F450495

General Info

Members Datasets Scaffolds Average Seq Length
470 235 940 152

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_582925_c1|nmdc:mga0n895_582925_c1_510_1061
Length 183
Sequence MTAAADVSITGLAVRPLIGAGVAGPSSAPGAKTMRKITPFLWFDSEAEEAMNYYLSIFKNGRVVSVNRANGRVLTVAFELEGQRFMGLNAGPKFKFNEAISFFADCETQAEVDELWEQLSAGGEKSRCGWLKDKYGLWWQIIPSTLGKLMSDSNSGKAHAVMQAMLKMDKIVIDDLRRAYEAA

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
168 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
174 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
229 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
230 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
231 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
232 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.15
Nodule 0
Rhizoplane 0.85
Rhizosphere 90
Stem 0
Stem Tuber 0
Unclassified 7.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_582925_c1 3300050512 Bacteria 1122
2 SwRhRL3b_contig_862913 2162886006 Bacteria 6633
3 SwRhRL2b_contig_3445787 2162886007 Bacteria 3745
4 Ga0065704_10001073 3300005289 Bacteria 9991
5 Ga0065704_10642682 3300005289 Bacteria 573
6 Ga0065712_10537915 3300005290 Bacteria 625
7 Ga0065712_10561242 3300005290 Bacteria 612
8 Ga0065707_10000452 3300005295 Bacteria 48326
9 Ga0065707_10023764 3300005295 Bacteria 2153
10 Ga0065707_10098635 3300005295 Bacteria 3070
11 Ga0070658_10330703 3300005327 Bacteria 1302
12 Ga0070658_11438948 3300005327 Unclassified 598
13 Ga0070683_100024574 3300005329 Bacteria 5398
14 Ga0070683_100025306 3300005329 Bacteria 5329
15 Ga0070683_100076899 3300005329 Unclassified 3121
16 Ga0070683_100081219 3300005329 Bacteria 3035
17 Ga0070683_102129108 3300005329 Bacteria 539
18 Ga0070670_100036578 3300005331 Bacteria 4225
19 Ga0070670_101544067 3300005331 Bacteria 610
20 Ga0070677_10497314 3300005333 Bacteria 660
21 Ga0068869_101401496 3300005334 Bacteria 619
22 Ga0070680_100067435 3300005336 Unclassified 2935
23 Ga0070680_100314141 3300005336 Bacteria 1330
24 Ga0068868_100406633 3300005338 Bacteria 1176
25 Ga0070689_100049716 3300005340 Unclassified 3238
26 Ga0070689_100238758 3300005340 Bacteria 1496
27 Ga0070689_100364921 3300005340 Bacteria 1214
28 Ga0070661_100074706 3300005344 Unclassified 2496
29 Ga0070661_100215486 3300005344 Bacteria 1471
30 Ga0070669_100062510 3300005353 Bacteria 2738
31 Ga0070669_100063021 3300005353 Bacteria 2728
32 Ga0070669_100932027 3300005353 Bacteria 743
33 Ga0070675_100019110 3300005354 Bacteria 5459
34 Ga0070675_100092340 3300005354 Bacteria 2537
35 Ga0070675_100309232 3300005354 Bacteria 1394
36 Ga0070675_100387595 3300005354 Bacteria 1245
37 Ga0070675_100655786 3300005354 Bacteria 954
38 Ga0070675_100918433 3300005354 Bacteria 803
39 Ga0070674_100649408 3300005356 Bacteria 897
40 Ga0070674_101015146 3300005356 Bacteria 729
41 Ga0070673_100152563 3300005364 Bacteria 1958
42 Ga0070673_101185955 3300005364 Bacteria 715
43 Ga0070688_100184614 3300005365 Bacteria 1449
44 Ga0070688_100936981 3300005365 Bacteria 685
45 Ga0070659_100012596 3300005366 Bacteria 6271
46 Ga0070701_10316470 3300005438 Bacteria 964
47 Ga0070705_100194351 3300005440 Bacteria 1386
48 Ga0070700_100091286 3300005441 Unclassified 1988
49 Ga0070700_100439447 3300005441 Bacteria 990
50 Ga0070694_100268677 3300005444 Bacteria 1296
51 Ga0070694_100336111 3300005444 Bacteria 1166
52 Ga0070708_100086079 3300005445 Bacteria 2854
53 Ga0070663_100143885 3300005455 Bacteria 1823
54 Ga0070678_100152193 3300005456 Bacteria 1865
55 Ga0070662_100602517 3300005457 Bacteria 924
56 Ga0070681_10093349 3300005458 Bacteria 2958
57 Ga0070681_11396163 3300005458 Unclassified 624
58 Ga0068867_102409317 3300005459 Bacteria 501
59 Ga0070685_10312913 3300005466 Bacteria 1062
60 Ga0070685_10540904 3300005466 Unclassified 830
61 Ga0070706_100017949 3300005467 Bacteria 6528
62 Ga0070706_100158108 3300005467 Bacteria 2116
63 Ga0070707_100979746 3300005468 Bacteria 811
64 Ga0070707_101510105 3300005468 Bacteria 639
65 Ga0070698_100015376 3300005471 Bacteria 8087
66 Ga0070698_100114685 3300005471 Bacteria 2658
67 Ga0070698_101179442 3300005471 Bacteria 715
68 Ga0070699_100011038 3300005518 Bacteria 7811
69 Ga0070699_100140060 3300005518 Bacteria 2135
70 Ga0070699_101385833 3300005518 Bacteria 645
71 Ga0070679_100020989 3300005530 Bacteria 6373
72 Ga0070679_100190862 3300005530 Bacteria 2018
73 Ga0070684_100019666 3300005535 Bacteria 5588
74 Ga0070684_100061917 3300005535 Bacteria 3277
75 Ga0070684_100701083 3300005535 Bacteria 944
