F450363

General Info

Members Datasets Scaffolds Average Seq Length
470 252 462 191

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100129771|Ga0070675_1001297712
Length 232
Sequence MASHCALSMQYHGRRVDYPGGVFCLADKVQRPEPPKQPKDAVMTTYKVGYFVGSLSSTSINRLLAKAMARLAPPDLVLSEIQIRDLPLYSQDYDADFPPVARAFKQCIADVDAVLFVTPEFNRSIPGGLKNAIDWASRPWGKNSFTRKPSAVIGASPGPIGTALAQQSLRGVLCFCNSPLMNMVEAYIHFKPGLITAEGEVTDERTQEFLRNYLTELHAFIVRVLTVLPRDA

Samples

Sample ID Description Type Environment
1 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
2 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
3 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
4 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
5 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
6 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
7 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
8 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
88 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
89 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
104 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
110 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
111 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
112 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
189 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
190 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
202 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
206 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
228 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
229 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
230 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
231 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
232 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
248 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
249 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
251 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
252 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.81
Metatranscriptomes 1.49
Isolates 1.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.13
Nodule 1.28
Rhizoplane 1.06
Rhizosphere 93.83
Stem 0
Stem Tuber 0
Unclassified 1.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001160 3300001915 Bacteria 7779
2 JGI24741J21665_1001330 3300001915 Bacteria 7202
3 JGI24740J21852_10000202 3300001979 Bacteria 24620
4 JGI25156J39149_1018438 3300002705 Bacteria 1289
5 JGI25157J39369_1006909 3300002741 Bacteria 1683
6 JGI25404J52841_10070237 3300003659 Bacteria 732
7 Ga0058862_12784152 3300004803 Bacteria 950
8 Ga0065715_10465578 3300005293 Bacteria 811
9 Ga0065707_10475207 3300005295 Bacteria 778
10 Ga0070658_10009260 3300005327 Bacteria 7918
11 Ga0070658_10509219 3300005327 Bacteria 1040
12 Ga0070658_10616608 3300005327 Bacteria 941
13 Ga0070658_10762154 3300005327 Bacteria 840
14 Ga0070683_100000254 3300005329 Bacteria 36669
15 Ga0070683_101196940 3300005329 Bacteria 730
16 Ga0070690_100030282 3300005330 Bacteria 3362
17 Ga0070690_100697045 3300005330 Bacteria 779
18 Ga0070670_100088907 3300005331 Bacteria 2655
19 Ga0070677_10142031 3300005333 Bacteria 1108
20 Ga0070666_10099307 3300005335 Bacteria 2004
21 Ga0070666_10250992 3300005335 Bacteria 1253
22 Ga0070666_10697072 3300005335 Bacteria 745
23 Ga0070680_100002497 3300005336 Bacteria 13632
24 Ga0070680_100214804 3300005336 Bacteria 1623
25 Ga0070680_100539787 3300005336 Bacteria 999
26 Ga0070682_100001210 3300005337 Bacteria 14716
27 Ga0070682_100060196 3300005337 Bacteria 2401
28 Ga0070682_100070723 3300005337 Bacteria 2231
29 Ga0070682_100237085 3300005337 Bacteria 1308
30 Ga0068868_100406825 3300005338 Bacteria 1175
31 Ga0068868_100449600 3300005338 Bacteria 1120
32 Ga0070660_100055748 3300005339 Bacteria 3055
33 Ga0070660_100231172 3300005339 Bacteria 1505
34 Ga0070660_100237886 3300005339 Bacteria 1482
35 Ga0070660_100397908 3300005339 Bacteria 1139
36 Ga0070691_10019796 3300005341 Bacteria 3107
37 Ga0070691_10064634 3300005341 Bacteria 1765
38 Ga0070687_100166333 3300005343 Bacteria 1308
39 Ga0070661_100008467 3300005344 Bacteria 7114
40 Ga0070661_100008845 3300005344 Bacteria 6969
41 Ga0070661_100094254 3300005344 Bacteria 2218
42 Ga0070668_100139691 3300005347 Bacteria 1951
43 Ga0070675_100129771 3300005354 Bacteria 2147
44 Ga0070675_100249263 3300005354 Bacteria 1554
45 Ga0070671_100203420 3300005355 Bacteria 1679
46 Ga0070674_100147298 3300005356 Bacteria 1773
47 Ga0070674_100417404 3300005356 Bacteria 1100
48 Ga0070673_100169805 3300005364 Bacteria 1861
49 Ga0070673_100358139 3300005364 Bacteria 1296
50 Ga0070688_100029070 3300005365 Bacteria 3306
51 Ga0070659_100004598 3300005366 Bacteria 9870
52 Ga0070659_100019650 3300005366 Bacteria 5124
53 Ga0070659_100024181 3300005366 Bacteria 4655
54 Ga0070659_100143028 3300005366 Bacteria 1948
55 Ga0070659_100146921 3300005366 Bacteria 1921
56 Ga0070659_100311412 3300005366 Bacteria 1315
57 Ga0070659_100578789 3300005366 Bacteria 963
58 Ga0070667_100285914 3300005367 Bacteria 1482
59 Ga0070667_100912396 3300005367 Bacteria 818
60 Ga0070709_10258019 3300005434 Bacteria 1258
61 Ga0070709_10284872 3300005434 Bacteria 1202
62 Ga0070714_100000055 3300005435 Bacteria 103321
63 Ga0070714_100603653 3300005435 Bacteria 1054
64 Ga0070701_10062720 3300005438 Bacteria 1964
65 Ga0070700_100021191 3300005441 Bacteria 3775
66 Ga0070694_100755071 3300005444 Bacteria 795
67 Ga0070663_100006002 3300005455 Bacteria 7267
68 Ga0070663_100152955 3300005455 Bacteria 1770
69 Ga0070663_100230712 3300005455 Bacteria 1457
70 Ga0070663_100618300 3300005455 Bacteria 913
71 Ga0070663_100667363 3300005455 Bacteria 881
72 Ga0070678_100148262 3300005456 Bacteria 1886
73 Ga0070678_101056149 3300005456 Bacteria 748
74 Ga0070678_101154658 3300005456 Bacteria 717
75 Ga0070681_10002073 3300005458 Bacteria 18195
76 Ga0070681_10117557 3300005458 Bacteria 2595
77 Ga0070681_10593700 3300005458 Bacteria 1022
78 Ga0068867_100014208 3300005459 Bacteria 5639
79 Ga0068867_100619834 3300005459 Bacteria 946
80 Ga0070685_10063519 3300005466 Bacteria 2169
81 Ga0070685_10385769 3300005466 Bacteria 966
82 Ga0070679_100000657 3300005530 Bacteria 29456
83 Ga0070679_100010956 3300005530 Bacteria 8615
84 Ga0070679_100054843 3300005530 Bacteria 3969
85 Ga0070679_100354508 3300005530 Bacteria 1415
86 Ga0070684_100000388 3300005535 Bacteria 30506
87 Ga0070684_100034303 3300005535 Bacteria 4338
88 Ga0070684_100171903 3300005535 Bacteria 1968
89 Ga0068853_100265686 3300005539 Bacteria 1579
90 Ga0068853_100284215 3300005539 Bacteria 1525
91 Ga0068853_100433836 3300005539 Bacteria 1234
92 Ga0068853_100805817 3300005539 Bacteria 899
93 Ga0068853_101285318 3300005539 Bacteria 707
94 Ga0070672_100042467 3300005543 Bacteria 3501
