F450416

General Info

Members Datasets Scaffolds Average Seq Length
470 289 940 172

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_11117966|Ga0163161_111179662
Length 164
Sequence MTDPRVGIVMGSDSDWPVMKAAAEALAEFDIAFEADVVSAHRMPEEMLAYGRSAADRGLSVIIAGAGGAAHLPGMLAAVTPLPVIGVPVPLDNLSIVQMPAGVPVATVAIGGARNAGLLAVRILAATDPALQERMRTFQAELKQSAQEKGATVRNDAAPRRVGF

Samples

Sample ID Description Type Environment
1 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
114 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
115 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
116 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
117 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
118 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
119 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
120 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
121 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
122 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
125 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
126 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
131 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
132 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
133 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
147 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
148 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
149 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
150 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
151 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
152 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
153 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
154 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
155 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
162 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
163 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
173 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
195 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
257 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
261 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
271 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
272 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
273 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
274 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
275 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
276 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
277 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
278 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
279 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
284 2643221576 Nocardioides sp. Root614 Isolate Unclassified
285 2643221590 Nocardioides sp. Root682 Isolate Unclassified
286 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
287 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
288 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
289 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.81
Metatranscriptomes 1.91
Isolates 1.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.47
Nodule 0
Rhizoplane 6.6
Rhizosphere 84.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163161_11117966 3300017792 Bacteria 678
2 Ga0070683_100995619 3300005329 Bacteria 805
3 Ga0070670_100686394 3300005331 Bacteria 920
4 Ga0070680_100000019 3300005336 Bacteria 83282
5 Ga0070659_100358760 3300005366 Bacteria 1224
6 Ga0070709_10000118 3300005434 Bacteria 53312
7 Ga0070709_10018286 3300005434 Bacteria 4034
8 Ga0070709_10087902 3300005434 Bacteria 2043
9 Ga0070714_100003752 3300005435 Bacteria 11392
10 Ga0070714_100015902 3300005435 Bacteria 6064
11 Ga0070713_100000299 3300005436 Bacteria 32808
12 Ga0070710_10000459 3300005437 Bacteria 19099
13 Ga0070705_100015927 3300005440 Bacteria 3896
14 Ga0070705_100742447 3300005440 Bacteria 775
15 Ga0070708_100108986 3300005445 Bacteria 2544
16 Ga0070708_100503536 3300005445 Bacteria 1142
17 Ga0070663_100299106 3300005455 Bacteria 1287
18 Ga0070678_100043107 3300005456 Bacteria 3212
19 Ga0070681_10000017 3300005458 Bacteria 125537
20 Ga0070681_10257593 3300005458 Bacteria 1657
21 Ga0068867_100365367 3300005459 Bacteria 1208
22 Ga0070706_100048968 3300005467 Bacteria 3899
23 Ga0070706_100259741 3300005467 Bacteria 1621
24 Ga0070706_100535583 3300005467 Bacteria 1089
25 Ga0070707_100000873 3300005468 Bacteria 29922
26 Ga0070707_100029930 3300005468 Bacteria 5182
27 Ga0070707_100043100 3300005468 Bacteria 4320
28 Ga0070707_100088076 3300005468 Bacteria 3003
29 Ga0070707_100153969 3300005468 Bacteria 2239
30 Ga0070707_100281693 3300005468 Bacteria 1615
31 Ga0070707_101056229 3300005468 Bacteria 778
32 Ga0070698_100000623 3300005471 Bacteria 38138
33 Ga0070698_100002990 3300005471 Bacteria 18616