76 Ga0070697_101376862 3300005536 Bacteria 630
77 Ga0068853_100555408 3300005539 Bacteria 1088
78 Ga0070672_100022820 3300005543 Bacteria 4603
79 Ga0070696_100048603 3300005546 Bacteria 2945
80 Ga0070665_100118868 3300005548 Bacteria 2645
81 Ga0070704_100107021 3300005549 Bacteria 2120
82 Ga0070704_100523902 3300005549 Bacteria 1032
83 Ga0068855_100289799 3300005563 Unclassified 1815
84 Ga0070664_100092582 3300005564 Bacteria 2618
85 Ga0070664_100236856 3300005564 Bacteria 1637
86 Ga0070664_100313459 3300005564 Bacteria 1420
87 Ga0070664_101078635 3300005564 Bacteria 756
88 Ga0068857_100001626 3300005577 Bacteria 18044
89 Ga0068854_100438795 3300005578 Bacteria 1088
90 Ga0068856_100244885 3300005614 Bacteria 1808
91 Ga0068852_101659078 3300005616 Bacteria 662
92 Ga0068859_100036031 3300005617 Bacteria 4965
93 Ga0068859_100423696 3300005617 Bacteria 1427
94 Ga0068859_100763299 3300005617 Bacteria 1056
95 Ga0068859_100936502 3300005617 Bacteria 950
96 Ga0068859_101346353 3300005617 Bacteria 787
97 Ga0068864_100268554 3300005618 Bacteria 1589
98 Ga0068864_100629216 3300005618 Bacteria 1043
99 Ga0068861_100027032 3300005719 Bacteria 4176
100 Ga0068861_100044470 3300005719 Bacteria 3340
101 Ga0068861_100298113 3300005719 Bacteria 1395
102 Ga0068861_100404569 3300005719 Unclassified 1212
103 Ga0068861_101137207 3300005719 Bacteria 752
104 Ga0068851_10028199 3300005834 Bacteria 2773
105 Ga0068851_10043228 3300005834 Bacteria 2271
106 Ga0068851_10141390 3300005834 Bacteria 1309
107 Ga0068870_10035567 3300005840 Bacteria 2557
108 Ga0068858_100007211 3300005842 Bacteria 10776
109 Ga0068858_100835175 3300005842 Unclassified 899
110 Ga0068858_100867514 3300005842 Bacteria 882
111 Ga0068860_100235772 3300005843 Bacteria 1779
112 Ga0068860_100305003 3300005843 Bacteria 1561
113 Ga0068860_100487945 3300005843 Bacteria 1228
114 Ga0068862_100212799 3300005844 Unclassified 1747
115 Ga0068862_100514423 3300005844 Bacteria 1138
116 Ga0068862_100642389 3300005844 Bacteria 1023
117 Ga0068862_102696746 3300005844 Unclassified 509
118 Ga0081539_10006200 3300005985 Bacteria 11606
119 Ga0075365_10011148 3300006038 Bacteria 5273
120 Ga0075365_10486834 3300006038 Bacteria 872
121 Ga0075368_10008633 3300006042 Bacteria 3638
122 Ga0075368_10017799 3300006042 Bacteria 2663
123 Ga0075363_100097292 3300006048 Bacteria 1626
124 Ga0075363_100179648 3300006048 Bacteria 1203
125 Ga0075364_10315044 3300006051 Bacteria 1065
126 Ga0070715_10884045 3300006163 Bacteria 549
127 Ga0070716_100146213 3300006173 Bacteria 1514
128 Ga0075367_10028617 3300006178 Bacteria 3180
129 Ga0075367_10068588 3300006178 Bacteria 2127
130 Ga0075367_10110609 3300006178 Bacteria 1686
131 Ga0075367_10241795 3300006178 Bacteria 1131
132 Ga0075366_10007602 3300006195 Bacteria 5996
133 Ga0075366_10029910 3300006195 Bacteria 3200
134 Ga0075366_10148532 3300006195 Bacteria 1419
135 Ga0075366_10528985 3300006195 Bacteria 729
136 Ga0097621_100615012 3300006237 Bacteria 994
137 Ga0097621_100934625 3300006237 Bacteria 809
138 Ga0075370_10023731 3300006353 Bacteria 3381
139 Ga0068871_100204731 3300006358 Bacteria 1705
140 Ga0068871_100989848 3300006358 Bacteria 783
141 Ga0075428_100033865 3300006844 Bacteria 5635
142 Ga0075428_100036771 3300006844 Bacteria 5392
143 Ga0075428_100037887 3300006844 Bacteria 5306
144 Ga0075428_100062904 3300006844 Bacteria 4063
145 Ga0075428_100324378 3300006844 Bacteria 1654
146 Ga0075428_101059795 3300006844 Bacteria 857
147 Ga0075428_101350872 3300006844 Bacteria 749
148 Ga0075428_101365290 3300006844 Bacteria 744
149 Ga0075430_100016193 3300006846 Bacteria 6351
150 Ga0075430_100106427 3300006846 Bacteria 2340
151 Ga0075430_100617860 3300006846 Bacteria 894
152 Ga0075431_100033055 3300006847 Bacteria 5330
153 Ga0075431_100040819 3300006847 Bacteria 4783
154 Ga0075431_100402969 3300006847 Bacteria 1369
155 Ga0075431_101259989 3300006847 Bacteria 701
156 Ga0075433_10294589 3300006852 Bacteria 1437
157 Ga0075433_10392930 3300006852 Unclassified 1224
158 Ga0075434_100371473 3300006871 Bacteria 1451
159 Ga0075434_101371829 3300006871 Bacteria 717
160 Ga0075429_100002861 3300006880 Bacteria 14606
161 Ga0075429_100038333 3300006880 Unclassified 4172
162 Ga0075429_100090626 3300006880 Bacteria 2667
163 Ga0075429_100161279 3300006880 Bacteria 1964
164 Ga0075429_100234984 3300006880 Bacteria 1606
165 Ga0075429_100242193 3300006880 Bacteria 1580
166 Ga0075429_100263624 3300006880 Bacteria 1509
167 Ga0068865_100706207 3300006881 Bacteria 862
168 Ga0097620_100036031 3300006931 Bacteria 4965