95 Ga0070672_100105350 3300005543 Bacteria 2293
96 Ga0070686_100208328 3300005544 Bacteria 1406
97 Ga0070696_100001869 3300005546 Bacteria 13807
98 Ga0070696_100013230 3300005546 Bacteria 5537
99 Ga0070693_100009309 3300005547 Bacteria 4881
100 Ga0070693_100038084 3300005547 Bacteria 2685
101 Ga0068855_100131146 3300005563 Bacteria 2862
102 Ga0068855_100389994 3300005563 Bacteria 1528
103 Ga0068855_101125796 3300005563 Bacteria 819
104 Ga0070664_100025397 3300005564 Bacteria 4910
105 Ga0070664_100193979 3300005564 Bacteria 1810
106 Ga0068857_100026096 3300005577 Bacteria 5146
107 Ga0068857_100035213 3300005577 Bacteria 4432
108 Ga0068857_100097458 3300005577 Bacteria 2636
109 Ga0068857_100418768 3300005577 Bacteria 1249
110 Ga0068857_100517926 3300005577 Bacteria 1121
111 Ga0068854_100084609 3300005578 Bacteria 2347
112 Ga0068854_100457610 3300005578 Bacteria 1067
113 Ga0068856_100218897 3300005614 Bacteria 1919
114 Ga0068856_100715707 3300005614 Bacteria 1021
115 Ga0068852_100060326 3300005616 Bacteria 3293
116 Ga0068852_100255923 3300005616 Bacteria 1679
117 Ga0068852_100293898 3300005616 Bacteria 1570
118 Ga0068859_100846768 3300005617 Bacteria 1001
119 Ga0068866_10014063 3300005718 Bacteria 3524
120 Ga0068861_100391040 3300005719 Bacteria 1231
121 Ga0068863_100071994 3300005841 Bacteria 3270
122 Ga0068858_100808869 3300005842 Bacteria 914
123 Ga0081540_1020852 3300005983 Bacteria 3926
124 Ga0075367_10004088 3300006178 Bacteria 7065
125 Ga0075366_10016146 3300006195 Bacteria 4288
126 Ga0097621_100099950 3300006237 Bacteria 2439
127 Ga0068871_100005657 3300006358 Bacteria 8767
128 Ga0068871_100190869 3300006358 Bacteria 1765
129 Ga0075428_100041295 3300006844 Bacteria 5073
130 Ga0075428_100724647 3300006844 Bacteria 1059
131 Ga0075428_101208001 3300006844 Bacteria 797
132 Ga0075431_100124821 3300006847 Bacteria 2656
133 Ga0075429_100054833 3300006880 Bacteria 3467
134 Ga0068865_100003452 3300006881 Bacteria 9465
135 Ga0068865_100009525 3300006881 Bacteria 6026
136 Ga0068865_100072955 3300006881 Bacteria 2439
137 Ga0097620_100846816 3300006931 Bacteria 1001
138 Ga0105240_10005265 3300009093 Bacteria 19316
139 Ga0105240_10212093 3300009093 Bacteria 2262
140 Ga0105240_10251675 3300009093 Bacteria 2043
141 Ga0105240_10712886 3300009093 Bacteria 1094
142 Ga0111539_10273344 3300009094 Bacteria 1967
143 Ga0111539_10428958 3300009094 Bacteria 1539
144 Ga0105245_10519858 3300009098 Bacteria 1209
145 Ga0114129_10334822 3300009147 Bacteria 2009
146 Ga0114129_11444505 3300009147 Bacteria 847
147 Ga0105243_11205097 3300009148 Bacteria 770
148 Ga0105241_10010803 3300009174 Bacteria 6697
149 Ga0105241_10140369 3300009174 Bacteria 1966
150 Ga0105241_10371532 3300009174 Bacteria 1247
151 Ga0105242_10170130 3300009176 Bacteria 1914
152 Ga0105242_10310994 3300009176 Bacteria 1442
153 Ga0105242_10494727 3300009176 Bacteria 1162
154 Ga0105248_10045905 3300009177 Bacteria 4898
155 Ga0105237_10012614 3300009545 Bacteria 8899
156 Ga0105237_10195176 3300009545 Bacteria 2024
157 Ga0105238_10004755 3300009551 Bacteria 13434
158 Ga0105238_10051006 3300009551 Bacteria 4163
159 Ga0105239_10025635 3300010375 Bacteria 6492
160 Ga0105239_10166896 3300010375 Bacteria 2462
161 Ga0105239_10494532 3300010375 Bacteria 1390
162 Ga0105246_11019220 3300011119 Bacteria 751
163 Ga0157346_1004119 3300012480 Bacteria 845
164 Ga0157345_1007949 3300012498 Bacteria 877
165 Ga0157314_1005956 3300012500 Bacteria 940
166 Ga0157373_10091253 3300013100 Bacteria 2145
167 Ga0157373_10121839 3300013100 Bacteria 1833
168 Ga0157371_10086657 3300013102 Bacteria 2218
169 Ga0157371_10108338 3300013102 Bacteria 1971
170 Ga0157370_10002917 3300013104 Bacteria 20365
171 Ga0157370_10019520 3300013104 Bacteria 6795
172 Ga0157370_10031252 3300013104 Bacteria 5211
173 Ga0157370_10057980 3300013104 Bacteria 3680
174 Ga0157370_10058800 3300013104 Bacteria 3653
175 Ga0157370_10189546 3300013104 Bacteria 1909
176 Ga0157370_10192612 3300013104 Bacteria 1892
177 Ga0157369_10043031 3300013105 Bacteria 4924
178 Ga0157369_10105676 3300013105 Bacteria 2997
179 Ga0157369_10659029 3300013105 Bacteria 1079
180 Ga0157369_10766748 3300013105 Bacteria 992
181 Ga0157374_10382933 3300013296 Bacteria 1401
182 Ga0163162_10051932 3300013306 Bacteria 4115
183 Ga0163162_10137974 3300013306 Bacteria 2550
184 Ga0163162_10155119 3300013306 Bacteria 2409
185 Ga0163162_10226497 3300013306 Bacteria 1999
186 Ga0163162_10826839 3300013306 Bacteria 1042
187 Ga0157372_10027442 3300013307 Bacteria 6201
188 Ga0157372_10039973 3300013307 Bacteria 5179
189 Ga0157372_10079596 3300013307 Bacteria 3706
190 Ga0157372_10080562 3300013307 Bacteria 3685
191 Ga0157372_10084219 3300013307 Bacteria 3603
192 Ga0157372_10084578 3300013307 Bacteria 3596
193 Ga0157372_10972635 3300013307 Bacteria 984
194 Ga0157375_10000515 3300013308 Bacteria 34858
195 Ga0157375_10122265 3300013308 Bacteria 2714
196 Ga0157375_10129493 3300013308 Bacteria 2642
197 Ga0157375_10260294 3300013308 Bacteria 1896
198 Ga0157375_10344393 3300013308 Bacteria 1656
199 Ga0157375_10818340 3300013308 Bacteria 1079
200 Ga0163163_10005444 3300014325 Bacteria 11007
201 Ga0163163_10235613 3300014325 Bacteria 1880
202 Ga0157380_10112106 3300014326 Bacteria 2294
203 Ga0157380_10212156 3300014326 Bacteria 1726
204 Ga0157380_10432841 3300014326 Bacteria 1258
205 Ga0182008_10048342 3300014497 Bacteria 2112
206 Ga0157379_10337272 3300014968 Bacteria 1378
207 Ga0157379_11096169 3300014968 Bacteria 762
208 Ga0157376_10027258 3300014969 Bacteria 4526
209 Ga0157376_10070177 3300014969 Bacteria 2973
210 Ga0157376_10240530 3300014969 Bacteria 1686
211 Ga0157376_10603434 3300014969 Bacteria 1093
212 Ga0157376_10633827 3300014969 Bacteria 1067
213 Ga0157376_10848875 3300014969 Bacteria 928
214 Ga0182006_1016788 3300015261 Bacteria 3120
215 Ga0197907_10891830 3300020069 Bacteria 1763
216 Ga0206351_10345552 3300020077 Bacteria 1240
217 Ga0206352_10817169 3300020078 Bacteria 700
218 Ga0206354_10417735 3300020081 Bacteria 1024
219 Ga0206353_11010918 3300020082 Bacteria 1489
220 Ga0206353_11851917 3300020082 Bacteria 2039
221 Ga0209646_1002458 3300025246 Bacteria 4091
222 Ga0209026_1000191 3300025250 Bacteria 88578
223 Ga0209759_1015071 3300025256 Bacteria 2011
224 Ga0209455_1000254 3300025272 Bacteria 62595
225 Ga0207697_10028515 3300025315 Bacteria 2283
226 Ga0207656_10204503 3300025321 Bacteria 955
227 Ga0207682_10000698 3300025893 Bacteria 15545
228 Ga0207642_10015259 3300025899 Bacteria 2858
229 Ga0207642_10166560 3300025899 Bacteria 1188
230 Ga0207688_10034384 3300025901 Bacteria 2807
231 Ga0207680_10322244 3300025903 Bacteria 1081
232 Ga0207680_10622650 3300025903 Bacteria 772
233 Ga0207647_10001470 3300025904 Bacteria 18101
234 Ga0207647_10003895 3300025904 Bacteria 11149
