_0183077
802 Ga0495670_0234735
803 Ga0495671_0113078
804 Ga0495671_0306107
805 Ga0495649_0186236
806 Ga0495589_0122209
807 Ga0495600_0243881
808 Ga0495660_0247325
809 Ga0495660_0289536
810 Ga0495581_0001056
811 Ga0495604_0084738
812 Ga0495636_0134339
813 Ga0495636_0228663
814 Ga0495674_0010092
815 Ga0495672_0070210
816 Ga0495672_0194056
817 Ga0495676_0060784
818 Ga0495683_0163596
819 Ga0495683_0182600
820 Ga0495677_0086461
821 Ga0495673_0018535
822 Ga0495684_0024347
823 Ga0495686_0390661
824 Ga0495593_0000469
825 Ga0495614_0001926
826 Ga0495615_0044514
827 Ga0495615_0046473
828 Ga0496102_0101431
829 Ga0496102_0257586
830 Ga0496102_0637510
831 Ga0496102_0832897
832 Ga0496102_0861075
833 Ga0496103_0396319
834 Ga0496104_1010717
835 Ga0496106_0000358
836 Ga0496106_0126786
837 Ga0496106_0194535
838 Ga0496107_0365094
839 Ga0496107_0495666
840 Ga0496109_0081549
841 Ga0496109_0238740
842 Ga0496110_0179915
843 Ga0496110_0202851
844 Ga0496110_0784853
845 Ga0496111_0077955
846 Ga0496111_0098257
847 Ga0496112_0088806
848 Ga0496112_0366426
849 Ga0496113_0039748
850 Ga0496113_0184683
851 Ga0496113_0331517
852 Ga0496117_0051494
853 Ga0496118_0000618
854 Ga0496118_0350650
855 Ga0496119_0087910
856 Ga0496119_0284892
857 Ga0496121_0000212
858 Ga0496121_0000265
859 Ga0496121_0079161
860 Ga0496121_0307400
861 Ga0496124_0000861
862 Ga0496124_0144288
863 Ga0496125_0007310
864 Ga0496125_0165690
865 Ga0496125_0545821
866 Ga0496126_0005496
867 Ga0496126_0020062
868 Ga0496126_0123865
869 Ga0496126_0173996
870 Ga0496126_0229389
871 Ga0496126_0367596
872 Ga0496126_0493565
873 Ga0501038_0454028
874 Ga0501041_0258599
875 nmdc:mga03683_284341_c1
876 nmdc:mga03683_56612_c1
877 nmdc:mga03n38_317992_c1
878 nmdc:mga03n38_7185_c1
879 nmdc:mga00v17_119244_c1
880 nmdc:mga00v17_149882_c1
881 nmdc:mga00v17_82216_c1
882 nmdc:mga0yw44_40766_c1
883 nmdc:mga0yw44_452810_c1
884 nmdc:mga0yw44_54872_c1
885 nmdc:mga0yw44_758431_c1
886 nmdc:mga0k408_176400_c2
887 nmdc:mga0k408_199112_c1
888 nmdc:mga06z11_26385_c1
889 nmdc:mga06z11_330647_c1
890 nmdc:mga06z11_8297_c1
891 nmdc:mga04h51_5206_c1
892 nmdc:mga07m45_313138_c1
893 nmdc:mga07m45_55223_c1
894 nmdc:mga09592_450515_c1
895 nmdc:mga08y16_214839_c1
896 nmdc:mga08y16_636696_c1
897 nmdc:mga0n895_105724_c1
898 nmdc:mga0sz30_48619_c2
899 Ga0500635_0024067
900 Ga0500646_0044103
901 Ga0500641_0091160
902 Ga0500562_033486
903 Ga0500595_002442
904 Ga0500595_056000
905 Ga0500595_057448
906 Ga0500658_0076628
907 Ga0500658_0103297
908 Ga0500568_0153429
909 Ga0500577_0141265
910 Ga0500577_0235735
911 Ga0500588_0122921
912 Ga0500604_0082824
913 Ga0500604_0094900
914 Ga0500636_0413415
915 Ga0500637_0070637
916 Ga0500645_030482
917 Ga0501082_0222673
918 Ga0530510_0326911
919 2524465867
920 2513673299
921 2513863602
922 2723848844
923 2793078841
924 2876817809
925 2879116815
926 2885378573
927 2885387310
928 2889034468
929 2903774352
930 2904692707
931 2906612412
932 2906636759
933 2906663454
934 2908757653
935 2935633043
936 2941509655
937 2941517484
938 2941526563
939 8006992960
940 8056689813

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

21

202

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6e4b-assembly2.cif.gz_C the crystal structure of a putative alpha-ribazole-5'-p phosphatase from escherichia coli str. k-12 substr. mg1655 0.8935 1 167
6e4b-assembly2.cif.gz_C the crystal structure of a putative alpha-ribazole-5'-p phosphatase from escherichia coli str. k-12 substr. mg1655 0.8837 1 167
1c7z-assembly1.cif.gz_B regulatory complex of fructose-2,6-bisphosphatase 0.8638 4 165
6nru-assembly5.cif.gz_E crystal structure of the alpha-ribazole phosphatase from shigella flexneri 0.863 2 167
1ebb-assembly1.cif.gz_A bacillus stearothermophilus yhfr 0.8581 1 165
ID Description Score Start End Superfamily
af_P40433_396_638_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8843 29 162 3.40.50.1240
af_Q54SI2_327_480_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8811 28 161 3.40.50.1240
af_Q86HD1_259_461_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8745 14 147 3.40.50.1240
af_A4ICX2_259_477_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8743 29 165 3.40.50.1240
af_Q4DA36_516_731_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8662 21 149 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A1M6X0X0-F1-model_v4 Alpha-ribazole phosphatase 0.9857 1 167
AF-A0A560DQ27-F1-model_v4 Alpha-ribazole phosphatase 0.9855 1 167 GO:0005737
GO:0016791
AF-A0A317HQN8-F1-model_v4 deleted 0.9855 21 168
AF-A0A533J5V6-F1-model_v4 deleted 0.9827 76 168
AF-A0A0R3LQU7-F1-model_v4 Alpha-ribazole phosphatase 0.976 1 167

Map