169 Ga0097620_100423681 3300006931 Bacteria 1427
170 Ga0097620_100763233 3300006931 Bacteria 1056
171 Ga0097620_100936657 3300006931 Bacteria 950
172 Ga0097620_101346897 3300006931 Bacteria 787
173 Ga0075435_101132709 3300007076 Bacteria 684
174 Ga0099794_10149022 3300007265 Bacteria 1187
175 Ga0105240_10637658 3300009093 Bacteria 1169
176 Ga0111539_10000177 3300009094 Bacteria 74071
177 Ga0111539_10106179 3300009094 Bacteria 3294
178 Ga0111539_10109131 3300009094 Bacteria 3247
179 Ga0111539_10554656 3300009094 Bacteria 1338
180 Ga0105245_10021175 3300009098 Bacteria 5701
181 Ga0105245_10802860 3300009098 Bacteria 979
182 Ga0105247_10476601 3300009101 Bacteria 905
183 Ga0114129_10001139 3300009147 Bacteria 35160
184 Ga0114129_10003271 3300009147 Bacteria 22742
185 Ga0114129_10003324 3300009147 Bacteria 22586
186 Ga0114129_10008559 3300009147 Bacteria 14584
187 Ga0114129_10008884 3300009147 Bacteria 14328
188 Ga0114129_10015640 3300009147 Bacteria 10790
189 Ga0114129_10036604 3300009147 Bacteria 6929
190 Ga0114129_10037829 3300009147 Bacteria 6811
191 Ga0114129_10271537 3300009147 Bacteria 2268
192 Ga0114129_10434021 3300009147 Bacteria 1725
193 Ga0114129_10790251 3300009147 Bacteria 1212
194 Ga0114129_11607181 3300009147 Bacteria 796
195 Ga0105243_10112424 3300009148 Bacteria 2282
196 Ga0105243_10291054 3300009148 Bacteria 1475
197 Ga0105243_11114584 3300009148 Bacteria 798
198 Ga0105243_12198081 3300009148 Unclassified 588
199 Ga0105241_10238298 3300009174 Unclassified 1537
200 Ga0105242_10140424 3300009176 Unclassified 2095
201 Ga0105242_10181549 3300009176 Bacteria 1857
202 Ga0105242_10225979 3300009176 Bacteria 1675
203 Ga0105242_10426269 3300009176 Unclassified 1244
204 Ga0105242_11581963 3300009176 Bacteria 689
205 Ga0105248_10050351 3300009177 Bacteria 4671
206 Ga0105248_10255625 3300009177 Bacteria 1972
207 Ga0105238_10176524 3300009551 Bacteria 2113
208 Ga0105238_10361194 3300009551 Bacteria 1442
209 Ga0105249_10100802 3300009553 Bacteria 2715
210 Ga0105249_11006462 3300009553 Bacteria 902
211 Ga0105249_11165308 3300009553 Bacteria 841
212 Ga0105239_10394100 3300010375 Unclassified 1566
213 Ga0105239_10396226 3300010375 Bacteria 1562
214 Ga0105246_11969028 3300011119 Bacteria 563
215 Ga0157369_10292731 3300013105 Bacteria 1695
216 Ga0157369_11673922 3300013105 Unclassified 647
217 Ga0157374_10092538 3300013296 Bacteria 2885
218 Ga0163162_10374423 3300013306 Bacteria 1557
219 Ga0163162_12172568 3300013306 Bacteria 637
220 Ga0163163_10298142 3300014325 Bacteria 1664
221 Ga0163163_10387222 3300014325 Bacteria 1456
222 Ga0163163_10433804 3300014325 Bacteria 1373
223 Ga0157380_10008191 3300014326 Bacteria 7448
224 Ga0157380_10015868 3300014326 Bacteria 5542
225 Ga0157380_10020812 3300014326 Bacteria 4911
226 Ga0157380_10087515 3300014326 Bacteria 2562
227 Ga0157380_10306521 3300014326 Bacteria 1465
228 Ga0157380_11473673 3300014326 Unclassified 733
229 Ga0157379_10055180 3300014968 Bacteria 3550
230 Ga0157379_10419971 3300014968 Bacteria 1231
231 Ga0157379_10478206 3300014968 Bacteria 1152
232 Ga0157376_10135655 3300014969 Bacteria 2202
233 Ga0157376_10176217 3300014969 Bacteria 1951
234 Ga0157376_10357283 3300014969 Bacteria 1400
235 Ga0163161_10196945 3300017792 Bacteria 1551
236 Ga0163161_10698378 3300017792 Bacteria 844
237 Ga0207656_10018159 3300025321 Bacteria 2764
238 Ga0207656_10026548 3300025321 Bacteria 2363
239 Ga0207682_10032730 3300025893 Bacteria 2090
240 Ga0207688_10124887 3300025901 Bacteria 1504
241 Ga0207685_10530896 3300025905 Bacteria 623
242 Ga0207643_10080170 3300025908 Bacteria 1891
243 Ga0207705_10163234 3300025909 Bacteria 1674
244 Ga0207684_10010747 3300025910 Bacteria 8036
245 Ga0207684_10387592 3300025910 Bacteria 1201
246 Ga0207684_10935421 3300025910 Bacteria 727
247 Ga0207654_10251630 3300025911 Unclassified 1184
248 Ga0207707_10125626 3300025912 Bacteria 2243
249 Ga0207707_10709531 3300025912 Bacteria 844
250 Ga0207707_11123156 3300025912 Unclassified 640
251 Ga0207695_10157377 3300025913 Bacteria 2206
252 Ga0207660_10009757 3300025917 Bacteria 6214
253 Ga0207660_10315180 3300025917 Bacteria 1248
254 Ga0207662_10370904 3300025918 Bacteria 965
255 Ga0207649_10023399 3300025920 Bacteria 3577
256 Ga0207649_10422478 3300025920 Bacteria 1001
257 Ga0207649_10499538 3300025920 Bacteria 925
258 Ga0207652_10331925 3300025921 Bacteria 1373
259 Ga0207652_10657734 3300025921 Bacteria 937
260 Ga0207646_10480224 3300025922 Bacteria 1120
261 Ga0207646_10770503 3300025922 Bacteria 858