235 Ga0207699_10320359 3300025906 Bacteria 1087
236 Ga0207705_10000087 3300025909 Bacteria 114441
237 Ga0207705_10001012 3300025909 Bacteria 22856
238 Ga0207705_10005258 3300025909 Bacteria 9700
239 Ga0207705_10044574 3300025909 Bacteria 3187
240 Ga0207705_10461998 3300025909 Bacteria 985
241 Ga0207654_10002688 3300025911 Bacteria 9030
242 Ga0207654_10587387 3300025911 Bacteria 794
243 Ga0207654_10741112 3300025911 Bacteria 707
244 Ga0207707_10000389 3300025912 Bacteria 45856
245 Ga0207707_10001714 3300025912 Bacteria 20166
246 Ga0207707_10075083 3300025912 Bacteria 2949
247 Ga0207707_10397856 3300025912 Bacteria 1183
248 Ga0207695_10000859 3300025913 Bacteria 55564
249 Ga0207695_10004333 3300025913 Bacteria 19435
250 Ga0207671_10003290 3300025914 Bacteria 16258
251 Ga0207671_10118045 3300025914 Bacteria 2025
252 Ga0207663_10317038 3300025916 Bacteria 1170
253 Ga0207660_10001751 3300025917 Bacteria 14544
254 Ga0207660_10157471 3300025917 Bacteria 1749
255 Ga0207662_10115824 3300025918 Bacteria 1675
256 Ga0207662_10712632 3300025918 Bacteria 704
257 Ga0207657_10007522 3300025919 Bacteria 11165
258 Ga0207657_10007728 3300025919 Bacteria 10979
259 Ga0207657_10262140 3300025919 Bacteria 1375
260 Ga0207649_10000488 3300025920 Bacteria 28138
261 Ga0207649_10110506 3300025920 Bacteria 1835
262 Ga0207649_10166551 3300025920 Bacteria 1531
263 Ga0207652_10000072 3300025921 Bacteria 109080
264 Ga0207652_10000418 3300025921 Bacteria 44135
265 Ga0207652_10025724 3300025921 Bacteria 4896
266 Ga0207652_10292771 3300025921 Bacteria 1469
267 Ga0207652_10418761 3300025921 Bacteria 1208
268 Ga0207681_10297090 3300025923 Bacteria 1277
269 Ga0207694_10003183 3300025924 Bacteria 13094
270 Ga0207694_10043783 3300025924 Bacteria 3455
271 Ga0207694_10074869 3300025924 Bacteria 2650
272 Ga0207650_10044940 3300025925 Bacteria 3248
273 Ga0207659_10312564 3300025926 Bacteria 1294
274 Ga0207664_10000030 3300025929 Bacteria 179903
275 Ga0207644_10049464 3300025931 Bacteria 3010
276 Ga0207644_10905835 3300025931 Bacteria 739
277 Ga0207690_10001212 3300025932 Bacteria 16290
278 Ga0207690_10002243 3300025932 Bacteria 11801
279 Ga0207690_10003044 3300025932 Bacteria 10099
280 Ga0207690_10003181 3300025932 Bacteria 9861
281 Ga0207690_10029894 3300025932 Bacteria 3468
282 Ga0207690_10203738 3300025932 Bacteria 1504
283 Ga0207690_10782882 3300025932 Bacteria 788
284 Ga0207706_10011045 3300025933 Bacteria 8230
285 Ga0207706_10012233 3300025933 Bacteria 7820
286 Ga0207670_10600569 3300025936 Bacteria 904
287 Ga0207669_10263006 3300025937 Bacteria 1291
288 Ga0207669_10305876 3300025937 Bacteria 1210
289 Ga0207691_10002909 3300025940 Bacteria 16703
290 Ga0207691_10090040 3300025940 Bacteria 2751
291 Ga0207691_10131865 3300025940 Bacteria 2206
292 Ga0207711_10179105 3300025941 Bacteria 1926
293 Ga0207689_10533670 3300025942 Bacteria 985
294 Ga0207661_10001043 3300025944 Bacteria 18426
295 Ga0207661_10072020 3300025944 Bacteria 2826
296 Ga0207679_10783622 3300025945 Bacteria 868
297 Ga0207679_10848392 3300025945 Bacteria 834
298 Ga0207667_10002947 3300025949 Bacteria 21120
299 Ga0207667_10005890 3300025949 Bacteria 14928
300 Ga0207667_10069645 3300025949 Bacteria 3662
301 Ga0207651_10410680 3300025960 Bacteria 1153
302 Ga0207651_10772673 3300025960 Bacteria 850
303 Ga0207651_11266891 3300025960 Bacteria 662
304 Ga0207668_10009932 3300025972 Bacteria 5724
305 Ga0207640_10000318 3300025981 Bacteria 32231
306 Ga0207677_10088512 3300026023 Bacteria 2245
307 Ga0207639_10000702 3300026041 Bacteria 22962
308 Ga0207639_10023502 3300026041 Bacteria 4452
309 Ga0207639_10058612 3300026041 Bacteria 2963
310 Ga0207639_10445995 3300026041 Bacteria 1174
311 Ga0207639_10617976 3300026041 Bacteria 1000
312 Ga0207639_10675673 3300026041 Bacteria 957
313 Ga0207639_10853154 3300026041 Bacteria 850
314 Ga0207678_10002600 3300026067 Bacteria 16445
315 Ga0207678_10003732 3300026067 Bacteria 13700
316 Ga0207678_10003991 3300026067 Bacteria 13275
317 Ga0207702_10017644 3300026078 Bacteria 5906
318 Ga0207702_10051560 3300026078 Bacteria 3478
319 Ga0207702_10650531 3300026078 Bacteria 1037
320 Ga0207702_10667831 3300026078 Bacteria 1023
321 Ga0207641_10048240 3300026088 Bacteria 3594
322 Ga0207641_10909023 3300026088 Bacteria 874
323 Ga0207648_10027506 3300026089 Bacteria 5048
324 Ga0207648_10652961 3300026089 Bacteria 972
325 Ga0207676_10057020 3300026095 Bacteria 3075
326 Ga0207676_10251675 3300026095 Bacteria 1590
327 Ga0207674_10015162 3300026116 Bacteria 8481
328 Ga0207674_10033350 3300026116 Bacteria 5392
329 Ga0207674_10180112 3300026116 Bacteria 2065
330 Ga0207674_10293846 3300026116 Bacteria 1573
331 Ga0207675_100031005 3300026118 Bacteria 4979
332 Ga0207683_10027254 3300026121 Bacteria 4937
333 Ga0207683_10099625 3300026121 Bacteria 2594
334 Ga0207683_10335066 3300026121 Bacteria 1387
335 Ga0207683_11159051 3300026121 Bacteria 717
336 Ga0207698_10000056 3300026142 Bacteria 80605
337 Ga0207698_10085773 3300026142 Bacteria 2558
338 Ga0207698_10359953 3300026142 Bacteria 1377
339 Ga0209995_1022238 3300027471 Bacteria 1052
340 Ga0209982_1003417 3300027552 Bacteria 2258
341 Ga0209970_1040008 3300027614 Bacteria 832
342 Ga0210002_1019676 3300027617 Bacteria 1085
343 Ga0209983_1007180 3300027665 Bacteria 2286
344 Ga0209998_10002040 3300027717 Bacteria 4737
345 Ga0209974_10002282 3300027876 Bacteria 6961
346 Ga0209974_10017167 3300027876 Bacteria 2401
347 Ga0307408_100008900 3300031548 Bacteria 6633
348 Ga0307408_101172619 3300031548 Bacteria 715
349 Ga0307413_10013950 3300031824 Bacteria 4063
350 Ga0307410_10006588 3300031852 Bacteria 6281
351 Ga0307410_10541611 3300031852 Bacteria 963
352 Ga0307406_10017628 3300031901 Bacteria 4160
353 Ga0307406_10423582 3300031901 Bacteria 1061
354 Ga0307407_10003544 3300031903 Bacteria 6436
355 Ga0307407_10206885 3300031903 Bacteria 1319
356 Ga0307407_10407207 3300031903 Bacteria 977
357 Ga0307412_10267223 3300031911 Bacteria 1337
358 Ga0307409_100002989 3300031995 Bacteria 9014
359 Ga0307409_101095423 3300031995 Bacteria 817
360 Ga0307416_100013899 3300032002 Bacteria 5489
361 Ga0307416_100560858 3300032002 Bacteria 1217
362 Ga0307416_100751352 3300032002 Bacteria 1068
363 Ga0307416_101014260 3300032002 Bacteria 933
364 Ga0307416_101225211 3300032002 Bacteria 856
365 Ga0307414_10023504 3300032004 Bacteria 3911
366 Ga0307414_11083210 3300032004 Bacteria 739
367 Ga0307411_10027766 3300032005 Bacteria 3430
368 Ga0307411_10112084 3300032005 Bacteria 1954
369 Ga0307415_100029168 3300032126 Bacteria 3522
370 Ga0307415_101473990 3300032126 Bacteria 650
371 Ga0373936_0270722 3300035113 Bacteria 762
372 Ga0373927_0501027 3300035695 Bacteria 802
373 Ga0373937_0008060 3300036401 Bacteria 9139
374 Ga0395899_0181288 3300037312 Bacteria 1478
