F450363
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 470 | 252 | 462 | 191 |
Family's Representative Sequence
| Representative Sequence | 3300005354|Ga0070675_100129771|Ga0070675_1001297712 |
| Length | 232 |
| Sequence | MASHCALSMQYHGRRVDYPGGVFCLADKVQRPEPPKQPKDAVMTTYKVGYFVGSLSSTSINRLLAKAMARLAPPDLVLSEIQIRDLPLYSQDYDADFPPVARAFKQCIADVDAVLFVTPEFNRSIPGGLKNAIDWASRPWGKNSFTRKPSAVIGASPGPIGTALAQQSLRGVLCFCNSPLMNMVEAYIHFKPGLITAEGEVTDERTQEFLRNYLTELHAFIVRVLTVLPRDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 2 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 3 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 4 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 5 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 6 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 7 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 8 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 9 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 10 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 11 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 12 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 13 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 88 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 89 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 110 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 111 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 112 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 170 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 171 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 172 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 173 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 180 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 184 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 185 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 186 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 189 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 190 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 191 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 192 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 193 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 194 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 195 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 196 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 209 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 210 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 211 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 212 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 213 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 214 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 229 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 230 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 231 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 232 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 233 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 238 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 239 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 240 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 241 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 242 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 248 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 249 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 252 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.81 |