262 Ga0207681_10069158 3300025923 Bacteria 2455
263 Ga0207681_10406466 3300025923 Bacteria 1101
264 Ga0207650_10020296 3300025925 Bacteria 4684
265 Ga0207650_10093010 3300025925 Bacteria 2307
266 Ga0207650_10796369 3300025925 Bacteria 801
267 Ga0207659_10039618 3300025926 Bacteria 3288
268 Ga0207659_10172639 3300025926 Bacteria 1706
269 Ga0207659_10174251 3300025926 Bacteria 1699
270 Ga0207687_10018627 3300025927 Bacteria 4587
271 Ga0207644_10077849 3300025931 Bacteria 2443
272 Ga0207690_10385151 3300025932 Bacteria 1115
273 Ga0207690_11017435 3300025932 Bacteria 689
274 Ga0207706_10179273 3300025933 Bacteria 1861
275 Ga0207706_10337538 3300025933 Bacteria 1311
276 Ga0207686_10044850 3300025934 Bacteria 2717
277 Ga0207686_10168958 3300025934 Bacteria 1540
278 Ga0207709_10291587 3300025935 Bacteria 1209
279 Ga0207709_10618640 3300025935 Bacteria 859
280 Ga0207709_11149331 3300025935 Bacteria 639
281 Ga0207670_10069931 3300025936 Bacteria 2423
282 Ga0207669_10568532 3300025937 Bacteria 917
283 Ga0207669_10875612 3300025937 Bacteria 749
284 Ga0207704_10035745 3300025938 Bacteria 2851
285 Ga0207691_10014131 3300025940 Bacteria 7616
286 Ga0207711_10296152 3300025941 Bacteria 1492
287 Ga0207661_10037037 3300025944 Bacteria 3812
288 Ga0207661_10098361 3300025944 Bacteria 2452
289 Ga0207679_10008305 3300025945 Bacteria 6612
290 Ga0207679_10014697 3300025945 Bacteria 5153
291 Ga0207679_10108523 3300025945 Bacteria 2185
292 Ga0207679_10145169 3300025945 Bacteria 1924
293 Ga0207667_11174887 3300025949 Unclassified 748
294 Ga0207651_10318460 3300025960 Bacteria 1299
295 Ga0207651_10647863 3300025960 Bacteria 927
296 Ga0207712_10400160 3300025961 Bacteria 1154
297 Ga0207640_10887696 3300025981 Unclassified 778
298 Ga0207658_10913918 3300025986 Bacteria 799
299 Ga0207677_10111399 3300026023 Bacteria 2039
300 Ga0207677_10734760 3300026023 Bacteria 878
301 Ga0207703_10096559 3300026035 Bacteria 2496
302 Ga0207639_10513850 3300026041 Bacteria 1096
303 Ga0207708_10042251 3300026075 Bacteria 3475
304 Ga0207708_10475505 3300026075 Bacteria 1044
305 Ga0207708_11665591 3300026075 Bacteria 560
306 Ga0207702_10653743 3300026078 Bacteria 1034
307 Ga0207641_10410997 3300026088 Bacteria 1301
308 Ga0207648_10658895 3300026089 Bacteria 968
309 Ga0207676_10020001 3300026095 Bacteria 4892
310 Ga0207676_10380239 3300026095 Bacteria 1314
311 Ga0207676_10872823 3300026095 Bacteria 881
312 Ga0207674_10047656 3300026116 Bacteria 4391
313 Ga0207675_100010164 3300026118 Bacteria 8821
314 Ga0207675_100031889 3300026118 Bacteria 4909
315 Ga0207675_100345117 3300026118 Unclassified 1458
316 Ga0207675_100371105 3300026118 Unclassified 1405
317 Ga0207675_100704441 3300026118 Bacteria 1019
318 Ga0207683_10061500 3300026121 Bacteria 3305
319 Ga0207683_10132982 3300026121 Bacteria 2238
320 Ga0207698_10742056 3300026142 Bacteria 980
321 Ga0209971_1016736 3300027682 Bacteria 1738
322 Ga0209813_10100728 3300027866 Bacteria 983
323 Ga0209813_10116095 3300027866 Bacteria 927
324 Ga0209813_10278212 3300027866 Bacteria 644
325 Ga0207428_10155090 3300027907 Bacteria 1742
326 Ga0207428_10229693 3300027907 Bacteria 1389
327 Ga0268266_10012559 3300028379 Bacteria 7319
328 Ga0268266_10228087 3300028379 Bacteria 1715
329 Ga0268265_10399332 3300028380 Bacteria 1270
330 Ga0268265_10673177 3300028380 Bacteria 997
331 Ga0268265_11172037 3300028380 Bacteria 765
332 Ga0268264_10212695 3300028381 Bacteria 1776
333 Ga0268264_11059323 3300028381 Bacteria 819
334 Ga0268264_11960018 3300028381 Unclassified 595
335 Ga0265330_10342337 3300031235 Bacteria 631
336 Ga0307408_101090809 3300031548 Bacteria 740
337 Ga0307408_102071239 3300031548 Bacteria 548
338 Ga0316578_10369026 3300031728 Bacteria 853
339 Ga0307405_10144141 3300031731 Unclassified 1666
340 Ga0307410_10123721 3300031852 Bacteria 1890
341 Ga0307406_10078878 3300031901 Unclassified 2183
342 Ga0307406_11457535 3300031901 Bacteria 601
343 Ga0307407_10712864 3300031903 Bacteria 757
344 Ga0307416_100070117 3300032002 Bacteria 2905
345 Ga0307416_100183542 3300032002 Bacteria 1964
346 Ga0307414_10676952 3300032004 Bacteria 932
347 Ga0307411_10465105 3300032005 Bacteria 1061
348 Ga0307411_11572286 3300032005 Bacteria 606
349 Ga0307415_100765768 3300032126 Bacteria 878
350 Ga0373939_0387524 3300035114 Bacteria 576
351 Ga0373941_0493227 3300035115 Bacteria 520
352 Ga0395900_0745732 3300037418 Bacteria 910
353 Ga0395898_0332494 3300037466 Bacteria 1449
354 Ga0316581_0166847 3300037588 Bacteria 679
355 Ga0395901_1021095 3300038443 Bacteria 802