375 Ga0395900_0000648 3300037418 Bacteria 46594
376 Ga0395900_0018592 3300037418 Bacteria 7087
377 Ga0395900_0242070 3300037418 Bacteria 1809
378 Ga0395900_0445675 3300037418 Bacteria 1251
379 Ga0395900_0620869 3300037418 Bacteria 1020
380 Ga0395900_1163521 3300037418 Bacteria 687
381 Ga0395898_0057714 3300037466 Bacteria 3781
382 Ga0395898_0069831 3300037466 Bacteria 3397
383 Ga0395898_0663251 3300037466 Bacteria 985
384 Ga0395905_0420309 3300037471 Bacteria 1233
385 Ga0395901_0012767 3300038443 Bacteria 8521
386 Ga0395901_0030757 3300038443 Bacteria 5532
387 Ga0395901_0084784 3300038443 Bacteria 3311
388 Ga0395901_0156609 3300038443 Bacteria 2392
389 Ga0395901_0258576 3300038443 Bacteria 1812
390 Ga0439432_134605 3300042006 Bacteria 728
391 Ga0439450_020222 3300042008 Bacteria 1419
392 Ga0439450_073609 3300042008 Bacteria 841
393 Ga0439464_0102502 3300042439 Bacteria 871
394 Ga0451577_0050191 3300042876 Bacteria 3725
395 Ga0439440_0004579 3300042993 Bacteria 2720
396 Ga0453684_0039427 3300044712 Bacteria 6437
397 Ga0466959_0796989 3300045049 Bacteria 632
398 Ga0451576_0026612 3300045051 Bacteria 6220
399 Ga0451576_0369536 3300045051 Bacteria 1503
400 Ga0495580_0491390 3300046472 Bacteria 820
401 Ga0495664_0024312 3300046477 Bacteria 3520
402 Ga0495594_0397530 3300046499 Bacteria 784
403 Ga0495630_0540455 3300046517 Bacteria 894
404 Ga0495642_0025950 3300046528 Bacteria 2325
405 Ga0495598_0005697 3300046537 Bacteria 2777
406 Ga0495621_0024615 3300046539 Bacteria 2013
407 Ga0495621_0158940 3300046539 Bacteria 893
408 Ga0495645_0069577 3300046543 Bacteria 2541
409 Ga0495645_0302043 3300046543 Bacteria 1045
410 Ga0495656_0001966 3300046615 Bacteria 6777
411 Ga0495668_0067979 3300046616 Bacteria 1960
412 Ga0495647_0033053 3300046681 Bacteria 1932
413 Ga0495684_0349190 3300047471 Bacteria 1050
414 Ga0496104_0000020 3300048907 Bacteria 247296
415 Ga0496105_0000028 3300048908 Bacteria 145917
416 Ga0496106_0078689 3300048909 Bacteria 2531
417 Ga0496107_0697872 3300048910 Bacteria 746
418 Ga0496110_0152213 3300048913 Bacteria 2095
419 Ga0496125_0389351 3300048928 Bacteria 819
420 Ga0501031_0160047 3300049568 Bacteria 1472
421 Ga0501032_0139102 3300049569 Bacteria 1599
422 Ga0501034_0001280 3300049571 Bacteria 33979
423 Ga0501034_0078451 3300049571 Bacteria 3307
424 Ga0501036_0048543 3300049572 Bacteria 3594
425 Ga0501036_0466839 3300049572 Unclassified 1051
426 Ga0501037_0155095 3300049573 Bacteria 1635
427 Ga0501041_0472917 3300049577 Bacteria 796
428 Ga0501046_0160951 3300049580 Bacteria 1688
429 Ga0501047_0111326 3300049581 Bacteria 2620
430 Ga0501070_0046489 3300049586 Bacteria 3609
431 Ga0501070_0092195 3300049586 Bacteria 2507
432 Ga0501071_0239842 3300049587 Bacteria 1367
433 Ga0501073_0005025 3300049589 Bacteria 9918
434 Ga0501074_0014850 3300049590 Bacteria 5662
435 Ga0501076_0041556 3300049592 Bacteria 3618
436 Ga0501077_0350921 3300049593 Bacteria 941
437 Ga0501198_026847 3300049649 Bacteria 943
438 Ga0501201_014520 3300049651 Bacteria 796
439 Ga0501235_043377 3300049669 Bacteria 1032
440 Ga0501243_067839 3300049675 Bacteria 673
441 Ga0501252_020326 3300049682 Bacteria 863
442 Ga0501079_0039714 3300049741 Bacteria 3630
443 Ga0501080_0131259 3300049742 Bacteria 2319
444 Ga0501080_0192401 3300049742 Bacteria 1874
445 Ga0501035_0398880 3300049822 Bacteria 1145
446 Ga0501044_0303582 3300049823 Bacteria 1525
447 nmdc:mga00v17_175094_c1 3300050491 Bacteria 1384
448 nmdc:mga0yw44_4335_c1 3300050492 Bacteria 6483
449 nmdc:mga0k408_24267_c1 3300050493 Bacteria 3427
450 nmdc:mga06z11_323223_c1 3300050494 Bacteria 921
451 nmdc:mga07m45_185353_c1 3300050496 Bacteria 1210
452 nmdc:mga05p37_642327_c1 3300050507 Bacteria 1190
453 nmdc:mga09592_281441_c1 3300050508 Bacteria 1442
454 nmdc:mga06r32_201907_c1 3300050510 Bacteria 1976
455 nmdc:mga08y16_408074_c1 3300050511 Bacteria 1390
456 nmdc:mga08y16_553342_c1 3300050511 Bacteria 1164
457 nmdc:mga0n895_1228359_c1 3300050512 Bacteria 722
458 Ga0500651_0125372 3300053093 Bacteria 1556
459 Ga0500594_0000655 3300053118 Bacteria 7358
460 Ga0501084_0863975 3300054114 Bacteria 761
461 Ga0501082_0641585 3300060353 Bacteria 929
462 Ga0530510_0332154 3300061734 Bacteria 1140

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_1163521 Ga0395900_1163521_10_621 179
2 3300037466 Ga0395898_0663251 Ga0395898_0663251_42_653 179
3 3300037471 Ga0395905_0420309 Ga0395905_0420309_22_633 179
4 iso_pu_bacteria 2512875016 2512930659 186
5 iso_pu_bacteria 2876363079 2876367994 186
6 iso_pu_bacteria 2903448605 2903449755 186
7 iso_pu_bacteria 2903521522 2903526990 186
8 iso_pu_bacteria 2903528002 2903533217 186
9 iso_pu_bacteria 2963644680 2963648567 186
10 iso_pu_bacteria 2968083720 2968083795 186
11 iso_pu_bacteria 637000159 637073649 186
12 3300005455 Ga0070663_100667363 Ga0070663_1006673631 188
13 3300005434 Ga0070709_10258019 Ga0070709_102580192 189
14 3300005435 Ga0070714_100603653 Ga0070714_1006036532 189
15 3300005616 Ga0068852_100255923 Ga0068852_1002559232 189
16 3300009093 Ga0105240_10212093 Ga0105240_102120932 189
17 3300009174 Ga0105241_10010803 Ga0105241_100108035 189
18 3300013104 Ga0157370_10031252 Ga0157370_100312524 189
19 3300013104 Ga0157370_10189546 Ga0157370_101895463 189
20 3300025911 Ga0207654_10002688 Ga0207654_100026885 189
21 3300025942 Ga0207689_10533670 Ga0207689_105336701 189
22 3300026078 Ga0207702_10650531 Ga0207702_106505311 189
23 3300026142 Ga0207698_10359953 Ga0207698_103599532 189
24 3300032002 Ga0307416_100560858 Ga0307416_1005608582 189
25 3300042008 Ga0439450_073609 Ga0439450_073609_90_668 189
26 3300042439 Ga0439464_0102502 Ga0439464_0102502_185_754 189
27 3300042993 Ga0439440_0004579 Ga0439440_0004579_1970_2548 189
28 3300049569 Ga0501032_0139102 Ga0501032_0139102_564_1133 189
29 3300049571 Ga0501034_0001280 Ga0501034_0001280_32236_32805 189
30 3300049572 Ga0501036_0048543 Ga0501036_0048543_1921_2490 189
31 3300049573 Ga0501037_0155095 Ga0501037_0155095_135_704 189
32 3300049580 Ga0501046_0160951 Ga0501046_0160951_55_624 189
33 3300049581 Ga0501047_0111326 Ga0501047_0111326_1175_1744 189
34 3300049586 Ga0501070_0046489 Ga0501070_0046489_2163_2732 189
35 3300049589 Ga0501073_0005025 Ga0501073_0005025_238_807 189
36 3300049590 Ga0501074_0014850 Ga0501074_0014850_3539_4108 189
37 3300049741 Ga0501079_0039714 Ga0501079_0039714_914_1483 189
38 3300049742 Ga0501080_0131259 Ga0501080_0131259_22_624 189
39 3300049742 Ga0501080_0192401 Ga0501080_0192401_1176_1745 189
40 3300049822 Ga0501035_0398880 Ga0501035_0398880_116_685 189
41 3300053093 Ga0500651_0125372 Ga0500651_0125372_601_1170 189
42 3300060353 Ga0501082_0641585 Ga0501082_0641585_22_591 189
43 3300001915 JGI24741J21665_1001160 JGI24741J21665_10011602 190
44 3300001915 JGI24741J21665_1001330 JGI24741J21665_10013302 190