34 Ga0070698_100008001 3300005471 Bacteria 11432
35 Ga0070698_100095313 3300005471 Bacteria 2953
36 Ga0070698_100207190 3300005471 Bacteria 1896
37 Ga0070679_100000009 3300005530 Bacteria 191579
38 Ga0070679_100036809 3300005530 Bacteria 4857
39 Ga0070679_100712823 3300005530 Bacteria 946
40 Ga0070684_100895436 3300005535 Bacteria 831
41 Ga0070697_100079144 3300005536 Bacteria 2705
42 Ga0070697_100165362 3300005536 Bacteria 1871
43 Ga0070696_100301247 3300005546 Bacteria 1228
44 Ga0070693_100065899 3300005547 Bacteria 2118
45 Ga0070704_100130334 3300005549 Bacteria 1948
46 Ga0070704_100968265 3300005549 Bacteria 768
47 Ga0068855_100607249 3300005563 Bacteria 1179
48 Ga0068856_100295700 3300005614 Bacteria 1636
49 Ga0070702_100035083 3300005615 Bacteria 2769
50 Ga0068852_100198373 3300005616 Bacteria 1898
51 Ga0068864_100398291 3300005618 Bacteria 1308
52 Ga0068861_100568645 3300005719 Bacteria 1036
53 Ga0068863_100076585 3300005841 Bacteria 3164
54 Ga0081455_10333581 3300005937 Bacteria 1076
55 Ga0081540_1000693 3300005983 Bacteria 31415
56 Ga0081539_10090403 3300005985 Bacteria 1583
57 Ga0070717_10003735 3300006028 Bacteria 10936
58 Ga0070717_10038333 3300006028 Bacteria 3896
59 Ga0070717_10063463 3300006028 Bacteria 3066
60 Ga0070717_10224897 3300006028 Bacteria 1650
61 Ga0070717_10667576 3300006028 Bacteria 944
62 Ga0070717_10834411 3300006028 Bacteria 839
63 Ga0075365_10024793 3300006038 Bacteria 3790
64 Ga0075365_10333661 3300006038 Bacteria 1068
65 Ga0075363_100064544 3300006048 Bacteria 1978
66 Ga0075364_10101435 3300006051 Bacteria 1916
67 Ga0070715_10008092 3300006163 Bacteria 3651
68 Ga0070715_10010409 3300006163 Bacteria 3314
69 Ga0070716_100000716 3300006173 Bacteria 14161
70 Ga0070712_100001248 3300006175 Bacteria 15370
71 Ga0070712_100102066 3300006175 Bacteria 2124
72 Ga0070712_100345705 3300006175 Bacteria 1216
73 Ga0075367_10092667 3300006178 Bacteria 1839
74 Ga0075370_10027439 3300006353 Bacteria 3159
75 Ga0075370_10351227 3300006353 Bacteria 881
76 Ga0068871_100307923 3300006358 Bacteria 1392
77 Ga0075431_100009233 3300006847 Bacteria 9897
78 Ga0075433_10017953 3300006852 Bacteria 5870
79 Ga0075433_10156724 3300006852 Bacteria 2026
80 Ga0075434_100003369 3300006871 Bacteria 14307
81 Ga0068865_100184114 3300006881 Bacteria 1610
82 Ga0075436_100032656 3300006914 Bacteria 3587
83 Ga0075436_100046528 3300006914 Bacteria 2992
84 Ga0075435_100003619 3300007076 Bacteria 10517
85 Ga0075435_100076455 3300007076 Bacteria 2743
86 Ga0111539_10028450 3300009094 Bacteria 6818
87 Ga0105245_10316400 3300009098 Bacteria 1536
88 Ga0105245_11641087 3300009098 Bacteria 695
89 Ga0114129_10013919 3300009147 Bacteria 11460
90 Ga0114129_11068392 3300009147 Bacteria 1012
91 Ga0114129_11345961 3300009147 Bacteria 883
92 Ga0105243_10027366 3300009148 Bacteria 4368
93 Ga0105242_10009892 3300009176 Bacteria 7304
94 Ga0105248_10460975 3300009177 Bacteria 1433
95 Ga0105248_12471763 3300009177 Bacteria 592
96 Ga0105238_10073910 3300009551 Bacteria 3402
97 Ga0105249_10013932 3300009553 Bacteria 7108
98 Ga0105028_130094 3300009993 Bacteria 604
99 Ga0157378_10008104 3300013297 Bacteria 9168
100 Ga0163162_10303271 3300013306 Bacteria 1729
101 Ga0157375_10298267 3300013308 Bacteria 1775
102 Ga0157375_10551530 3300013308 Bacteria 1314
103 Ga0157376_10604690 3300014969 Bacteria 1092
104 Ga0163161_10841770 3300017792 Bacteria 774
105 Ga0206349_1713777 3300020075 Bacteria 1142
106 Ga0206350_10030112 3300020080 Bacteria 1035
107 Ga0213873_10000202 3300021358 Bacteria 10875
108 Ga0213876_10002748 3300021384 Bacteria 10248
109 Ga0213876_10107141 3300021384 Bacteria 1483
110 Ga0213875_10000308 3300021388 Bacteria 46749
111 Ga0213875_10000488 3300021388 Bacteria 33637
112 Ga0207692_10004361 3300025898 Bacteria 5602
113 Ga0207692_10142291 3300025898 Bacteria 1365
114 Ga0207685_10092524 3300025905 Bacteria 1276
115 Ga0207699_10000106 3300025906 Bacteria 58842
116 Ga0207699_10004659 3300025906 Bacteria 6558
117 Ga0207699_10057697 3300025906 Bacteria 2319
118 Ga0207699_10076506 3300025906 Bacteria 2062
119 Ga0207705_10729267 3300025909 Bacteria 770
120 Ga0207684_10002007 3300025910 Bacteria 20959
121 Ga0207684_10012638 3300025910 Bacteria 7332
122 Ga0207684_10190059 3300025910 Bacteria 1771
123 Ga0207707_10000257 3300025912 Bacteria 57640
124 Ga0207693_10006289 3300025915 Bacteria 9851
125 Ga0207660_10002011 3300025917 Bacteria 13518
126 Ga0207652_10000070 3300025921 Bacteria 109705
127 Ga0207646_10000434 3300025922 Bacteria 55879
128 Ga0207646_10028328 3300025922 Bacteria 5100
129 Ga0207646_10103124 3300025922 Bacteria 2558
130 Ga0207646_10136567 3300025922 Bacteria 2208
131 Ga0207646_10230435 3300025922 Bacteria 1673
132 Ga0207700_10000053 3300025928 Bacteria 75986