356 Ga0439464_0012493 3300042439 Bacteria 2263
357 Ga0439464_0019872 3300042439 Bacteria 1836
358 Ga0439460_0280273 3300042461 Bacteria 580
359 Ga0451577_0219060 3300042876 Bacteria 1720
360 Ga0451577_0361983 3300042876 Bacteria 1316
361 Ga0439440_0045547 3300042993 Bacteria 1082
362 Ga0453683_0225909 3300044673 Bacteria 1191
363 Ga0453684_0012039 3300044712 Bacteria 14376
364 Ga0453684_0034288 3300044712 Bacteria 7050
365 Ga0453684_0203154 3300044712 Bacteria 2308
366 Ga0453684_0217420 3300044712 Bacteria 2216
367 Ga0453684_0860284 3300044712 Bacteria 974
368 Ga0453684_1371069 3300044712 Bacteria 735
369 Ga0451576_0915324 3300045051 Bacteria 920
370 Ga0451576_1356932 3300045051 Unclassified 740
371 Ga0466967_0726346 3300045976 Bacteria 984
372 Ga0495603_0119690 3300046455 Bacteria 1535
373 Ga0495653_0391914 3300046463 Bacteria 885
374 Ga0495580_0413019 3300046472 Bacteria 909
375 Ga0495639_0288531 3300046475 Bacteria 817
376 Ga0495632_0374365 3300046519 Unclassified 624
377 Ga0495633_0211220 3300046558 Bacteria 890
378 Ga0495625_0426826 3300046660 Bacteria 823
379 Ga0495635_0121433 3300046663 Bacteria 1782
380 Ga0495659_0081588 3300046664 Bacteria 1228
381 Ga0495588_0302986 3300046674 Unclassified 841
382 Ga0495658_0332218 3300046683 Bacteria 964
383 Ga0495670_0478351 3300046691 Bacteria 676
384 Ga0495636_0119074 3300047318 Bacteria 1167
385 Ga0495676_0227321 3300047321 Bacteria 1283
386 Ga0495680_0453782 3300047322 Bacteria 877
387 Ga0496100_0674600 3300048903 Bacteria 806
388 Ga0496102_1177752 3300048905 Bacteria 686
389 Ga0496104_0482922 3300048907 Bacteria 1150
390 Ga0496114_0028431 3300048917 Bacteria 4588
391 Ga0501299_201449 3300049522 Bacteria 529
392 Ga0501036_0494399 3300049572 Bacteria 1018
393 Ga0501039_0834105 3300049575 Bacteria 719
394 Ga0501040_0051861 3300049576 Bacteria 2807
395 Ga0501075_0012932 3300049591 Bacteria 5946
396 Ga0501075_0055051 3300049591 Bacteria 2993
397 Ga0501076_0265518 3300049592 Bacteria 1405
398 Ga0501076_0613466 3300049592 Bacteria 898
399 Ga0501077_0438062 3300049593 Bacteria 837
400 Ga0501207_077688 3300049654 Bacteria 634
401 Ga0501079_0267815 3300049741 Bacteria 1335
402 Ga0501080_0366322 3300049742 Bacteria 1300
403 Ga0501081_0061485 3300049743 Bacteria 2604
404 Ga0501081_0320520 3300049743 Bacteria 1139
405 Ga0501045_0105046 3300049824 Bacteria 2093
406 Ga0501045_0617564 3300049824 Bacteria 802
407 nmdc:mga03n38_34202_c1 3300050490 Bacteria 2168
408 nmdc:mga03n38_86068_c1 3300050490 Bacteria 1487
409 nmdc:mga00v17_12226_c1 3300050491 Bacteria 4735
410 nmdc:mga00v17_87591_c1 3300050491 Bacteria 1952
411 nmdc:mga0yw44_39156_c1 3300050492 Bacteria 2809
412 nmdc:mga0yw44_987071_c1 3300050492 Bacteria 570
413 nmdc:mga0k408_11801_c1 3300050493 Bacteria 4767
414 nmdc:mga0k408_30325_c1 3300050493 Bacteria 3083
415 nmdc:mga0k408_502773_c1 3300050493 Bacteria 718
416 nmdc:mga06z11_136947_c1 3300050494 Bacteria 1380
417 nmdc:mga06z11_220602_c1 3300050494 Bacteria 1108
418 nmdc:mga06z11_54104_c1 3300050494 Bacteria 2068
419 nmdc:mga06z11_54714_c1 3300050494 Bacteria 2058
420 nmdc:mga06z11_703065_c1 3300050494 Bacteria 616
421 nmdc:mga04h51_136418_c1 3300050495 Bacteria 927
422 nmdc:mga04h51_312507_c1 3300050495 Bacteria 643
423 nmdc:mga07m45_64355_c1 3300050496 Bacteria 2081
424 nmdc:mga07m45_86469_c1 3300050496 Bacteria 1794
425 nmdc:mga05p37_100879_c1 3300050507 Bacteria 3555
426 nmdc:mga05p37_103751_c1 3300050507 Bacteria 3499
427 nmdc:mga05p37_11087_c1 3300050507 Bacteria 9192
428 nmdc:mga05p37_12521_c1 3300050507 Bacteria 10127
429 nmdc:mga05p37_1381264_c1 3300050507 Bacteria 711
430 nmdc:mga05p37_15355_c1 3300050507 Bacteria 9201
431 nmdc:mga05p37_20681_c1 3300050507 Bacteria 7964
432 nmdc:mga05p37_4332_c1 3300050507 Bacteria 16584
433 nmdc:mga05p37_603499_c1 3300050507 Bacteria 1238
434 nmdc:mga05p37_77873_c1 3300050507 Bacteria 4082
435 nmdc:mga05p37_8520_c1 3300050507 Bacteria 12119
436 nmdc:mga09592_523594_c1 3300050508 Bacteria 1020
437 nmdc:mga09592_642538_c1 3300050508 Bacteria 906
438 nmdc:mga09592_68564_c1 3300050508 Bacteria 3008
439 nmdc:mga09592_9652_c1 3300050508 Bacteria 7841
440 nmdc:mga0qj67_129501_c1 3300050509 Unclassified 2043
441 nmdc:mga0qj67_18729_c1 3300050509 Bacteria 5279
442 nmdc:mga0qj67_230671_c1 3300050509 Bacteria 1502
443 nmdc:mga0qj67_63197_c1 3300050509 Bacteria 2944
444 nmdc:mga06r32_110031_c1 3300050510 Bacteria 2710
445 nmdc:mga06r32_111509_c1 3300050510 Bacteria 2692
446 nmdc:mga06r32_516340_c1 3300050510 Bacteria 1170
447 nmdc:mga06r32_546682_c1 3300050510 Bacteria 1132