45 3300001979 JGI24740J21852_10000202 JGI24740J21852_1000020214 190
46 3300002705 JGI25156J39149_1018438 JGI25156J39149_10184382 190
47 3300002741 JGI25157J39369_1006909 JGI25157J39369_10069092 190
48 3300003659 JGI25404J52841_10070237 JGI25404J52841_100702371 190
49 3300004803 Ga0058862_12784152 Ga0058862_127841521 190
50 3300005293 Ga0065715_10465578 Ga0065715_104655781 190
51 3300005295 Ga0065707_10475207 Ga0065707_104752071 190
52 3300005327 Ga0070658_10009260 Ga0070658_100092607 190
53 3300005327 Ga0070658_10509219 Ga0070658_105092192 190
54 3300005327 Ga0070658_10616608 Ga0070658_106166081 190
55 3300005327 Ga0070658_10762154 Ga0070658_107621542 190
56 3300005329 Ga0070683_100000254 Ga0070683_10000025423 190
57 3300005329 Ga0070683_101196940 Ga0070683_1011969401 190
58 3300005330 Ga0070690_100030282 Ga0070690_1000302823 190
59 3300005330 Ga0070690_100697045 Ga0070690_1006970451 190
60 3300005331 Ga0070670_100088907 Ga0070670_1000889074 190
61 3300005333 Ga0070677_10142031 Ga0070677_101420312 190
62 3300005335 Ga0070666_10099307 Ga0070666_100993072 190
63 3300005335 Ga0070666_10250992 Ga0070666_102509922 190
64 3300005335 Ga0070666_10697072 Ga0070666_106970722 190
65 3300005336 Ga0070680_100002497 Ga0070680_10000249716 190
66 3300005336 Ga0070680_100214804 Ga0070680_1002148042 190
67 3300005336 Ga0070680_100539787 Ga0070680_1005397872 190
68 3300005337 Ga0070682_100001210 Ga0070682_10000121018 190
69 3300005337 Ga0070682_100060196 Ga0070682_1000601961 190
70 3300005337 Ga0070682_100070723 Ga0070682_1000707232 190
71 3300005337 Ga0070682_100237085 Ga0070682_1002370852 190
72 3300005338 Ga0068868_100406825 Ga0068868_1004068251 190
73 3300005338 Ga0068868_100449600 Ga0068868_1004496002 190
74 3300005339 Ga0070660_100055748 Ga0070660_1000557483 190
75 3300005339 Ga0070660_100231172 Ga0070660_1002311722 190
76 3300005339 Ga0070660_100237886 Ga0070660_1002378862 190
77 3300005339 Ga0070660_100397908 Ga0070660_1003979081 190
78 3300005341 Ga0070691_10019796 Ga0070691_100197962 190
79 3300005341 Ga0070691_10064634 Ga0070691_100646342 190
80 3300005343 Ga0070687_100166333 Ga0070687_1001663331 190
81 3300005344 Ga0070661_100008467 Ga0070661_1000084673 190
82 3300005344 Ga0070661_100008845 Ga0070661_10000884510 190
83 3300005344 Ga0070661_100094254 Ga0070661_1000942542 190
84 3300005347 Ga0070668_100139691 Ga0070668_1001396911 190
85 3300005354 Ga0070675_100129771 Ga0070675_1001297712 190
86 3300005354 Ga0070675_100249263 Ga0070675_1002492632 190
87 3300005355 Ga0070671_100203420 Ga0070671_1002034202 190
88 3300005356 Ga0070674_100147298 Ga0070674_1001472983 190
89 3300005356 Ga0070674_100417404 Ga0070674_1004174042 190
90 3300005364 Ga0070673_100169805 Ga0070673_1001698055 190
91 3300005364 Ga0070673_100358139 Ga0070673_1003581392 190
92 3300005365 Ga0070688_100029070 Ga0070688_1000290701 190
93 3300005366 Ga0070659_100004598 Ga0070659_1000045987 190
94 3300005366 Ga0070659_100019650 Ga0070659_1000196505 190
95 3300005366 Ga0070659_100024181 Ga0070659_1000241814 190
96 3300005366 Ga0070659_100143028 Ga0070659_1001430283 190
97 3300005366 Ga0070659_100146921 Ga0070659_1001469211 190
98 3300005366 Ga0070659_100311412 Ga0070659_1003114121 190
99 3300005366 Ga0070659_100578789 Ga0070659_1005787892 190
100 3300005367 Ga0070667_100285914 Ga0070667_1002859142 190
101 3300005367 Ga0070667_100912396 Ga0070667_1009123961 190
102 3300005434 Ga0070709_10284872 Ga0070709_102848722 190
103 3300005435 Ga0070714_100000055 Ga0070714_10000005576 190
104 3300005438 Ga0070701_10062720 Ga0070701_100627204 190
105 3300005441 Ga0070700_100021191 Ga0070700_1000211912 190
106 3300005444 Ga0070694_100755071 Ga0070694_1007550711 190
107 3300005455 Ga0070663_100006002 Ga0070663_1000060024 190
108 3300005455 Ga0070663_100152955 Ga0070663_1001529552 190
109 3300005455 Ga0070663_100230712 Ga0070663_1002307122 190
110 3300005455 Ga0070663_100618300 Ga0070663_1006183001 190
111 3300005456 Ga0070678_100148262 Ga0070678_1001482622 190
112 3300005456 Ga0070678_101056149 Ga0070678_1010561491 190
113 3300005456 Ga0070678_101154658 Ga0070678_1011546581 190
114 3300005458 Ga0070681_10002073 Ga0070681_1000207316 190
115 3300005458 Ga0070681_10117557 Ga0070681_101175574 190
116 3300005458 Ga0070681_10593700 Ga0070681_105937002 190
117 3300005459 Ga0068867_100014208 Ga0068867_1000142083 190
118 3300005459 Ga0068867_100619834 Ga0068867_1006198342 190
119 3300005466 Ga0070685_10063519 Ga0070685_100635192 190
120 3300005466 Ga0070685_10385769 Ga0070685_103857691 190
121 3300005530 Ga0070679_100000657 Ga0070679_1000006575 190
122 3300005530 Ga0070679_100010956 Ga0070679_1000109569 190
123 3300005530 Ga0070679_100054843 Ga0070679_1000548433 190
124 3300005530 Ga0070679_100354508 Ga0070679_1003545082 190
125 3300005535 Ga0070684_100000388 Ga0070684_10000038818 190
126 3300005535 Ga0070684_100034303 Ga0070684_1000343032 190
127 3300005535 Ga0070684_100171903 Ga0070684_1001719031 190
128 3300005539 Ga0068853_100265686 Ga0068853_1002656862 190
129 3300005539 Ga0068853_100284215 Ga0068853_1002842152 190
130 3300005539 Ga0068853_100433836 Ga0068853_1004338361 190
131 3300005539 Ga0068853_100805817 Ga0068853_1008058171 190
132 3300005539 Ga0068853_101285318 Ga0068853_1012853181 190
133 3300005543 Ga0070672_100042467 Ga0070672_1000424672 190
134 3300005543 Ga0070672_100105350 Ga0070672_1001053503 190
135 3300005544 Ga0070686_100208328 Ga0070686_1002083281 190
136 3300005546 Ga0070696_100001869 Ga0070696_10000186917 190
137 3300005546 Ga0070696_100013230 Ga0070696_1000132307 190
138 3300005547 Ga0070693_100009309 Ga0070693_1000093095 190
139 3300005547 Ga0070693_100038084 Ga0070693_1000380842 190
140 3300005563 Ga0068855_100131146 Ga0068855_1001311462 190
141 3300005563 Ga0068855_100389994 Ga0068855_1003899943 190
142 3300005563 Ga0068855_101125796 Ga0068855_1011257962 190
143 3300005564 Ga0070664_100025397 Ga0070664_1000253975 190
144 3300005564 Ga0070664_100193979 Ga0070664_1001939791 190
145 3300005577 Ga0068857_100026096 Ga0068857_1000260962 190
146 3300005577 Ga0068857_100035213 Ga0068857_1000352135 190
147 3300005577 Ga0068857_100097458 Ga0068857_1000974584 190
148 3300005577 Ga0068857_100418768 Ga0068857_1004187681 190
149 3300005577 Ga0068857_100517926 Ga0068857_1005179262 190
150 3300005578 Ga0068854_100084609 Ga0068854_1000846092 190
151 3300005578 Ga0068854_100457610 Ga0068854_1004576101 190
152 3300005614 Ga0068856_100218897 Ga0068856_1002188973 190
153 3300005614 Ga0068856_100715707 Ga0068856_1007157071 190
154 3300005616 Ga0068852_100060326 Ga0068852_1000603263 190
155 3300005616 Ga0068852_100293898 Ga0068852_1002938983 190
156 3300005617 Ga0068859_100846768 Ga0068859_1008467682 190
157 3300005718 Ga0068866_10014063 Ga0068866_100140633 190