133 Ga0207664_10000371 3300025929 Bacteria 32846
134 Ga0207664_10012239 3300025929 Bacteria 6131
135 Ga0207664_10434339 3300025929 Bacteria 1171
136 Ga0207690_10523080 3300025932 Bacteria 962
137 Ga0207709_10019073 3300025935 Bacteria 3849
138 Ga0207670_11170826 3300025936 Bacteria 650
139 Ga0207704_10680710 3300025938 Bacteria 850
140 Ga0207665_10000166 3300025939 Bacteria 44650
141 Ga0207665_11057341 3300025939 Bacteria 646
142 Ga0207711_10906728 3300025941 Bacteria 819
143 Ga0207661_10298909 3300025944 Bacteria 1443
144 Ga0207661_10714982 3300025944 Bacteria 922
145 Ga0207640_10343202 3300025981 Bacteria 1197
146 Ga0207708_10000029 3300026075 Bacteria 161861
147 Ga0207708_10526004 3300026075 Bacteria 994
148 Ga0207708_10596050 3300026075 Bacteria 936
149 Ga0207702_10632919 3300026078 Bacteria 1051
150 Ga0207641_10041060 3300026088 Bacteria 3877
151 Ga0207641_10384339 3300026088 Bacteria 1345
152 Ga0207648_10534753 3300026089 Bacteria 1075
153 Ga0207676_10799873 3300026095 Bacteria 920
154 Ga0207674_10085459 3300026116 Bacteria 3150
155 Ga0207675_100528852 3300026118 Bacteria 1176
156 Ga0207675_101251304 3300026118 Bacteria 762
157 Ga0207683_10064697 3300026121 Bacteria 3223
158 Ga0207698_10330293 3300026142 Bacteria 1432
159 Ga0207698_10890041 3300026142 Bacteria 897
160 Ga0209974_10027615 3300027876 Bacteria 1878
161 Ga0207428_10158937 3300027907 Bacteria 1717
162 Ga0265318_10193199 3300028577 Bacteria 745
163 Ga0265338_10023014 3300028800 Bacteria 6422
164 Ga0265338_10376593 3300028800 Bacteria 1016
165 Ga0265325_10011217 3300031241 Bacteria 5154
166 Ga0265325_10028490 3300031241 Bacteria 3010
167 Ga0265340_10006460 3300031247 Bacteria 6451
168 Ga0265340_10060569 3300031247 Bacteria 1812
169 Ga0265339_10008963 3300031249 Bacteria 6328
170 Ga0265316_10149608 3300031344 Bacteria 1749
171 Ga0307513_10276345 3300031456 Bacteria 1460
172 Ga0265314_10037939 3300031711 Bacteria 3486
173 Ga0307405_10300147 3300031731 Bacteria 1218
174 Ga0307410_10038727 3300031852 Bacteria 3125
175 Ga0307410_10660573 3300031852 Bacteria 878
176 Ga0307409_100135455 3300031995 Bacteria 2113
177 Ga0307411_10026736 3300032005 Bacteria 3479
178 Ga0307415_100073780 3300032126 Bacteria 2409
179 Ga0307415_100349210 3300032126 Bacteria 1244
180 Ga0373930_0094331 3300034816 Bacteria 705
181 Ga0373948_0043697 3300034817 Bacteria 945
182 Ga0373958_0002826 3300034819 Bacteria 2468
183 Ga0373959_0005066 3300034820 Bacteria 2152
184 Ga0373938_0004788 3300034957 Bacteria 2273
185 Ga0373928_0003286 3300035084 Bacteria 3097
186 Ga0373929_0002835 3300035085 Bacteria 3167
187 Ga0373934_0105554 3300035086 Bacteria 1140
188 Ga0373944_0036382 3300035089 Bacteria 1504
189 Ga0373951_0019308 3300035091 Bacteria 1553
190 Ga0373936_0106709 3300035113 Bacteria 1186
191 Ga0373941_0184373 3300035115 Bacteria 785
192 Ga0373954_0009552 3300035118 Bacteria 4268
193 Ga0373954_0010741 3300035118 Bacteria 4048
194 Ga0373960_0059484 3300035121 Bacteria 1155
195 Ga0373960_0254663 3300035121 Bacteria 639
196 Ga0373943_0155759 3300035170 Bacteria 1240
197 Ga0373946_0309653 3300035171 Bacteria 782
198 Ga0373955_0298368 3300035172 Bacteria 971
199 Ga0373942_0037971 3300035207 Bacteria 1304
200 Ga0373961_0096762 3300035241 Bacteria 950
201 Ga0373962_0009684 3300035242 Bacteria 2392
202 Ga0373924_0043920 3300035410 Bacteria 1836
203 Ga0373924_0132154 3300035410 Bacteria 1086
204 Ga0373931_0464516 3300035691 Bacteria 811
205 Ga0373935_0052910 3300035692 Bacteria 2582
206 Ga0373935_0138593 3300035692 Bacteria 1641
207 Ga0373935_1323713 3300035692 Bacteria 538
208 Ga0373927_0122229 3300035695 Bacteria 1699
209 Ga0373933_0001746 3300035724 Bacteria 12607
210 Ga0373933_0086854 3300035724 Bacteria 1925
211 Ga0373947_0025043 3300035725 Bacteria 3479
212 Ga0373947_0284624 3300035725 Bacteria 1099
213 Ga0373937_0003216 3300036401 Bacteria 13680
214 Ga0373937_0011446 3300036401 Bacteria 7786
215 Ga0373925_0056800 3300037068 Bacteria 2932
216 Ga0373925_0146331 3300037068 Bacteria 1852
217 Ga0373925_1016831 3300037068 Bacteria 682
218 Ga0395905_0838276 3300037471 Bacteria 822
219 Ga0436364_0132601 3300037853 Bacteria 24278
220 Ga0436364_0361980 3300037853 Bacteria 27663
221 Ga0436364_0734194 3300037853 Bacteria 2718
222 Ga0436364_1389485 3300037853 Bacteria 33853
223 Ga0436365_0374278 3300039437 Bacteria 3933
224 Ga0436365_1454613 3300039437 Bacteria 26721
225 Ga0436365_1720669 3300039437 Bacteria 5114
226 Ga0436361_0456437 3300039447 Bacteria 1042
227 Ga0436363_0312523 3300039450 Bacteria 1232
228 Ga0436362_0009442 3300039453 Bacteria 29555
229 Ga0436362_1117050 3300039453 Bacteria 1898
230 Ga0439438_108905 3300041405 Bacteria 669
231 Ga0439453_0094133 3300041408 Bacteria 661
232 Ga0439461_0025085 3300041410 Bacteria 1209