448 nmdc:mga06r32_565625_c1 3300050510 Bacteria 1110
449 nmdc:mga06r32_980221_c1 3300050510 Bacteria 799
450 nmdc:mga08y16_30128_c1 3300050511 Bacteria 5712
451 nmdc:mga08y16_83841_c1 3300050511 Bacteria 3322
452 nmdc:mga08y16_85785_c1 3300050511 Bacteria 3282
453 nmdc:mga0n895_370038_c1 3300050512 Bacteria 1451
454 nmdc:mga0a205_194159_c1 3300050515 Bacteria 1921
455 nmdc:mga0a205_336593_c1 3300050515 Bacteria 1378
456 nmdc:mga0a205_46859_c1 3300050515 Bacteria 1956
457 nmdc:mga0a205_478738_c1 3300050515 Bacteria 1103
458 nmdc:mga0a205_814965_c1 3300050515 Bacteria 781
459 nmdc:mga0sz30_249330_c1 3300050516 Bacteria 790
460 Ga0495601_0305678 3300053077 Bacteria 1036
461 Ga0495619_0191193 3300053085 Bacteria 1417
462 Ga0500555_000036 3300053103 Bacteria 73628
463 Ga0500556_0012039 3300053104 Bacteria 2574
464 Ga0500568_0029083 3300053139 Bacteria 2296
465 Ga0500616_0000135 3300053153 Bacteria 126795
466 Ga0500645_000392 3300053730 Bacteria 30595
467 Ga0501084_0068768 3300054114 Bacteria 2965
468 Ga0501082_0102473 3300060353 Bacteria 2476
469 Ga0501082_0201809 3300060353 Bacteria 1730
470 Ga0530510_0009401 3300061734 Bacteria 6855
471 nmdc:mga0n895_582925_c1
472 SwRhRL3b_contig_862913
473 SwRhRL2b_contig_3445787
474 Ga0065704_10001073
475 Ga0065704_10642682
476 Ga0065712_10537915
477 Ga0065712_10561242
478 Ga0065707_10000452
479 Ga0065707_10023764
480 Ga0065707_10098635
481 Ga0070658_10330703
482 Ga0070658_11438948
483 Ga0070683_100024574
484 Ga0070683_100025306
485 Ga0070683_100076899
486 Ga0070683_100081219
487 Ga0070683_102129108
488 Ga0070670_100036578
489 Ga0070670_101544067
490 Ga0070677_10497314
491 Ga0068869_101401496
492 Ga0070680_100067435
493 Ga0070680_100314141
494 Ga0068868_100406633
495 Ga0070689_100049716
496 Ga0070689_100238758
497 Ga0070689_100364921
498 Ga0070661_100074706
499 Ga0070661_100215486
500 Ga0070669_100062510
501 Ga0070669_100063021
502 Ga0070669_100932027
503 Ga0070675_100019110
504 Ga0070675_100092340
505 Ga0070675_100309232
506 Ga0070675_100387595
507 Ga0070675_100655786
508 Ga0070675_100918433
509 Ga0070674_100649408
510 Ga0070674_101015146
511 Ga0070673_100152563
512 Ga0070673_101185955
513 Ga0070688_100184614
514 Ga0070688_100936981
515 Ga0070659_100012596
516 Ga0070701_10316470
517 Ga0070705_100194351
518 Ga0070700_100091286
519 Ga0070700_100439447
520 Ga0070694_100268677
521 Ga0070694_100336111
522 Ga0070708_100086079
523 Ga0070663_100143885
524 Ga0070678_100152193
525 Ga0070662_100602517
526 Ga0070681_10093349
527 Ga0070681_11396163
528 Ga0068867_102409317
529 Ga0070685_10312913
530 Ga0070685_10540904
531 Ga0070706_100017949
532 Ga0070706_100158108
533 Ga0070707_100979746
534 Ga0070707_101510105
535 Ga0070698_100015376
536 Ga0070698_100114685
537 Ga0070698_101179442
538 Ga0070699_100011038
539 Ga0070699_100140060
540 Ga0070699_101385833
541 Ga0070679_100020989
542 Ga0070679_100190862
543 Ga0070684_100019666
544 Ga0070684_100061917
545 Ga0070684_100701083
546 Ga0070697_101376862
547 Ga0068853_100555408
548 Ga0070672_100022820
549 Ga0070696_100048603
550 Ga0070665_100118868
551 Ga0070704_100107021
552 Ga0070704_100523902
553 Ga0068855_100289799
554 Ga0070664_100092582
555 Ga0070664_100236856
556 Ga0070664_100313459
557 Ga0070664_101078635
558 Ga0068857_100001626
559 Ga0068854_100438795
560 Ga0068856_100244885
561 Ga0068852_101659078
562 Ga0068859_100036031
563 Ga0068859_100423696
564 Ga0068859_100763299
565 Ga0068859_100936502
566 Ga0068859_101346353
567 Ga0068864_100268554
568 Ga0068864_100629216
569 Ga0068861_100027032
570 Ga0068861_100044470
571 Ga0068861_100298113
572 Ga0068861_100404569
573 Ga0068861_101137207
574 Ga0068851_10028199
575 Ga0068851_10043228
576 Ga0068851_10141390
577 Ga0068870_10035567
578 Ga0068858_100007211
579 Ga0068858_100835175
580 Ga0068858_100867514
581 Ga0068860_100235772
582 Ga0068860_100305003
583 Ga0068860_100487945
584 Ga0068862_100212799
585 Ga0068862_100514423
586 Ga0068862_100642389
587 Ga0068862_102696746
588 Ga0081539_10006200
589 Ga0075365_10011148
590 Ga0075365_10486834
591 Ga0075368_10008633
592 Ga0075368_10017799
593 Ga0075363_100097292
594 Ga0075363_100179648
595 Ga0075364_10315044
596 Ga0070715_10884045
597 Ga0070716_100146213
598 Ga0075367_10028617
599 Ga0075367_10068588
600 Ga0075367_10110609
601 Ga0075367_10241795
602 Ga0075366_10007602
603 Ga0075366_10029910
604 Ga0075366_10148532
605 Ga0075366_10528985
606 Ga0097621_100615012
607 Ga0097621_100934625
608 Ga0075370_10023731
609 Ga0068871_100204731
610 Ga0068871_100989848