| Metatranscriptomes | 1.49 |
| Isolates | 1.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.13 |
| Nodule | 1.28 |
| Rhizoplane | 1.06 |
| Rhizosphere | 93.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1001160 | 3300001915 | Bacteria | 7779 |
| 2 | JGI24741J21665_1001330 | 3300001915 | Bacteria | 7202 |
| 3 | JGI24740J21852_10000202 | 3300001979 | Bacteria | 24620 |
| 4 | JGI25156J39149_1018438 | 3300002705 | Bacteria | 1289 |
| 5 | JGI25157J39369_1006909 | 3300002741 | Bacteria | 1683 |
| 6 | JGI25404J52841_10070237 | 3300003659 | Bacteria | 732 |
| 7 | Ga0058862_12784152 | 3300004803 | Bacteria | 950 |
| 8 | Ga0065715_10465578 | 3300005293 | Bacteria | 811 |
| 9 | Ga0065707_10475207 | 3300005295 | Bacteria | 778 |
| 10 | Ga0070658_10009260 | 3300005327 | Bacteria | 7918 |
| 11 | Ga0070658_10509219 | 3300005327 | Bacteria | 1040 |
| 12 | Ga0070658_10616608 | 3300005327 | Bacteria | 941 |
| 13 | Ga0070658_10762154 | 3300005327 | Bacteria | 840 |
| 14 | Ga0070683_100000254 | 3300005329 | Bacteria | 36669 |
| 15 | Ga0070683_101196940 | 3300005329 | Bacteria | 730 |
| 16 | Ga0070690_100030282 | 3300005330 | Bacteria | 3362 |
| 17 | Ga0070690_100697045 | 3300005330 | Bacteria | 779 |
| 18 | Ga0070670_100088907 | 3300005331 | Bacteria | 2655 |
| 19 | Ga0070677_10142031 | 3300005333 | Bacteria | 1108 |
| 20 | Ga0070666_10099307 | 3300005335 | Bacteria | 2004 |
| 21 | Ga0070666_10250992 | 3300005335 | Bacteria | 1253 |
| 22 | Ga0070666_10697072 | 3300005335 | Bacteria | 745 |
| 23 | Ga0070680_100002497 | 3300005336 | Bacteria | 13632 |
| 24 | Ga0070680_100214804 | 3300005336 | Bacteria | 1623 |
| 25 | Ga0070680_100539787 | 3300005336 | Bacteria | 999 |
| 26 | Ga0070682_100001210 | 3300005337 | Bacteria | 14716 |
| 27 | Ga0070682_100060196 | 3300005337 | Bacteria | 2401 |
| 28 | Ga0070682_100070723 | 3300005337 | Bacteria | 2231 |
| 29 | Ga0070682_100237085 | 3300005337 | Bacteria | 1308 |
| 30 | Ga0068868_100406825 | 3300005338 | Bacteria | 1175 |
| 31 | Ga0068868_100449600 | 3300005338 | Bacteria | 1120 |
| 32 | Ga0070660_100055748 | 3300005339 | Bacteria | 3055 |
| 33 | Ga0070660_100231172 | 3300005339 | Bacteria | 1505 |
| 34 | Ga0070660_100237886 | 3300005339 | Bacteria | 1482 |
| 35 | Ga0070660_100397908 | 3300005339 | Bacteria | 1139 |
| 36 | Ga0070691_10019796 | 3300005341 | Bacteria | 3107 |
| 37 | Ga0070691_10064634 | 3300005341 | Bacteria | 1765 |
| 38 | Ga0070687_100166333 | 3300005343 | Bacteria | 1308 |
| 39 | Ga0070661_100008467 | 3300005344 | Bacteria | 7114 |
| 40 | Ga0070661_100008845 | 3300005344 | Bacteria | 6969 |
| 41 | Ga0070661_100094254 | 3300005344 | Bacteria | 2218 |