233 Ga0439465_0105451 3300041413 Bacteria 977
234 Ga0451793_0396118 3300041452 Bacteria 1889
235 Ga0451802_0825046 3300041460 Bacteria 1068
236 Ga0451833_0012212 3300041491 Bacteria 613
237 Ga0451849_1574946 3300041505 Bacteria 1012
238 Ga0451843_0644274 3300041509 Bacteria 1881
239 Ga0451853_2504315 3300041512 Bacteria 3083
240 Ga0466965_0050554 3300044683 Bacteria 2061
241 Ga0466966_0029755 3300044684 Bacteria 3551
242 Ga0466961_0055039 3300044693 Bacteria 2537
243 Ga0466961_0149046 3300044693 Bacteria 1461
244 Ga0466961_0152577 3300044693 Bacteria 1442
245 Ga0466961_0307023 3300044693 Bacteria 968
246 Ga0466961_0602523 3300044693 Bacteria 661
247 Ga0466963_0000918 3300044694 Bacteria 15006
248 Ga0466963_0112434 3300044694 Bacteria 1870
249 Ga0466963_0118418 3300044694 Bacteria 1821
250 Ga0466963_0506413 3300044694 Bacteria 852
251 Ga0466963_0672739 3300044694 Bacteria 730
252 Ga0466964_0001466 3300044706 Bacteria 8066
253 Ga0466964_0377044 3300044706 Bacteria 735
254 Ga0466971_0000394 3300044719 Bacteria 16912
255 Ga0466971_0604497 3300044719 Bacteria 547
256 Ga0466968_0100700 3300044735 Bacteria 1290
257 Ga0466970_0030611 3300044765 Bacteria 2838
258 Ga0466970_0035852 3300044765 Bacteria 2627
259 Ga0466970_0060404 3300044765 Bacteria 2030
260 Ga0466970_0092086 3300044765 Bacteria 1646
261 Ga0466970_0093986 3300044765 Bacteria 1629
262 Ga0466970_0841443 3300044765 Bacteria 538
263 Ga0466957_0026149 3300044842 Bacteria 3461
264 Ga0466957_0029443 3300044842 Bacteria 3274
265 Ga0466957_0100587 3300044842 Bacteria 1822
266 Ga0466957_0205757 3300044842 Bacteria 1294
267 Ga0466960_0089114 3300044901 Bacteria 1569
268 Ga0466960_0096275 3300044901 Bacteria 1517
269 Ga0466960_0477713 3300044901 Bacteria 728
270 Ga0466959_0003768 3300045049 Bacteria 10041
271 Ga0466959_0282836 3300045049 Bacteria 1138
272 Ga0466959_0675175 3300045049 Bacteria 693
273 Ga0466958_0006242 3300045836 Bacteria 6470
274 Ga0466958_0271886 3300045836 Bacteria 1085
275 Ga0466967_0062305 3300045976 Bacteria 3311
276 Ga0466967_0164159 3300045976 Bacteria 2087
277 Ga0466967_0305846 3300045976 Bacteria 1530
278 Ga0466967_0799541 3300045976 Bacteria 936
279 Ga0466967_1297023 3300045976 Bacteria 725
280 Ga0495603_0038956 3300046455 Bacteria 2849
281 Ga0495629_0028420 3300046459 Bacteria 3970
282 Ga0495641_0007889 3300046461 Bacteria 6576
283 Ga0495641_0085869 3300046461 Bacteria 1408
284 Ga0495653_0009748 3300046463 Bacteria 7855
285 Ga0495653_0022891 3300046463 Bacteria 5052
286 Ga0495653_0108357 3300046463 Bacteria 2000
287 Ga0495653_0111966 3300046463 Bacteria 1960
288 Ga0495580_0059103 3300046472 Bacteria 2694
289 Ga0495580_0208937 3300046472 Bacteria 1343
290 Ga0495582_0016538 3300046473 Bacteria 4041
291 Ga0495639_0055607 3300046475 Bacteria 1805
292 Ga0495639_0071324 3300046475 Bacteria 1605
293 Ga0495662_0051348 3300046476 Bacteria 1990
294 Ga0495662_0076651 3300046476 Bacteria 1623
295 Ga0495664_0010488 3300046477 Bacteria 5198
296 Ga0495608_0069749 3300046511 Bacteria 2295
297 Ga0495618_0055143 3300046514 Bacteria 2516
298 Ga0495628_0006751 3300046516 Bacteria 9995
299 Ga0495630_0090011 3300046517 Bacteria 2318
300 Ga0495666_0141893 3300046526 Bacteria 1119
301 Ga0495666_0161616 3300046526 Bacteria 1038
302 Ga0495652_0037626 3300046529 Bacteria 4196
303 Ga0495652_0145334 3300046529 Bacteria 1859
304 Ga0495652_0300807 3300046529 Bacteria 1166
305 Ga0495665_0005991 3300046531 Bacteria 6554
306 Ga0495665_0112811 3300046531 Bacteria 1425
307 Ga0495640_0097208 3300046533 Bacteria 1936
308 Ga0495640_0118319 3300046533 Bacteria 1724
309 Ga0495640_0260141 3300046533 Bacteria 1084
310 Ga0495640_0499472 3300046533 Bacteria 740
311 Ga0495587_0007128 3300046536 Bacteria 7254
312 Ga0495587_0047130 3300046536 Bacteria 2556
313 Ga0495645_0103165 3300046543 Bacteria 2026
314 Ga0495667_0009680 3300046559 Bacteria 6529
315 Ga0495667_0035997 3300046559 Bacteria 3306
316 Ga0495634_0009330 3300046642 Bacteria 7238
317 Ga0495634_0544146 3300046642 Bacteria 677
318 Ga0495635_0044144 3300046663 Bacteria 3075
319 Ga0495635_0081959 3300046663 Bacteria 2207
320 Ga0495599_0066548 3300046678 Bacteria 2250
321 Ga0495623_0023792 3300046679 Bacteria 3952
322 Ga0495646_0020790 3300046680 Bacteria 4150
323 Ga0495647_0024568 3300046681 Bacteria 2194
324 Ga0495658_0022511 3300046683 Bacteria 3333
325 Ga0495658_0201836 3300046683 Bacteria 1239
326 Ga0495658_0489145 3300046683 Bacteria 787
327 Ga0495613_0028945 3300046689 Bacteria 4119
328 Ga0495613_0075625 3300046689 Bacteria 2451
329 Ga0495624_0120857 3300046690 Bacteria 1608
330 Ga0495600_0009562 3300046809 Bacteria 5993
331 Ga0495581_0017502 3300047315 Bacteria 4163
332 Ga0495604_0107415 3300047317 Bacteria 2040
333 Ga0495676_0066426 3300047321 Bacteria 2795
334 Ga0495676_0140989 3300047321 Bacteria 1727