611 Ga0075428_100033865
612 Ga0075428_100036771
613 Ga0075428_100037887
614 Ga0075428_100062904
615 Ga0075428_100324378
616 Ga0075428_101059795
617 Ga0075428_101350872
618 Ga0075428_101365290
619 Ga0075430_100016193
620 Ga0075430_100106427
621 Ga0075430_100617860
622 Ga0075431_100033055
623 Ga0075431_100040819
624 Ga0075431_100402969
625 Ga0075431_101259989
626 Ga0075433_10294589
627 Ga0075433_10392930
628 Ga0075434_100371473
629 Ga0075434_101371829
630 Ga0075429_100002861
631 Ga0075429_100038333
632 Ga0075429_100090626
633 Ga0075429_100161279
634 Ga0075429_100234984
635 Ga0075429_100242193
636 Ga0075429_100263624
637 Ga0068865_100706207
638 Ga0097620_100036031
639 Ga0097620_100423681
640 Ga0097620_100763233
641 Ga0097620_100936657
642 Ga0097620_101346897
643 Ga0075435_101132709
644 Ga0099794_10149022
645 Ga0105240_10637658
646 Ga0111539_10000177
647 Ga0111539_10106179
648 Ga0111539_10109131
649 Ga0111539_10554656
650 Ga0105245_10021175
651 Ga0105245_10802860
652 Ga0105247_10476601
653 Ga0114129_10001139
654 Ga0114129_10003271
655 Ga0114129_10003324
656 Ga0114129_10008559
657 Ga0114129_10008884
658 Ga0114129_10015640
659 Ga0114129_10036604
660 Ga0114129_10037829
661 Ga0114129_10271537
662 Ga0114129_10434021
663 Ga0114129_10790251
664 Ga0114129_11607181
665 Ga0105243_10112424
666 Ga0105243_10291054
667 Ga0105243_11114584
668 Ga0105243_12198081
669 Ga0105241_10238298
670 Ga0105242_10140424
671 Ga0105242_10181549
672 Ga0105242_10225979
673 Ga0105242_10426269
674 Ga0105242_11581963
675 Ga0105248_10050351
676 Ga0105248_10255625
677 Ga0105238_10176524
678 Ga0105238_10361194
679 Ga0105249_10100802
680 Ga0105249_11006462
681 Ga0105249_11165308
682 Ga0105239_10394100
683 Ga0105239_10396226
684 Ga0105246_11969028
685 Ga0157369_10292731
686 Ga0157369_11673922
687 Ga0157374_10092538
688 Ga0163162_10374423
689 Ga0163162_12172568
690 Ga0163163_10298142
691 Ga0163163_10387222
692 Ga0163163_10433804
693 Ga0157380_10008191
694 Ga0157380_10015868
695 Ga0157380_10020812
696 Ga0157380_10087515
697 Ga0157380_10306521
698 Ga0157380_11473673
699 Ga0157379_10055180
700 Ga0157379_10419971
701 Ga0157379_10478206
702 Ga0157376_10135655
703 Ga0157376_10176217
704 Ga0157376_10357283
705 Ga0163161_10196945
706 Ga0163161_10698378
707 Ga0207656_10018159
708 Ga0207656_10026548
709 Ga0207682_10032730
710 Ga0207688_10124887
711 Ga0207685_10530896
712 Ga0207643_10080170
713 Ga0207705_10163234
714 Ga0207684_10010747
715 Ga0207684_10387592
716 Ga0207684_10935421
717 Ga0207654_10251630
718 Ga0207707_10125626
719 Ga0207707_10709531
720 Ga0207707_11123156
721 Ga0207695_10157377
722 Ga0207660_10009757
723 Ga0207660_10315180
724 Ga0207662_10370904
725 Ga0207649_10023399
726 Ga0207649_10422478
727 Ga0207649_10499538
728 Ga0207652_10331925
729 Ga0207652_10657734
730 Ga0207646_10480224
731 Ga0207646_10770503
732 Ga0207681_10069158
733 Ga0207681_10406466
734 Ga0207650_10020296
735 Ga0207650_10093010
736 Ga0207650_10796369
737 Ga0207659_10039618
738 Ga0207659_10172639
739 Ga0207659_10174251
740 Ga0207687_10018627
741 Ga0207644_10077849
742 Ga0207690_10385151
743 Ga0207690_11017435
744 Ga0207706_10179273
745 Ga0207706_10337538
746 Ga0207686_10044850
747 Ga0207686_10168958
748 Ga0207709_10291587
749 Ga0207709_10618640
750 Ga0207709_11149331
751 Ga0207670_10069931
752 Ga0207669_10568532
753 Ga0207669_10875612
754 Ga0207704_10035745
755 Ga0207691_10014131
756 Ga0207711_10296152
757 Ga0207661_10037037
758 Ga0207661_10098361
759 Ga0207679_10008305
760 Ga0207679_10014697
761 Ga0207679_10108523
762 Ga0207679_10145169
763 Ga0207667_11174887
764 Ga0207651_10318460
765 Ga0207651_10647863
766 Ga0207712_10400160
767 Ga0207640_10887696
768 Ga0207658_10913918
769 Ga0207677_10111399
770 Ga0207677_10734760
771 Ga0207703_10096559
772 Ga0207639_10513850
773 Ga0207708_10042251
774 Ga0207708_10475505
775 Ga0207708_11665591
776 Ga0207702_10653743
777 Ga0207641_10410997
778 Ga0207648_10658895
779 Ga0207676_10020001
780 Ga0207676_10380239
781 Ga0207676_10872823
782 Ga0207674_10047656
783 Ga0207675_100010164
784 Ga0207675_100031889
785 Ga0207675_100345117
786 Ga0207675_100371105
787 Ga0207675_100704441
788 Ga0207683_10061500
789 Ga0207683_10132982
790 Ga0207698_10742056
791 Ga0209971_1016736
792 Ga0209813_10100728
793 Ga0209813_10116095
794 Ga0209813_10278212
795 Ga0207428_10155090
796 Ga0207428_10229693
797 Ga0268266_10012559
798 Ga0268266_10228087
799 Ga0268265_10399332
800 Ga0268265_10673177
801 Ga0268265_11172037
802 Ga0268264_10212695
803 Ga0268264_11059323
804 Ga0268264_11960018
805 Ga0265330_10342337