158 3300005719 Ga0068861_100391040 Ga0068861_1003910402 190
159 3300005841 Ga0068863_100071994 Ga0068863_1000719944 190
160 3300005842 Ga0068858_100808869 Ga0068858_1008088692 190
161 3300005983 Ga0081540_1020852 Ga0081540_10208524 190
162 3300006178 Ga0075367_10004088 Ga0075367_100040887 190
163 3300006195 Ga0075366_10016146 Ga0075366_100161465 190
164 3300006237 Ga0097621_100099950 Ga0097621_1000999502 190
165 3300006358 Ga0068871_100005657 Ga0068871_1000056576 190
166 3300006358 Ga0068871_100190869 Ga0068871_1001908694 190
167 3300006844 Ga0075428_100041295 Ga0075428_1000412959 190
168 3300006844 Ga0075428_100724647 Ga0075428_1007246471 190
169 3300006844 Ga0075428_101208001 Ga0075428_1012080011 190
170 3300006847 Ga0075431_100124821 Ga0075431_1001248212 190
171 3300006880 Ga0075429_100054833 Ga0075429_1000548332 190
172 3300006881 Ga0068865_100003452 Ga0068865_1000034525 190
173 3300006881 Ga0068865_100009525 Ga0068865_1000095252 190
174 3300006881 Ga0068865_100072955 Ga0068865_1000729551 190
175 3300006931 Ga0097620_100846816 Ga0097620_1008468162 190
176 3300009093 Ga0105240_10005265 Ga0105240_1000526514 190
177 3300009093 Ga0105240_10251675 Ga0105240_102516752 190
178 3300009093 Ga0105240_10712886 Ga0105240_107128862 190
179 3300009094 Ga0111539_10273344 Ga0111539_102733442 190
180 3300009094 Ga0111539_10428958 Ga0111539_104289582 190
181 3300009098 Ga0105245_10519858 Ga0105245_105198582 190
182 3300009147 Ga0114129_10334822 Ga0114129_103348222 190
183 3300009147 Ga0114129_11444505 Ga0114129_114445051 190
184 3300009148 Ga0105243_11205097 Ga0105243_112050971 190
185 3300009174 Ga0105241_10140369 Ga0105241_101403693 190
186 3300009174 Ga0105241_10371532 Ga0105241_103715322 190
187 3300009176 Ga0105242_10170130 Ga0105242_101701302 190
188 3300009176 Ga0105242_10310994 Ga0105242_103109942 190
189 3300009176 Ga0105242_10494727 Ga0105242_104947271 190
190 3300009177 Ga0105248_10045905 Ga0105248_100459053 190
191 3300009545 Ga0105237_10012614 Ga0105237_100126145 190
192 3300009545 Ga0105237_10195176 Ga0105237_101951762 190
193 3300009551 Ga0105238_10004755 Ga0105238_1000475517 190
194 3300009551 Ga0105238_10051006 Ga0105238_100510065 190
195 3300010375 Ga0105239_10025635 Ga0105239_100256357 190
196 3300010375 Ga0105239_10166896 Ga0105239_101668961 190
197 3300010375 Ga0105239_10494532 Ga0105239_104945322 190
198 3300011119 Ga0105246_11019220 Ga0105246_110192201 190
199 3300012480 Ga0157346_1004119 Ga0157346_10041191 190
200 3300012498 Ga0157345_1007949 Ga0157345_10079491 190
201 3300012500 Ga0157314_1005956 Ga0157314_10059561 190
202 3300013100 Ga0157373_10091253 Ga0157373_100912532 190
203 3300013100 Ga0157373_10121839 Ga0157373_101218392 190
204 3300013102 Ga0157371_10086657 Ga0157371_100866572 190
205 3300013102 Ga0157371_10108338 Ga0157371_101083382 190
206 3300013104 Ga0157370_10002917 Ga0157370_100029172 190
207 3300013104 Ga0157370_10019520 Ga0157370_100195201 190
208 3300013104 Ga0157370_10057980 Ga0157370_100579803 190
209 3300013104 Ga0157370_10058800 Ga0157370_100588004 190
210 3300013104 Ga0157370_10192612 Ga0157370_101926122 190
211 3300013105 Ga0157369_10043031 Ga0157369_100430315 190
212 3300013105 Ga0157369_10105676 Ga0157369_101056762 190
213 3300013105 Ga0157369_10659029 Ga0157369_106590293 190
214 3300013105 Ga0157369_10766748 Ga0157369_107667482 190
215 3300013296 Ga0157374_10382933 Ga0157374_103829332 190
216 3300013306 Ga0163162_10051932 Ga0163162_100519322 190
217 3300013306 Ga0163162_10137974 Ga0163162_101379741 190
218 3300013306 Ga0163162_10155119 Ga0163162_101551192 190
219 3300013306 Ga0163162_10226497 Ga0163162_102264973 190
220 3300013306 Ga0163162_10826839 Ga0163162_108268391 190
221 3300013307 Ga0157372_10027442 Ga0157372_100274429 190
222 3300013307 Ga0157372_10039973 Ga0157372_100399732 190
223 3300013307 Ga0157372_10079596 Ga0157372_100795963 190
224 3300013307 Ga0157372_10080562 Ga0157372_100805624 190
225 3300013307 Ga0157372_10084219 Ga0157372_100842192 190
226 3300013307 Ga0157372_10084578 Ga0157372_100845782 190
227 3300013307 Ga0157372_10972635 Ga0157372_109726351 190
228 3300013308 Ga0157375_10000515 Ga0157375_1000051532 190
229 3300013308 Ga0157375_10122265 Ga0157375_101222653 190
230 3300013308 Ga0157375_10129493 Ga0157375_101294933 190
231 3300013308 Ga0157375_10260294 Ga0157375_102602941 190
232 3300013308 Ga0157375_10344393 Ga0157375_103443932 190
233 3300013308 Ga0157375_10818340 Ga0157375_108183401 190
234 3300014325 Ga0163163_10005444 Ga0163163_1000544412 190
235 3300014325 Ga0163163_10235613 Ga0163163_102356131 190
236 3300014326 Ga0157380_10112106 Ga0157380_101121063 190
237 3300014326 Ga0157380_10212156 Ga0157380_102121561 190
238 3300014326 Ga0157380_10432841 Ga0157380_104328412 190
239 3300014497 Ga0182008_10048342 Ga0182008_100483423 190
240 3300014968 Ga0157379_10337272 Ga0157379_103372722 190
241 3300014968 Ga0157379_11096169 Ga0157379_110961691 190
242 3300014969 Ga0157376_10027258 Ga0157376_100272583 190
243 3300014969 Ga0157376_10070177 Ga0157376_100701772 190
244 3300014969 Ga0157376_10240530 Ga0157376_102405301 190
245 3300014969 Ga0157376_10603434 Ga0157376_106034342 190
246 3300014969 Ga0157376_10633827 Ga0157376_106338271 190
247 3300014969 Ga0157376_10848875 Ga0157376_108488751 190
248 3300015261 Ga0182006_1016788 Ga0182006_10167881 190
249 3300020069 Ga0197907_10891830 Ga0197907_108918301 190
250 3300020077 Ga0206351_10345552 Ga0206351_103455522 190
251 3300020078 Ga0206352_10817169 Ga0206352_108171691 190
252 3300020081 Ga0206354_10417735 Ga0206354_104177352 190
253 3300020082 Ga0206353_11010918 Ga0206353_110109182 190
254 3300020082 Ga0206353_11851917 Ga0206353_118519171 190
255 3300025246 Ga0209646_1002458 Ga0209646_10024584 190
256 3300025250 Ga0209026_1000191 Ga0209026_10001918 190
257 3300025256 Ga0209759_1015071 Ga0209759_10150712 190
258 3300025272 Ga0209455_1000254 Ga0209455_100025445 190
259 3300025315 Ga0207697_10028515 Ga0207697_100285154 190
260 3300025321 Ga0207656_10204503 Ga0207656_102045033 190
261 3300025893 Ga0207682_10000698 Ga0207682_100006981 190
262 3300025899 Ga0207642_10015259 Ga0207642_100152593 190
263 3300025899 Ga0207642_10166560 Ga0207642_101665601 190
264 3300025901 Ga0207688_10034384 Ga0207688_100343842 190
265 3300025903 Ga0207680_10322244 Ga0207680_103222442 190
266 3300025903 Ga0207680_10622650 Ga0207680_106226501 190
267 3300025904 Ga0207647_10001470 Ga0207647_100014706 190
268 3300025904 Ga0207647_10003895 Ga0207647_1000389510 190
269 3300025906 Ga0207699_10320359 Ga0207699_103203591 190
270 3300025909 Ga0207705_10000087 Ga0207705_1000008767 190
271 3300025909 Ga0207705_10001012 Ga0207705_100010122 190
272 3300025909 Ga0207705_10005258 Ga0207705_100052581 190
273 3300025909 Ga0207705_10044574 Ga0207705_100445742 190