| 42 | Ga0070668_100139691 | 3300005347 | Bacteria | 1951 |
| 43 | Ga0070675_100129771 | 3300005354 | Bacteria | 2147 |
| 44 | Ga0070675_100249263 | 3300005354 | Bacteria | 1554 |
| 45 | Ga0070671_100203420 | 3300005355 | Bacteria | 1679 |
| 46 | Ga0070674_100147298 | 3300005356 | Bacteria | 1773 |
| 47 | Ga0070674_100417404 | 3300005356 | Bacteria | 1100 |
| 48 | Ga0070673_100169805 | 3300005364 | Bacteria | 1861 |
| 49 | Ga0070673_100358139 | 3300005364 | Bacteria | 1296 |
| 50 | Ga0070688_100029070 | 3300005365 | Bacteria | 3306 |
| 51 | Ga0070659_100004598 | 3300005366 | Bacteria | 9870 |
| 52 | Ga0070659_100019650 | 3300005366 | Bacteria | 5124 |
| 53 | Ga0070659_100024181 | 3300005366 | Bacteria | 4655 |
| 54 | Ga0070659_100143028 | 3300005366 | Bacteria | 1948 |
| 55 | Ga0070659_100146921 | 3300005366 | Bacteria | 1921 |
| 56 | Ga0070659_100311412 | 3300005366 | Bacteria | 1315 |
| 57 | Ga0070659_100578789 | 3300005366 | Bacteria | 963 |
| 58 | Ga0070667_100285914 | 3300005367 | Bacteria | 1482 |
| 59 | Ga0070667_100912396 | 3300005367 | Bacteria | 818 |
| 60 | Ga0070709_10258019 | 3300005434 | Bacteria | 1258 |
| 61 | Ga0070709_10284872 | 3300005434 | Bacteria | 1202 |
| 62 | Ga0070714_100000055 | 3300005435 | Bacteria | 103321 |
| 63 | Ga0070714_100603653 | 3300005435 | Bacteria | 1054 |
| 64 | Ga0070701_10062720 | 3300005438 | Bacteria | 1964 |
| 65 | Ga0070700_100021191 | 3300005441 | Bacteria | 3775 |
| 66 | Ga0070694_100755071 | 3300005444 | Bacteria | 795 |
| 67 | Ga0070663_100006002 | 3300005455 | Bacteria | 7267 |
| 68 | Ga0070663_100152955 | 3300005455 | Bacteria | 1770 |
| 69 | Ga0070663_100230712 | 3300005455 | Bacteria | 1457 |
| 70 | Ga0070663_100618300 | 3300005455 | Bacteria | 913 |
| 71 | Ga0070663_100667363 | 3300005455 | Bacteria | 881 |
| 72 | Ga0070678_100148262 | 3300005456 | Bacteria | 1886 |
| 73 | Ga0070678_101056149 | 3300005456 | Bacteria | 748 |
| 74 | Ga0070678_101154658 | 3300005456 | Bacteria | 717 |
| 75 | Ga0070681_10002073 | 3300005458 | Bacteria | 18195 |
| 76 | Ga0070681_10117557 | 3300005458 | Bacteria | 2595 |
| 77 | Ga0070681_10593700 | 3300005458 | Bacteria | 1022 |
| 78 | Ga0068867_100014208 | 3300005459 | Bacteria | 5639 |
| 79 | Ga0068867_100619834 | 3300005459 | Bacteria | 946 |
| 80 | Ga0070685_10063519 | 3300005466 | Bacteria | 2169 |
| 81 | Ga0070685_10385769 | 3300005466 | Bacteria | 966 |
| 82 | Ga0070679_100000657 | 3300005530 | Bacteria | 29456 |
| 83 | Ga0070679_100010956 | 3300005530 | Bacteria | 8615 |
| 84 | Ga0070679_100054843 | 3300005530 | Bacteria | 3969 |
| 85 | Ga0070679_100354508 | 3300005530 | Bacteria | 1415 |
| 86 | Ga0070684_100000388 | 3300005535 | Bacteria | 30506 |
| 87 | Ga0070684_100034303 | 3300005535 | Bacteria | 4338 |
| 88 | Ga0070684_100171903 | 3300005535 | Bacteria | 1968 |
| 89 | Ga0068853_100265686 | 3300005539 | Bacteria | 1579 |
| 90 | Ga0068853_100284215 | 3300005539 | Bacteria | 1525 |
| 91 | Ga0068853_100433836 | 3300005539 | Bacteria | 1234 |
| 92 | Ga0068853_100805817 | 3300005539 | Bacteria | 899 |