806 Ga0307408_101090809
807 Ga0307408_102071239
808 Ga0316578_10369026
809 Ga0307405_10144141
810 Ga0307410_10123721
811 Ga0307406_10078878
812 Ga0307406_11457535
813 Ga0307407_10712864
814 Ga0307416_100070117
815 Ga0307416_100183542
816 Ga0307414_10676952
817 Ga0307411_10465105
818 Ga0307411_11572286
819 Ga0307415_100765768
820 Ga0373939_0387524
821 Ga0373941_0493227
822 Ga0395900_0745732
823 Ga0395898_0332494
824 Ga0316581_0166847
825 Ga0395901_1021095
826 Ga0439464_0012493
827 Ga0439464_0019872
828 Ga0439460_0280273
829 Ga0451577_0219060
830 Ga0451577_0361983
831 Ga0439440_0045547
832 Ga0453683_0225909
833 Ga0453684_0012039
834 Ga0453684_0034288
835 Ga0453684_0203154
836 Ga0453684_0217420
837 Ga0453684_0860284
838 Ga0453684_1371069
839 Ga0451576_0915324
840 Ga0451576_1356932
841 Ga0466967_0726346
842 Ga0495603_0119690
843 Ga0495653_0391914
844 Ga0495580_0413019
845 Ga0495639_0288531
846 Ga0495632_0374365
847 Ga0495633_0211220
848 Ga0495625_0426826
849 Ga0495635_0121433
850 Ga0495659_0081588
851 Ga0495588_0302986
852 Ga0495658_0332218
853 Ga0495670_0478351
854 Ga0495636_0119074
855 Ga0495676_0227321
856 Ga0495680_0453782
857 Ga0496100_0674600
858 Ga0496102_1177752
859 Ga0496104_0482922
860 Ga0496114_0028431
861 Ga0501299_201449
862 Ga0501036_0494399
863 Ga0501039_0834105
864 Ga0501040_0051861
865 Ga0501075_0012932
866 Ga0501075_0055051
867 Ga0501076_0265518
868 Ga0501076_0613466
869 Ga0501077_0438062
870 Ga0501207_077688
871 Ga0501079_0267815
872 Ga0501080_0366322
873 Ga0501081_0061485
874 Ga0501081_0320520
875 Ga0501045_0105046
876 Ga0501045_0617564
877 nmdc:mga03n38_34202_c1
878 nmdc:mga03n38_86068_c1
879 nmdc:mga00v17_12226_c1
880 nmdc:mga00v17_87591_c1
881 nmdc:mga0yw44_39156_c1
882 nmdc:mga0yw44_987071_c1
883 nmdc:mga0k408_11801_c1
884 nmdc:mga0k408_30325_c1
885 nmdc:mga0k408_502773_c1
886 nmdc:mga06z11_136947_c1
887 nmdc:mga06z11_220602_c1
888 nmdc:mga06z11_54104_c1
889 nmdc:mga06z11_54714_c1
890 nmdc:mga06z11_703065_c1
891 nmdc:mga04h51_136418_c1
892 nmdc:mga04h51_312507_c1
893 nmdc:mga07m45_64355_c1
894 nmdc:mga07m45_86469_c1
895 nmdc:mga05p37_100879_c1
896 nmdc:mga05p37_103751_c1
897 nmdc:mga05p37_11087_c1
898 nmdc:mga05p37_12521_c1
899 nmdc:mga05p37_1381264_c1
900 nmdc:mga05p37_15355_c1
901 nmdc:mga05p37_20681_c1
902 nmdc:mga05p37_4332_c1
903 nmdc:mga05p37_603499_c1
904 nmdc:mga05p37_77873_c1
905 nmdc:mga05p37_8520_c1
906 nmdc:mga09592_523594_c1
907 nmdc:mga09592_642538_c1
908 nmdc:mga09592_68564_c1
909 nmdc:mga09592_9652_c1
910 nmdc:mga0qj67_129501_c1
911 nmdc:mga0qj67_18729_c1
912 nmdc:mga0qj67_230671_c1
913 nmdc:mga0qj67_63197_c1
914 nmdc:mga06r32_110031_c1
915 nmdc:mga06r32_111509_c1
916 nmdc:mga06r32_516340_c1
917 nmdc:mga06r32_546682_c1
918 nmdc:mga06r32_565625_c1
919 nmdc:mga06r32_980221_c1
920 nmdc:mga08y16_30128_c1
921 nmdc:mga08y16_83841_c1
922 nmdc:mga08y16_85785_c1
923 nmdc:mga0n895_370038_c1
924 nmdc:mga0a205_194159_c1
925 nmdc:mga0a205_336593_c1
926 nmdc:mga0a205_46859_c1
927 nmdc:mga0a205_478738_c1
928 nmdc:mga0a205_814965_c1
929 nmdc:mga0sz30_249330_c1
930 Ga0495601_0305678
931 Ga0495619_0191193
932 Ga0500555_000036
933 Ga0500556_0012039
934 Ga0500568_0029083
935 Ga0500616_0000135
936 Ga0500645_000392
937 Ga0501084_0068768
938 Ga0501082_0102473
939 Ga0501082_0201809
940 Ga0530510_0009401

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

35

142

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9347 2 150
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9286 2 150
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9281 2 150
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9266 2 150
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9221 2 150
ID Description Score Start End Superfamily
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9291 2 150 3.10.180.10
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9229 2 150 3.10.180.10
3omsA01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7909 7 62 3.30.720.100
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7883 8 108 3.10.180.10
af_Q4DVY1_99_326_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.7819 28 57 2.60.120.200
ID Description Score Start End GO Terms
AF-A0A537CIB8-F1-model_v4 VOC family protein 0.9932 76 150
AF-S4MYN5-F1-model_v4 PhnB-like domain-containing protein 0.9906 72 152
AF-A0A2V6CT88-F1-model_v4 PhnB-like domain-containing protein 0.9898 90 152
AF-A0A7Y2AEA9-F1-model_v4 VOC family protein 0.9838 79 150
AF-A0A2V7U7S1-F1-model_v4 PhnB-like domain-containing protein 0.9821 81 152

Map