274 3300025909 Ga0207705_10461998 Ga0207705_104619982 190
275 3300025911 Ga0207654_10587387 Ga0207654_105873872 190
276 3300025911 Ga0207654_10741112 Ga0207654_107411121 190
277 3300025912 Ga0207707_10000389 Ga0207707_1000038930 190
278 3300025912 Ga0207707_10001714 Ga0207707_1000171410 190
279 3300025912 Ga0207707_10075083 Ga0207707_100750832 190
280 3300025912 Ga0207707_10397856 Ga0207707_103978562 190
281 3300025913 Ga0207695_10000859 Ga0207695_1000085920 190
282 3300025913 Ga0207695_10004333 Ga0207695_1000433314 190
283 3300025914 Ga0207671_10003290 Ga0207671_100032905 190
284 3300025914 Ga0207671_10118045 Ga0207671_101180452 190
285 3300025916 Ga0207663_10317038 Ga0207663_103170382 190
286 3300025917 Ga0207660_10001751 Ga0207660_100017515 190
287 3300025917 Ga0207660_10157471 Ga0207660_101574712 190
288 3300025918 Ga0207662_10115824 Ga0207662_101158242 190
289 3300025918 Ga0207662_10712632 Ga0207662_107126321 190
290 3300025919 Ga0207657_10007522 Ga0207657_100075224 190
291 3300025919 Ga0207657_10007728 Ga0207657_100077285 190
292 3300025919 Ga0207657_10262140 Ga0207657_102621402 190
293 3300025920 Ga0207649_10000488 Ga0207649_1000048820 190
294 3300025920 Ga0207649_10110506 Ga0207649_101105063 190
295 3300025920 Ga0207649_10166551 Ga0207649_101665512 190
296 3300025921 Ga0207652_10000072 Ga0207652_1000007216 190
297 3300025921 Ga0207652_10000418 Ga0207652_100004182 190
298 3300025921 Ga0207652_10025724 Ga0207652_100257244 190
299 3300025921 Ga0207652_10292771 Ga0207652_102927712 190
300 3300025921 Ga0207652_10418761 Ga0207652_104187611 190
301 3300025923 Ga0207681_10297090 Ga0207681_102970902 190
302 3300025924 Ga0207694_10003183 Ga0207694_1000318311 190
303 3300025924 Ga0207694_10043783 Ga0207694_100437836 190
304 3300025924 Ga0207694_10074869 Ga0207694_100748692 190
305 3300025925 Ga0207650_10044940 Ga0207650_100449403 190
306 3300025926 Ga0207659_10312564 Ga0207659_103125642 190
307 3300025929 Ga0207664_10000030 Ga0207664_10000030100 190
308 3300025931 Ga0207644_10049464 Ga0207644_100494644 190
309 3300025931 Ga0207644_10905835 Ga0207644_109058351 190
310 3300025932 Ga0207690_10001212 Ga0207690_100012124 190
311 3300025932 Ga0207690_10002243 Ga0207690_1000224313 190
312 3300025932 Ga0207690_10003044 Ga0207690_100030444 190
313 3300025932 Ga0207690_10003181 Ga0207690_100031812 190
314 3300025932 Ga0207690_10029894 Ga0207690_100298944 190
315 3300025932 Ga0207690_10203738 Ga0207690_102037381 190
316 3300025932 Ga0207690_10782882 Ga0207690_107828821 190
317 3300025933 Ga0207706_10011045 Ga0207706_100110455 190
318 3300025933 Ga0207706_10012233 Ga0207706_100122333 190
319 3300025936 Ga0207670_10600569 Ga0207670_106005692 190
320 3300025937 Ga0207669_10263006 Ga0207669_102630061 190
321 3300025937 Ga0207669_10305876 Ga0207669_103058761 190
322 3300025940 Ga0207691_10002909 Ga0207691_100029099 190
323 3300025940 Ga0207691_10090040 Ga0207691_100900402 190
324 3300025940 Ga0207691_10131865 Ga0207691_101318654 190
325 3300025941 Ga0207711_10179105 Ga0207711_101791052 190
326 3300025944 Ga0207661_10001043 Ga0207661_100010432 190
327 3300025944 Ga0207661_10072020 Ga0207661_100720206 190
328 3300025945 Ga0207679_10783622 Ga0207679_107836221 190
329 3300025945 Ga0207679_10848392 Ga0207679_108483922 190
330 3300025949 Ga0207667_10002947 Ga0207667_100029474 190
331 3300025949 Ga0207667_10005890 Ga0207667_100058902 190
332 3300025949 Ga0207667_10069645 Ga0207667_100696452 190
333 3300025960 Ga0207651_10410680 Ga0207651_104106801 190
334 3300025960 Ga0207651_10772673 Ga0207651_107726732 190
335 3300025960 Ga0207651_11266891 Ga0207651_112668911 190
336 3300025972 Ga0207668_10009932 Ga0207668_100099324 190
337 3300025981 Ga0207640_10000318 Ga0207640_1000031817 190
338 3300026023 Ga0207677_10088512 Ga0207677_100885122 190
339 3300026041 Ga0207639_10000702 Ga0207639_1000070214 190
340 3300026041 Ga0207639_10023502 Ga0207639_100235022 190
341 3300026041 Ga0207639_10058612 Ga0207639_100586124 190
342 3300026041 Ga0207639_10445995 Ga0207639_104459951 190
343 3300026041 Ga0207639_10617976 Ga0207639_106179761 190
344 3300026041 Ga0207639_10675673 Ga0207639_106756732 190
345 3300026041 Ga0207639_10853154 Ga0207639_108531541 190
346 3300026067 Ga0207678_10002600 Ga0207678_1000260011 190
347 3300026067 Ga0207678_10003732 Ga0207678_100037325 190
348 3300026067 Ga0207678_10003991 Ga0207678_100039911 190
349 3300026078 Ga0207702_10017644 Ga0207702_100176445 190
350 3300026078 Ga0207702_10051560 Ga0207702_100515601 190
351 3300026078 Ga0207702_10667831 Ga0207702_106678311 190
352 3300026088 Ga0207641_10048240 Ga0207641_100482402 190
353 3300026088 Ga0207641_10909023 Ga0207641_109090231 190
354 3300026089 Ga0207648_10027506 Ga0207648_100275062 190
355 3300026089 Ga0207648_10652961 Ga0207648_106529611 190
356 3300026095 Ga0207676_10057020 Ga0207676_100570203 190
357 3300026095 Ga0207676_10251675 Ga0207676_102516751 190
358 3300026116 Ga0207674_10015162 Ga0207674_1001516211 190
359 3300026116 Ga0207674_10033350 Ga0207674_100333502 190
360 3300026116 Ga0207674_10180112 Ga0207674_101801123 190
361 3300026116 Ga0207674_10293846 Ga0207674_102938461 190
362 3300026118 Ga0207675_100031005 Ga0207675_1000310054 190
363 3300026121 Ga0207683_10027254 Ga0207683_100272545 190
364 3300026121 Ga0207683_10099625 Ga0207683_100996251 190
365 3300026121 Ga0207683_10335066 Ga0207683_103350661 190
366 3300026121 Ga0207683_11159051 Ga0207683_111590511 190
367 3300026142 Ga0207698_10000056 Ga0207698_1000005622 190
368 3300026142 Ga0207698_10085773 Ga0207698_100857733 190
369 3300027471 Ga0209995_1022238 Ga0209995_10222382 190
370 3300027552 Ga0209982_1003417 Ga0209982_10034172 190
371 3300027614 Ga0209970_1040008 Ga0209970_10400081 190
372 3300027617 Ga0210002_1019676 Ga0210002_10196761 190
373 3300027665 Ga0209983_1007180 Ga0209983_10071802 190
374 3300027717 Ga0209998_10002040 Ga0209998_100020405 190
375 3300027876 Ga0209974_10002282 Ga0209974_100022826 190
376 3300027876 Ga0209974_10017167 Ga0209974_100171673 190
377 3300031548 Ga0307408_100008900 Ga0307408_1000089002 190
378 3300031548 Ga0307408_101172619 Ga0307408_1011726191 190
379 3300031824 Ga0307413_10013950 Ga0307413_100139503 190
380 3300031852 Ga0307410_10006588 Ga0307410_100065882 190
381 3300031852 Ga0307410_10541611 Ga0307410_105416111 190
382 3300031901 Ga0307406_10017628 Ga0307406_100176283 190
383 3300031901 Ga0307406_10423582 Ga0307406_104235821 190
384 3300031903 Ga0307407_10003544 Ga0307407_100035445 190
385 3300031903 Ga0307407_10206885 Ga0307407_102068851 190
386 3300031903 Ga0307407_10407207 Ga0307407_104072072 190
387 3300031911 Ga0307412_10267223 Ga0307412_102672232 190
388 3300031995 Ga0307409_100002989 Ga0307409_1000029898 190
389 3300031995 Ga0307409_101095423 Ga0307409_1010954231 190