| 93 | Ga0068853_101285318 | 3300005539 | Bacteria | 707 |
| 94 | Ga0070672_100042467 | 3300005543 | Bacteria | 3501 |
| 95 | Ga0070672_100105350 | 3300005543 | Bacteria | 2293 |
| 96 | Ga0070686_100208328 | 3300005544 | Bacteria | 1406 |
| 97 | Ga0070696_100001869 | 3300005546 | Bacteria | 13807 |
| 98 | Ga0070696_100013230 | 3300005546 | Bacteria | 5537 |
| 99 | Ga0070693_100009309 | 3300005547 | Bacteria | 4881 |
| 100 | Ga0070693_100038084 | 3300005547 | Bacteria | 2685 |
| 101 | Ga0068855_100131146 | 3300005563 | Bacteria | 2862 |
| 102 | Ga0068855_100389994 | 3300005563 | Bacteria | 1528 |
| 103 | Ga0068855_101125796 | 3300005563 | Bacteria | 819 |
| 104 | Ga0070664_100025397 | 3300005564 | Bacteria | 4910 |
| 105 | Ga0070664_100193979 | 3300005564 | Bacteria | 1810 |
| 106 | Ga0068857_100026096 | 3300005577 | Bacteria | 5146 |
| 107 | Ga0068857_100035213 | 3300005577 | Bacteria | 4432 |
| 108 | Ga0068857_100097458 | 3300005577 | Bacteria | 2636 |
| 109 | Ga0068857_100418768 | 3300005577 | Bacteria | 1249 |
| 110 | Ga0068857_100517926 | 3300005577 | Bacteria | 1121 |
| 111 | Ga0068854_100084609 | 3300005578 | Bacteria | 2347 |
| 112 | Ga0068854_100457610 | 3300005578 | Bacteria | 1067 |
| 113 | Ga0068856_100218897 | 3300005614 | Bacteria | 1919 |
| 114 | Ga0068856_100715707 | 3300005614 | Bacteria | 1021 |
| 115 | Ga0068852_100060326 | 3300005616 | Bacteria | 3293 |
| 116 | Ga0068852_100255923 | 3300005616 | Bacteria | 1679 |
| 117 | Ga0068852_100293898 | 3300005616 | Bacteria | 1570 |
| 118 | Ga0068859_100846768 | 3300005617 | Bacteria | 1001 |
| 119 | Ga0068866_10014063 | 3300005718 | Bacteria | 3524 |
| 120 | Ga0068861_100391040 | 3300005719 | Bacteria | 1231 |
| 121 | Ga0068863_100071994 | 3300005841 | Bacteria | 3270 |
| 122 | Ga0068858_100808869 | 3300005842 | Bacteria | 914 |
| 123 | Ga0081540_1020852 | 3300005983 | Bacteria | 3926 |
| 124 | Ga0075367_10004088 | 3300006178 | Bacteria | 7065 |
| 125 | Ga0075366_10016146 | 3300006195 | Bacteria | 4288 |
| 126 | Ga0097621_100099950 | 3300006237 | Bacteria | 2439 |
| 127 | Ga0068871_100005657 | 3300006358 | Bacteria | 8767 |
| 128 | Ga0068871_100190869 | 3300006358 | Bacteria | 1765 |
| 129 | Ga0075428_100041295 | 3300006844 | Bacteria | 5073 |
| 130 | Ga0075428_100724647 | 3300006844 | Bacteria | 1059 |
| 131 | Ga0075428_101208001 | 3300006844 | Bacteria | 797 |
| 132 | Ga0075431_100124821 | 3300006847 | Bacteria | 2656 |
| 133 | Ga0075429_100054833 | 3300006880 | Bacteria | 3467 |
| 134 | Ga0068865_100003452 | 3300006881 | Bacteria | 9465 |
| 135 | Ga0068865_100009525 | 3300006881 | Bacteria | 6026 |
| 136 | Ga0068865_100072955 | 3300006881 | Bacteria | 2439 |
| 137 | Ga0097620_100846816 | 3300006931 | Bacteria | 1001 |
| 138 | Ga0105240_10005265 | 3300009093 | Bacteria | 19316 |
| 139 | Ga0105240_10212093 | 3300009093 | Bacteria | 2262 |
| 140 | Ga0105240_10251675 | 3300009093 | Bacteria | 2043 |
| 141 | Ga0105240_10712886 | 3300009093 | Bacteria | 1094 |
| 142 | Ga0111539_10273344 | 3300009094 | Bacteria | 1967 |