335 Ga0495680_0004255 3300047322 Bacteria 13748
336 Ga0495680_0023863 3300047322 Bacteria 5082
337 Ga0495680_0058296 3300047322 Bacteria 2984
338 Ga0495680_0303360 3300047322 Bacteria 1121
339 Ga0495684_0101061 3300047471 Bacteria 2180
340 Ga0495684_0286612 3300047471 Bacteria 1186
341 Ga0495593_0054615 3300047673 Bacteria 2104
342 Ga0495593_0087489 3300047673 Bacteria 1606
343 Ga0495602_0022196 3300048088 Bacteria 6221
344 Ga0495602_0043008 3300048088 Bacteria 4111
345 Ga0495602_0161108 3300048088 Bacteria 1751
346 Ga0495602_1023324 3300048088 Bacteria 544
347 Ga0495614_0079330 3300048089 Bacteria 1421
348 Ga0496100_0007511 3300048903 Bacteria 6020
349 Ga0496100_0100392 3300048903 Bacteria 1994
350 Ga0496102_0175537 3300048905 Bacteria 2017
351 Ga0496102_1218134 3300048905 Bacteria 672
352 Ga0496103_0286109 3300048906 Bacteria 1060
353 Ga0496104_0159594 3300048907 Bacteria 2163
354 Ga0496105_0138102 3300048908 Bacteria 2007
355 Ga0496105_0340863 3300048908 Bacteria 1198
356 Ga0496106_0138432 3300048909 Bacteria 1914
357 Ga0496106_0428129 3300048909 Bacteria 1063
358 Ga0496107_0179946 3300048910 Bacteria 1570
359 Ga0496108_0012058 3300048911 Bacteria 7027
360 Ga0496108_0128714 3300048911 Bacteria 2175
361 Ga0496108_0163837 3300048911 Bacteria 1922
362 Ga0496109_0040349 3300048912 Bacteria 4228
363 Ga0496109_0154288 3300048912 Bacteria 2151
364 Ga0496109_0243390 3300048912 Bacteria 1693
365 Ga0496110_0124921 3300048913 Bacteria 2321
366 Ga0496110_0241762 3300048913 Bacteria 1642
367 Ga0496112_0070824 3300048915 Bacteria 3446
368 Ga0496112_0391807 3300048915 Bacteria 1329
369 Ga0496112_0524857 3300048915 Bacteria 1119
370 Ga0496113_0011694 3300048916 Bacteria 5870
371 Ga0496113_0084653 3300048916 Bacteria 2435
372 Ga0496113_0482989 3300048916 Bacteria 995
373 Ga0496114_0012045 3300048917 Bacteria 6919
374 Ga0496114_0099819 3300048917 Bacteria 2476
375 Ga0496114_0455029 3300048917 Bacteria 1133
376 Ga0496115_0031075 3300048918 Bacteria 4205
377 Ga0496125_0000214 3300048928 Bacteria 118625
378 Ga0496126_0522244 3300048929 Bacteria 946
379 Ga0501306_002289 3300049127 Bacteria 1943
380 Ga0501310_000043 3300049130 Bacteria 12853
381 Ga0501305_002261 3300049161 Bacteria 2050
382 Ga0501311_018517 3300049527 Bacteria 926
383 Ga0501317_011794 3300049533 Bacteria 1069
384 Ga0501318_001296 3300049534 Bacteria 1927
385 Ga0501323_010156 3300049539 Bacteria 1119
386 Ga0501032_0014525 3300049569 Bacteria 5575
387 Ga0501032_0210014 3300049569 Bacteria 1269
388 Ga0501033_0112529 3300049570 Bacteria 1980
389 Ga0501034_0428406 3300049571 Bacteria 1243
390 Ga0501036_0006857 3300049572 Bacteria 9256
391 Ga0501037_0180625 3300049573 Bacteria 1497
392 Ga0501037_0726860 3300049573 Bacteria 659
393 Ga0501039_0497249 3300049575 Bacteria 957
394 Ga0501040_0007809 3300049576 Bacteria 6929
395 Ga0501042_0000616 3300049578 Bacteria 18986
396 Ga0501047_0074509 3300049581 Bacteria 3268
397 Ga0501048_0006807 3300049582 Bacteria 8682
398 Ga0501067_0207330 3300049583 Bacteria 1092
399 Ga0501069_0058006 3300049585 Bacteria 2159
400 Ga0501069_0129916 3300049585 Bacteria 1442
401 Ga0501069_0241863 3300049585 Bacteria 1052
402 Ga0501070_0002928 3300049586 Bacteria 14854
403 Ga0501070_0160677 3300049586 Bacteria 1852
404 Ga0501070_0260494 3300049586 Bacteria 1417
405 Ga0501070_0580826 3300049586 Bacteria 895
406 Ga0501071_0009431 3300049587 Bacteria 6499
407 Ga0501072_0013156 3300049588 Bacteria 6335
408 Ga0501073_0140514 3300049589 Bacteria 1673
409 Ga0501074_0036476 3300049590 Bacteria 3561
410 Ga0501076_0051226 3300049592 Bacteria 3267
411 Ga0501077_0016147 3300049593 Bacteria 4704
412 Ga0501202_052094 3300049652 Bacteria 909
413 Ga0501079_0034824 3300049741 Bacteria 3874
414 Ga0501080_0328516 3300049742 Bacteria 1383
415 Ga0501080_0721021 3300049742 Bacteria 879
416 Ga0501080_0943646 3300049742 Bacteria 750
417 Ga0501083_0310158 3300049744 Bacteria 1026
418 Ga0501044_0001698 3300049823 Bacteria 25837
419 Ga0501044_0232397 3300049823 Bacteria 1791
420 Ga0501045_0011211 3300049824 Bacteria 6288
421 nmdc:mga03683_57712_c1 3300050489 Bacteria 1634
422 nmdc:mga03n38_169643_c1 3300050490 Bacteria 1111
423 nmdc:mga00v17_154405_c1 3300050491 Bacteria 1475
424 nmdc:mga00v17_82371_c1 3300050491 Bacteria 2011
425 nmdc:mga0yw44_41215_c1 3300050492 Bacteria 2748
426 nmdc:mga0yw44_70504_c1 3300050492 Bacteria 2167
427 nmdc:mga06z11_310517_c1 3300050494 Bacteria 939
428 nmdc:mga07m45_18027_c1 3300050496 Bacteria 3803
429 nmdc:mga05p37_86241_c1 3300050507 Bacteria 3870
430 nmdc:mga06r32_166421_c1 3300050510 Bacteria 2188
431 nmdc:mga08y16_236902_c1 3300050511 Bacteria 1887
432 nmdc:mga0n895_254304_c1 3300050512 Bacteria 1783
433 nmdc:mga0n895_3248_c1 3300050512 Bacteria 13032
434 nmdc:mga0n895_894583_c1 3300050512 Bacteria 874