390 3300032002 Ga0307416_100013899 Ga0307416_1000138991 190
391 3300032002 Ga0307416_100751352 Ga0307416_1007513522 190
392 3300032002 Ga0307416_101014260 Ga0307416_1010142602 190
393 3300032002 Ga0307416_101225211 Ga0307416_1012252111 190
394 3300032004 Ga0307414_10023504 Ga0307414_100235042 190
395 3300032004 Ga0307414_11083210 Ga0307414_110832101 190
396 3300032005 Ga0307411_10027766 Ga0307411_100277662 190
397 3300032005 Ga0307411_10112084 Ga0307411_101120842 190
398 3300032126 Ga0307415_100029168 Ga0307415_1000291682 190
399 3300032126 Ga0307415_101473990 Ga0307415_1014739901 190
400 3300035113 Ga0373936_0270722 Ga0373936_0270722_57_674 190
401 3300035695 Ga0373927_0501027 Ga0373927_0501027_101_673 190
402 3300036401 Ga0373937_0008060 Ga0373937_0008060_5873_6490 190
403 3300037312 Ga0395899_0181288 Ga0395899_0181288_765_1337 190
404 3300037418 Ga0395900_0000648 Ga0395900_0000648_19731_20306 190
405 3300037418 Ga0395900_0018592 Ga0395900_0018592_4329_4901 190
406 3300037418 Ga0395900_0242070 Ga0395900_0242070_1215_1787 190
407 3300037418 Ga0395900_0445675 Ga0395900_0445675_417_989 190
408 3300037418 Ga0395900_0620869 Ga0395900_0620869_95_754 190
409 3300037466 Ga0395898_0057714 Ga0395898_0057714_453_1028 190
410 3300037466 Ga0395898_0069831 Ga0395898_0069831_2544_3116 190
411 3300038443 Ga0395901_0012767 Ga0395901_0012767_7531_8106 190
412 3300038443 Ga0395901_0030757 Ga0395901_0030757_2368_2940 190
413 3300038443 Ga0395901_0084784 Ga0395901_0084784_143_715 190
414 3300038443 Ga0395901_0156609 Ga0395901_0156609_1303_1875 190
415 3300038443 Ga0395901_0258576 Ga0395901_0258576_1215_1787 190
416 3300042006 Ga0439432_134605 Ga0439432_134605_74_649 190
417 3300042008 Ga0439450_020222 Ga0439450_020222_351_923 190
418 3300042876 Ga0451577_0050191 Ga0451577_0050191_3129_3701 190
419 3300044712 Ga0453684_0039427 Ga0453684_0039427_2989_3561 190
420 3300045049 Ga0466959_0796989 Ga0466959_0796989_29_604 190
421 3300045051 Ga0451576_0026612 Ga0451576_0026612_291_863 190
422 3300045051 Ga0451576_0369536 Ga0451576_0369536_845_1417 190
423 3300046472 Ga0495580_0491390 Ga0495580_0491390_71_688 190
424 3300046477 Ga0495664_0024312 Ga0495664_0024312_2738_3310 190
425 3300046499 Ga0495594_0397530 Ga0495594_0397530_110_682 190
426 3300046517 Ga0495630_0540455 Ga0495630_0540455_82_699 190
427 3300046528 Ga0495642_0025950 Ga0495642_0025950_311_883 190
428 3300046537 Ga0495598_0005697 Ga0495598_0005697_344_919 190
429 3300046539 Ga0495621_0024615 Ga0495621_0024615_260_841 190
430 3300046539 Ga0495621_0158940 Ga0495621_0158940_244_816 190
431 3300046543 Ga0495645_0069577 Ga0495645_0069577_438_1010 190
432 3300046543 Ga0495645_0302043 Ga0495645_0302043_268_885 190
433 3300046615 Ga0495656_0001966 Ga0495656_0001966_5239_5811 190
434 3300046616 Ga0495668_0067979 Ga0495668_0067979_800_1375 190
435 3300046681 Ga0495647_0033053 Ga0495647_0033053_244_861 190
436 3300047471 Ga0495684_0349190 Ga0495684_0349190_129_746 190
437 3300048907 Ga0496104_0000020 Ga0496104_0000020_195959_196531 190
438 3300048908 Ga0496105_0000028 Ga0496105_0000028_128221_128793 190
439 3300048909 Ga0496106_0078689 Ga0496106_0078689_350_922 190
440 3300048910 Ga0496107_0697872 Ga0496107_0697872_63_635 190
441 3300048913 Ga0496110_0152213 Ga0496110_0152213_140_712 190
442 3300048928 Ga0496125_0389351 Ga0496125_0389351_138_782 190
443 3300049568 Ga0501031_0160047 Ga0501031_0160047_91_663 190
444 3300049571 Ga0501034_0078451 Ga0501034_0078451_2398_2970 190
445 3300049572 Ga0501036_0466839 Ga0501036_0466839_208_780 190
446 3300049577 Ga0501041_0472917 Ga0501041_0472917_133_756 190
447 3300049586 Ga0501070_0092195 Ga0501070_0092195_179_751 190
448 3300049587 Ga0501071_0239842 Ga0501071_0239842_371_994 190
449 3300049592 Ga0501076_0041556 Ga0501076_0041556_2890_3513 190
450 3300049593 Ga0501077_0350921 Ga0501077_0350921_180_752 190
451 3300049649 Ga0501198_026847 Ga0501198_026847_294_869 190
452 3300049651 Ga0501201_014520 Ga0501201_014520_31_606 190
453 3300049669 Ga0501235_043377 Ga0501235_043377_20_595 190
454 3300049675 Ga0501243_067839 Ga0501243_067839_20_595 190
455 3300049682 Ga0501252_020326 Ga0501252_020326_45_620 190
456 3300049823 Ga0501044_0303582 Ga0501044_0303582_905_1477 190
457 3300050491 nmdc:mga00v17_175094_c1 nmdc:mga00v17_175094_c1_371_946 190
458 3300050492 nmdc:mga0yw44_4335_c1 nmdc:mga0yw44_4335_c1_306_878 190
459 3300050493 nmdc:mga0k408_24267_c1 nmdc:mga0k408_24267_c1_285_860 190
460 3300050494 nmdc:mga06z11_323223_c1 nmdc:mga06z11_323223_c1_56_631 190
461 3300050496 nmdc:mga07m45_185353_c1 nmdc:mga07m45_185353_c1_233_811 190
462 3300050507 nmdc:mga05p37_642327_c1 nmdc:mga05p37_642327_c1_309_881 190
463 3300050508 nmdc:mga09592_281441_c1 nmdc:mga09592_281441_c1_558_1133 190
464 3300050510 nmdc:mga06r32_201907_c1 nmdc:mga06r32_201907_c1_1131_1703 190
465 3300050511 nmdc:mga08y16_408074_c1 nmdc:mga08y16_408074_c1_326_898 190
466 3300050511 nmdc:mga08y16_553342_c1 nmdc:mga08y16_553342_c1_23_595 190
467 3300050512 nmdc:mga0n895_1228359_c1 nmdc:mga0n895_1228359_c1_23_595 190
468 3300053118 Ga0500594_0000655 Ga0500594_0000655_3003_3575 190
469 3300054114 Ga0501084_0863975 Ga0501084_0863975_163_744 190
470 3300061734 Ga0530510_0332154 Ga0530510_0332154_175_798 190

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

46

193

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u7r-assembly1.cif.gz_A ferb - flavoenzyme nad(p)h:(acceptor) oxidoreductase (ferb) from paracoccus denitrificans 0.8662 3 184
1x77-assembly1.cif.gz_B crystal structure of a nad(p)h-dependent fmn reductase complexed with fmn 0.8621 5 176
4hs4-assembly1.cif.gz_G-1 crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a y129n substitution. 0.8594 2 182
4h6p-assembly1.cif.gz_A crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a r101a substitution. 0.8584 2 182
3u7r-assembly1.cif.gz_A ferb - flavoenzyme nad(p)h:(acceptor) oxidoreductase (ferb) from paracoccus denitrificans 0.8486 3 184
ID Description Score Start End Superfamily
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8621 5 176 3.40.50.360
3u7rB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8605 3 184 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8485 5 176 3.40.50.360
3u7rB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8425 3 184 3.40.50.360
3svlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8395 3 179 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A0M3GD83-F1-model_v4 deleted 0.9385 1 184
AF-A0A544XEI9-F1-model_v4 deleted 0.9355 1 186
AF-A0A3S1RJN2-F1-model_v4 deleted 0.9349 1 176
AF-A0A848QE11-F1-model_v4 deleted 0.9309 1 114
AF-A0A3S1RJN2-F1-model_v4 deleted 0.9298 1 176

Feature Viewer

pLDDT pTM Quality
87.09 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map