| 143 | Ga0111539_10428958 | 3300009094 | Bacteria | 1539 |
| 144 | Ga0105245_10519858 | 3300009098 | Bacteria | 1209 |
| 145 | Ga0114129_10334822 | 3300009147 | Bacteria | 2009 |
| 146 | Ga0114129_11444505 | 3300009147 | Bacteria | 847 |
| 147 | Ga0105243_11205097 | 3300009148 | Bacteria | 770 |
| 148 | Ga0105241_10010803 | 3300009174 | Bacteria | 6697 |
| 149 | Ga0105241_10140369 | 3300009174 | Bacteria | 1966 |
| 150 | Ga0105241_10371532 | 3300009174 | Bacteria | 1247 |
| 151 | Ga0105242_10170130 | 3300009176 | Bacteria | 1914 |
| 152 | Ga0105242_10310994 | 3300009176 | Bacteria | 1442 |
| 153 | Ga0105242_10494727 | 3300009176 | Bacteria | 1162 |
| 154 | Ga0105248_10045905 | 3300009177 | Bacteria | 4898 |
| 155 | Ga0105237_10012614 | 3300009545 | Bacteria | 8899 |
| 156 | Ga0105237_10195176 | 3300009545 | Bacteria | 2024 |
| 157 | Ga0105238_10004755 | 3300009551 | Bacteria | 13434 |
| 158 | Ga0105238_10051006 | 3300009551 | Bacteria | 4163 |
| 159 | Ga0105239_10025635 | 3300010375 | Bacteria | 6492 |
| 160 | Ga0105239_10166896 | 3300010375 | Bacteria | 2462 |
| 161 | Ga0105239_10494532 | 3300010375 | Bacteria | 1390 |
| 162 | Ga0105246_11019220 | 3300011119 | Bacteria | 751 |
| 163 | Ga0157346_1004119 | 3300012480 | Bacteria | 845 |
| 164 | Ga0157345_1007949 | 3300012498 | Bacteria | 877 |
| 165 | Ga0157314_1005956 | 3300012500 | Bacteria | 940 |
| 166 | Ga0157373_10091253 | 3300013100 | Bacteria | 2145 |
| 167 | Ga0157373_10121839 | 3300013100 | Bacteria | 1833 |
| 168 | Ga0157371_10086657 | 3300013102 | Bacteria | 2218 |
| 169 | Ga0157371_10108338 | 3300013102 | Bacteria | 1971 |
| 170 | Ga0157370_10002917 | 3300013104 | Bacteria | 20365 |
| 171 | Ga0157370_10019520 | 3300013104 | Bacteria | 6795 |
| 172 | Ga0157370_10031252 | 3300013104 | Bacteria | 5211 |
| 173 | Ga0157370_10057980 | 3300013104 | Bacteria | 3680 |
| 174 | Ga0157370_10058800 | 3300013104 | Bacteria | 3653 |
| 175 | Ga0157370_10189546 | 3300013104 | Bacteria | 1909 |
| 176 | Ga0157370_10192612 | 3300013104 | Bacteria | 1892 |
| 177 | Ga0157369_10043031 | 3300013105 | Bacteria | 4924 |
| 178 | Ga0157369_10105676 | 3300013105 | Bacteria | 2997 |
| 179 | Ga0157369_10659029 | 3300013105 | Bacteria | 1079 |
| 180 | Ga0157369_10766748 | 3300013105 | Bacteria | 992 |
| 181 | Ga0157374_10382933 | 3300013296 | Bacteria | 1401 |
| 182 | Ga0163162_10051932 | 3300013306 | Bacteria | 4115 |
| 183 | Ga0163162_10137974 | 3300013306 | Bacteria | 2550 |
| 184 | Ga0163162_10155119 | 3300013306 | Bacteria | 2409 |
| 185 | Ga0163162_10226497 | 3300013306 | Bacteria | 1999 |
| 186 | Ga0163162_10826839 | 3300013306 | Bacteria | 1042 |
| 187 | Ga0157372_10027442 | 3300013307 | Bacteria | 6201 |
| 188 | Ga0157372_10039973 | 3300013307 | Bacteria | 5179 |
| 189 | Ga0157372_10079596 | 3300013307 | Bacteria | 3706 |
| 190 | Ga0157372_10080562 | 3300013307 | Bacteria | 3685 |
| 191 | Ga0157372_10084219 | 3300013307 | Bacteria | 3603 |
| 192 | Ga0157372_10084578 | 3300013307 | Bacteria | 3596 |
| 193 | Ga0157372_10972635 | 3300013307 | Bacteria | 984 |
| 194 | Ga0157375_10000515 | 3300013308 | Bacteria | 34858 |