435 nmdc:mga0rr50_113745_c1 3300050513 Bacteria 2145
436 nmdc:mga0rr50_156471_c1 3300050513 Bacteria 1847
437 nmdc:mga0rr50_19988_c1 3300050513 Bacteria 4536
438 nmdc:mga08x19_15188_c1 3300050514 Bacteria 4682
439 nmdc:mga08x19_28582_c1 3300050514 Bacteria 3493
440 nmdc:mga08x19_87886_c1 3300050514 Bacteria 2048
441 nmdc:mga0a205_196409_c1 3300050515 Bacteria 1909
442 nmdc:mga0a205_49185_c1 3300050515 Bacteria 4069
443 Ga0495601_0038597 3300053077 Bacteria 2987
444 Ga0495612_0034000 3300053078 Bacteria 2063
445 Ga0500635_0000004 3300053080 Bacteria 210675
446 Ga0495655_0014269 3300053083 Bacteria 1662
447 Ga0495595_0174912 3300053084 Bacteria 1063
448 Ga0495619_0062431 3300053085 Bacteria 2480
449 Ga0495619_0103079 3300053085 Bacteria 1943
450 Ga0495619_0117071 3300053085 Bacteria 1825
451 Ga0495619_0131573 3300053085 Bacteria 1719
452 Ga0500644_0000410 3300053088 Bacteria 20195
453 Ga0500628_157365 3300053129 Bacteria 639
454 Ga0500568_0002744 3300053139 Bacteria 10200
455 Ga0500573_0001011 3300053140 Bacteria 12943
456 Ga0500590_051846 3300053148 Bacteria 2084
457 Ga0501084_0020015 3300054114 Bacteria 5579
458 Ga0501082_0052330 3300060353 Bacteria 3520
459 Ga0466962_0002002 3300061719 Bacteria 9625
460 Ga0466962_0082966 3300061719 Bacteria 1533
461 Ga0466962_0199534 3300061719 Bacteria 977
462 Ga0466962_0291048 3300061719 Bacteria 807
463 Ga0530510_0128522 3300061734 Bacteria 1863
464 Ga0530510_0774827 3300061734 Bacteria 732
465 2643892529 2643221576 Bacteria 5214352
466 2643961581 2643221590 Bacteria 5214697
467 2729908078 2728369276 Bacteria 5610032
468 2812364642 2811994880 Bacteria 4147780
469 2867349618 2867346516 Bacteria 7608576
470 2884996135 2884994152 Bacteria 4492978
471 Ga0163161_11117966
472 Ga0070683_100995619
473 Ga0070670_100686394
474 Ga0070680_100000019
475 Ga0070659_100358760
476 Ga0070709_10000118
477 Ga0070709_10018286
478 Ga0070709_10087902
479 Ga0070714_100003752
480 Ga0070714_100015902
481 Ga0070713_100000299
482 Ga0070710_10000459
483 Ga0070705_100015927
484 Ga0070705_100742447
485 Ga0070708_100108986
486 Ga0070708_100503536
487 Ga0070663_100299106
488 Ga0070678_100043107
489 Ga0070681_10000017
490 Ga0070681_10257593
491 Ga0068867_100365367
492 Ga0070706_100048968
493 Ga0070706_100259741
494 Ga0070706_100535583
495 Ga0070707_100000873
496 Ga0070707_100029930
497 Ga0070707_100043100
498 Ga0070707_100088076
499 Ga0070707_100153969
500 Ga0070707_100281693
501 Ga0070707_101056229
502 Ga0070698_100000623
503 Ga0070698_100002990
504 Ga0070698_100008001
505 Ga0070698_100095313
506 Ga0070698_100207190
507 Ga0070679_100000009
508 Ga0070679_100036809
509 Ga0070679_100712823
510 Ga0070684_100895436
511 Ga0070697_100079144
512 Ga0070697_100165362
513 Ga0070696_100301247
514 Ga0070693_100065899
515 Ga0070704_100130334
516 Ga0070704_100968265
517 Ga0068855_100607249
518 Ga0068856_100295700
519 Ga0070702_100035083
520 Ga0068852_100198373
521 Ga0068864_100398291
522 Ga0068861_100568645
523 Ga0068863_100076585
524 Ga0081455_10333581
525 Ga0081540_1000693
526 Ga0081539_10090403
527 Ga0070717_10003735
528 Ga0070717_10038333
529 Ga0070717_10063463
530 Ga0070717_10224897
531 Ga0070717_10667576
532 Ga0070717_10834411
533 Ga0075365_10024793
534 Ga0075365_10333661
535 Ga0075363_100064544
536 Ga0075364_10101435
537 Ga0070715_10008092
538 Ga0070715_10010409
539 Ga0070716_100000716
540 Ga0070712_100001248
541 Ga0070712_100102066
542 Ga0070712_100345705
543 Ga0075367_10092667
544 Ga0075370_10027439
545 Ga0075370_10351227
546 Ga0068871_100307923
547 Ga0075431_100009233
548 Ga0075433_10017953
549 Ga0075433_10156724
550 Ga0075434_100003369
551 Ga0068865_100184114
552 Ga0075436_100032656
553 Ga0075436_100046528
554 Ga0075435_100003619
555 Ga0075435_100076455
556 Ga0111539_10028450
557 Ga0105245_10316400
558 Ga0105245_11641087
559 Ga0114129_10013919
560 Ga0114129_11068392
561 Ga0114129_11345961
562 Ga0105243_10027366
563 Ga0105242_10009892
564 Ga0105248_10460975
565 Ga0105248_12471763
566 Ga0105238_10073910
567 Ga0105249_10013932
568 Ga0105028_130094
569 Ga0157378_10008104
570 Ga0163162_10303271
571 Ga0157375_10298267
572 Ga0157375_10551530
573 Ga0157376_10604690
574 Ga0163161_10841770
575 Ga0206349_1713777
576 Ga0206350_10030112
577 Ga0213873_10000202
578 Ga0213876_10002748
579 Ga0213876_10107141
580 Ga0213875_10000308
581 Ga0213875_10000488
582 Ga0207692_10004361
583 Ga0207692_10142291
584 Ga0207685_10092524
585 Ga0207699_10000106
586 Ga0207699_10004659
587 Ga0207699_10057697
588 Ga0207699_10076506
589 Ga0207705_10729267
590 Ga0207684_10002007
591 Ga0207684_10012638
592 Ga0207684_10190059
593 Ga0207707_10000257
594 Ga0207693_10006289
595 Ga0207660_10002011
596 Ga0207652_10000070
597 Ga0207646_10000434
598 Ga0207646_10028328
599 Ga0207646_10103124
600 Ga0207646_10136567
601 Ga0207646_10230435
602 Ga0207700_10000053
603 Ga0207664_10000371
604 Ga0207664_10012239
605 Ga0207664_10434339
606 Ga0207690_10523080
607 Ga0207709_10019073
608 Ga0207670_11170826
609 Ga0207704_10680710
610 Ga0207665_10000166
611 Ga0207665_11057341
612 Ga0207711_10906728
613 Ga0207661_10298909
614 Ga0207661_10714982
615 Ga0207640_10343202
616 Ga0207708_10000029
617 Ga0207708_10526004
618 Ga0207708_10596050
619 Ga0207702_10632919
620 Ga0207641_10041060
621 Ga0207641_10384339
622 Ga0207648_10534753
623 Ga0207676_10799873
624 Ga0207674_10085459
625 Ga0207675_100528852
626 Ga0207675_101251304
627 Ga0207683_10064697
628 Ga0207698_10330293
629 Ga0207698_10890041
630 Ga0209974_10027615
631 Ga0207428_10158937
632 Ga0265318_10193199
633 Ga0265338_10023014
634 Ga0265338_10376593
635 Ga0265325_10011217
636 Ga0265325_10028490
637 Ga0265340_10006460
638 Ga0265340_10060569
639 Ga0265339_10008963
640 Ga0265316_10149608
641 Ga0307513_10276345
642 Ga0265314_10037939
643 Ga0307405_10300147
644 Ga0307410_10038727
645 Ga0307410_10660573
646 Ga0307409_100135455
647 Ga0307411_10026736
648 Ga0307415_100073780
649 Ga0307415_100349210
650 Ga0373930_0094331
651 Ga0373948_0043697
652 Ga0373958_0002826
653 Ga0373959_0005066
654 Ga0373938_0004788
655 Ga0373928_0003286
656 Ga0373929_0002835
657 Ga0373934_0105554
658 Ga0373944_0036382
659 Ga0373951_0019308
660 Ga0373936_0106709
661 Ga0373941_0184373
662 Ga0373954_0009552
663 Ga0373954_0010741
664 Ga0373960_0059484
665 Ga0373960_0254663
666 Ga0373943_0155759
667 Ga0373946_0309653
668 Ga0373955_0298368
669 Ga0373942_0037971
670 Ga0373961_0096762
671 Ga0373962_0009684
672 Ga0373924_0043920
673 Ga0373924_0132154
674 Ga0373931_0464516
675 Ga0373935_0052910
676 Ga0373935_0138593
677 Ga0373935_1323713
678 Ga0373927_0122229
679 Ga0373933_0001746
680 Ga0373933_0086854
681 Ga0373947_0025043
682 Ga0373947_0284624
683 Ga0373937_0003216
684 Ga0373937_0011446
685 Ga0373925_0056800
686 Ga0373925_0146331
687 Ga0373925_1016831
688 Ga0395905_0838276
689 Ga0436364_0132601
690 Ga0436364_0361980
691 Ga0436364_0734194
692 Ga0436364_1389485
693 Ga0436365_0374278
694 Ga0436365_1454613
695 Ga0436365_1720669
696 Ga0436361_0456437
697 Ga0436363_0312523
698 Ga0436362_0009442
699 Ga0436362_1117050
700 Ga0439438_108905
701 Ga0439453_0094133
702 Ga0439461_0025085
703 Ga0439465_0105451
704 Ga0451793_0396118
705 Ga0451802_0825046
706 Ga0451833_0012212
707 Ga0451849_1574946
708 Ga0451843_0644274
709 Ga0451853_2504315
710 Ga0466965_0050554
711 Ga0466966_0029755
712 Ga0466961_0055039
713 Ga0466961_0149046
714 Ga0466961_0152577
715 Ga0466961_0307023
716 Ga0466961_0602523
717 Ga0466963_0000918
718 Ga0466963_0112434
719 Ga0466963_0118418
720 Ga0466963_0506413
721 Ga0466963_0672739
722 Ga0466964_0001466
723 Ga0466964_0377044
724 Ga0466971_0000394
725 Ga0466971_0604497
726 Ga0466968_0100700
727 Ga0466970_0030611
728 Ga0466970_0035852
729 Ga0466970_0060404
730 Ga0466970_0092086
731 Ga0466970_0093986
732 Ga0466970_0841443
733 Ga0466957_0026149
734 Ga0466957_0029443
735 Ga0466957_0100587
736 Ga0466957_0205757
737 Ga0466960_0089114
738 Ga0466960_0096275
739 Ga0466960_0477713
740 Ga0466959_0003768
741 Ga0466959_0282836
742 Ga0466959_0675175
743 Ga0466958_0006242
744 Ga0466958_0271886
745 Ga0466967_0062305
746 Ga0466967_0164159
747 Ga0466967_0305846
748 Ga0466967_0799541
749 Ga0466967_1297023
750 Ga0495603_0038956
751 Ga0495629_0028420
752 Ga0495641_0007889
753 Ga0495641_0085869
754 Ga0495653_0009748
755 Ga0495653_0022891
756 Ga0495653_0108357
757 Ga0495653_0111966
758 Ga0495580_0059103
759 Ga0495580_0208937
760 Ga0495582_0016538
761 Ga0495639_0055607
762 Ga0495639_0071324
763 Ga0495662_0051348
764 Ga0495662_0076651
765 Ga0495664_0010488
766 Ga0495608_0069749
767 Ga0495618_0055143
768 Ga0495628_0006751
769 Ga0495630_0090011
770 Ga0495666_0141893
771 Ga0495666_0161616
772 Ga0495652_0037626
773 Ga0495652_0145334
774 Ga0495652_0300807
775 Ga0495665_0005991
776 Ga0495665_0112811
777 Ga0495640_0097208
778 Ga0495640_0118319
779 Ga0495640_0260141
780 Ga0495640_0499472
781 Ga0495587_0007128
782 Ga0495587_0047130
783 Ga0495645_0103165
784 Ga0495667_0009680
785 Ga0495667_0035997
786 Ga0495634_0009330
787 Ga0495634_0544146
788 Ga0495635_0044144
789 Ga0495635_0081959
790 Ga0495599_0066548
791 Ga0495623_0023792
792 Ga0495646_0020790
793 Ga0495647_0024568
794 Ga0495658_0022511
795 Ga0495658_0201836
796 Ga0495658_0489145
797 Ga0495613_0028945
798 Ga0495613_0075625
799 Ga0495624_0120857
800 Ga0495600_0009562
801 Ga0495581_0017502
802 Ga0495604_0107415
803 Ga0495676_0066426
804 Ga0495676_0140989
805 Ga0495680_0004255
806 Ga0495680_0023863
807 Ga0495680_0058296
808 Ga0495680_0303360
809 Ga0495684_0101061
810 Ga0495684_0286612
811 Ga0495593_0054615
812 Ga0495593_0087489
813 Ga0495602_0022196
814 Ga0495602_0043008
815 Ga0495602_0161108
816 Ga0495602_1023324
817 Ga0495614_0079330
818 Ga0496100_0007511
819 Ga0496100_0100392
820 Ga0496102_0175537
821 Ga0496102_1218134
822 Ga0496103_0286109
823 Ga0496104_0159594
824 Ga0496105_0138102
825 Ga0496105_0340863
826 Ga0496106_0138432
827 Ga0496106_0428129
828 Ga0496107_0179946
829 Ga0496108_0012058
830 Ga0496108_0128714
831 Ga0496108_0163837
832 Ga0496109_0040349
833 Ga0496109_0154288
834 Ga0496109_0243390
835 Ga0496110_0124921
836 Ga0496110_0241762
837 Ga0496112_0070824
838 Ga0496112_0391807
839 Ga0496112_0524857
840 Ga0496113_0011694
841 Ga0496113_0084653
842 Ga0496113_0482989
843 Ga0496114_0012045
844 Ga0496114_0099819
845 Ga0496114_0455029
846 Ga0496115_0031075
847 Ga0496125_0000214
848 Ga0496126_0522244
849 Ga0501306_002289
850 Ga0501310_000043
851 Ga0501305_002261
852 Ga0501311_018517
853 Ga0501317_011794
854 Ga0501318_001296
855 Ga0501323_010156
856 Ga0501032_0014525
857 Ga0501032_0210014
858 Ga0501033_0112529
859 Ga0501034_0428406
860 Ga0501036_0006857
861 Ga0501037_0180625
862 Ga0501037_0726860
863 Ga0501039_0497249
864 Ga0501040_0007809
865 Ga0501042_0000616
866 Ga0501047_0074509
867 Ga0501048_0006807
868 Ga0501067_0207330
869 Ga0501069_0058006
870 Ga0501069_0129916
871 Ga0501069_0241863
872 Ga0501070_0002928
873 Ga0501070_0160677
874 Ga0501070_0260494
875 Ga0501070_0580826
876 Ga0501071_0009431
877 Ga0501072_0013156
878 Ga0501073_0140514
879 Ga0501074_0036476
880 Ga0501076_0051226
881 Ga0501077_0016147
882 Ga0501202_052094
883 Ga0501079_0034824
884 Ga0501080_0328516
885 Ga0501080_0721021
886 Ga0501080_0943646
887 Ga0501083_0310158
888 Ga0501044_0001698
889 Ga0501044_0232397
890 Ga0501045_0011211
891 nmdc:mga03683_57712_c1
892 nmdc:mga03n38_169643_c1
893 nmdc:mga00v17_154405_c1
894 nmdc:mga00v17_82371_c1
895 nmdc:mga0yw44_41215_c1
896 nmdc:mga0yw44_70504_c1
897 nmdc:mga06z11_310517_c1
898 nmdc:mga07m45_18027_c1
899 nmdc:mga05p37_86241_c1
900 nmdc:mga06r32_166421_c1
901 nmdc:mga08y16_236902_c1
902 nmdc:mga0n895_254304_c1
903 nmdc:mga0n895_3248_c1
904 nmdc:mga0n895_894583_c1
905 nmdc:mga0rr50_113745_c1
906 nmdc:mga0rr50_156471_c1
907 nmdc:mga0rr50_19988_c1
908 nmdc:mga08x19_15188_c1
909 nmdc:mga08x19_28582_c1
910 nmdc:mga08x19_87886_c1
911 nmdc:mga0a205_196409_c1
912 nmdc:mga0a205_49185_c1
913 Ga0495601_0038597
914 Ga0495612_0034000
915 Ga0500635_0000004
916 Ga0495655_0014269
917 Ga0495595_0174912
918 Ga0495619_0062431
919 Ga0495619_0103079
920 Ga0495619_0117071
921 Ga0495619_0131573
922 Ga0500644_0000410
923 Ga0500628_157365
924 Ga0500568_0002744
925 Ga0500573_0001011
926 Ga0500590_051846
927 Ga0501084_0020015
928 Ga0501082_0052330
929 Ga0466962_0002002
930 Ga0466962_0082966
931 Ga0466962_0199534
932 Ga0466962_0291048
933 Ga0530510_0128522
934 Ga0530510_0774827
935 2643892529
936 2643961581
937 2729908078
938 2812364642
939 2867349618
940 2884996135

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00731

AIRC

AIR carboxylase

5

145

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zmb-assembly1.cif.gz_B structure of acetobacter aceti pure-s57v,y154f 0.9837 6 154
2fwb-assembly1.cif.gz_B structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h89f from the acidophilic bacterium acetobacter aceti, at ph 8 0.9837 6 154
4zjy-assembly1.cif.gz_B structure of acetobacter aceti pure-s57n 0.9835 6 154
2fw9-assembly1.cif.gz_B structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59f from the acidophilic bacterium acetobacter aceti, at ph 8 0.9835 6 154
5clf-assembly1.cif.gz_B structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) from the acidophilic bacterium acetobacter aceti, at ph 8.5 0.9833 6 150
ID Description Score Start End Superfamily
af_Q9SJ42_1_162_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9793 13 165 3.40.50.1970
5cvtB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9734 6 154 3.40.50.1970
2ywxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.967 9 164 3.40.50.1970
af_Q2FZJ5_1_139_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9643 29 163 3.40.50.1970
af_P21264_391_571_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9498 1 174 3.40.50.1970
ID Description Score Start End GO Terms
AF-A0A2V1KCK0-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9923 7 165 GO:0006189
GO:0034023
AF-A0A6I5CL20-F1-model_v4 5-(Carboxyamino)imidazole ribonucleotide mutase (EC 4.1.1.21, EC 5.4.99.18) 0.9921 6 160 GO:0004638
GO:0006189
GO:0034023
AF-A0A7V9F483-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.992 4 169 GO:0004638
GO:0006189
GO:0034023
AF-A0A7X7V6D3-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.992 6 168 GO:0004638
GO:0006189
GO:0034023
AF-A0A1V2PRK4-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9913 9 170 GO:0006189
GO:0034023

Map