| 195 | Ga0157375_10122265 | 3300013308 | Bacteria | 2714 |
| 196 | Ga0157375_10129493 | 3300013308 | Bacteria | 2642 |
| 197 | Ga0157375_10260294 | 3300013308 | Bacteria | 1896 |
| 198 | Ga0157375_10344393 | 3300013308 | Bacteria | 1656 |
| 199 | Ga0157375_10818340 | 3300013308 | Bacteria | 1079 |
| 200 | Ga0163163_10005444 | 3300014325 | Bacteria | 11007 |
| 201 | Ga0163163_10235613 | 3300014325 | Bacteria | 1880 |
| 202 | Ga0157380_10112106 | 3300014326 | Bacteria | 2294 |
| 203 | Ga0157380_10212156 | 3300014326 | Bacteria | 1726 |
| 204 | Ga0157380_10432841 | 3300014326 | Bacteria | 1258 |
| 205 | Ga0182008_10048342 | 3300014497 | Bacteria | 2112 |
| 206 | Ga0157379_10337272 | 3300014968 | Bacteria | 1378 |
| 207 | Ga0157379_11096169 | 3300014968 | Bacteria | 762 |
| 208 | Ga0157376_10027258 | 3300014969 | Bacteria | 4526 |
| 209 | Ga0157376_10070177 | 3300014969 | Bacteria | 2973 |
| 210 | Ga0157376_10240530 | 3300014969 | Bacteria | 1686 |
| 211 | Ga0157376_10603434 | 3300014969 | Bacteria | 1093 |
| 212 | Ga0157376_10633827 | 3300014969 | Bacteria | 1067 |
| 213 | Ga0157376_10848875 | 3300014969 | Bacteria | 928 |
| 214 | Ga0182006_1016788 | 3300015261 | Bacteria | 3120 |
| 215 | Ga0197907_10891830 | 3300020069 | Bacteria | 1763 |
| 216 | Ga0206351_10345552 | 3300020077 | Bacteria | 1240 |
| 217 | Ga0206352_10817169 | 3300020078 | Bacteria | 700 |
| 218 | Ga0206354_10417735 | 3300020081 | Bacteria | 1024 |
| 219 | Ga0206353_11010918 | 3300020082 | Bacteria | 1489 |
| 220 | Ga0206353_11851917 | 3300020082 | Bacteria | 2039 |
| 221 | Ga0209646_1002458 | 3300025246 | Bacteria | 4091 |
| 222 | Ga0209026_1000191 | 3300025250 | Bacteria | 88578 |
| 223 | Ga0209759_1015071 | 3300025256 | Bacteria | 2011 |
| 224 | Ga0209455_1000254 | 3300025272 | Bacteria | 62595 |
| 225 | Ga0207697_10028515 | 3300025315 | Bacteria | 2283 |
| 226 | Ga0207656_10204503 | 3300025321 | Bacteria | 955 |
| 227 | Ga0207682_10000698 | 3300025893 | Bacteria | 15545 |
| 228 | Ga0207642_10015259 | 3300025899 | Bacteria | 2858 |
| 229 | Ga0207642_10166560 | 3300025899 | Bacteria | 1188 |
| 230 | Ga0207688_10034384 | 3300025901 | Bacteria | 2807 |
| 231 | Ga0207680_10322244 | 3300025903 | Bacteria | 1081 |
| 232 | Ga0207680_10622650 | 3300025903 | Bacteria | 772 |
| 233 | Ga0207647_10001470 | 3300025904 | Bacteria | 18101 |
| 234 | Ga0207647_10003895 | 3300025904 | Bacteria | 11149 |
| 235 | Ga0207699_10320359 | 3300025906 | Bacteria | 1087 |
| 236 | Ga0207705_10000087 | 3300025909 | Bacteria | 114441 |
| 237 | Ga0207705_10001012 | 3300025909 | Bacteria | 22856 |
| 238 | Ga0207705_10005258 | 3300025909 | Bacteria | 9700 |
| 239 | Ga0207705_10044574 | 3300025909 | Bacteria | 3187 |
| 240 | Ga0207705_10461998 | 3300025909 | Bacteria | 985 |
| 241 | Ga0207654_10002688 | 3300025911 | Bacteria | 9030 |
| 242 | Ga0207654_10587387 | 3300025911 | Bacteria | 794 |
| 243 | Ga0207654_10741112 | 3300025911 | Bacteria | 707 |
| 244 | Ga0207707_10000389 | 3300025912 | Bacteria | 45856 |
| 245 | Ga0207707_10001714 | 3300025912 | Bacteria | 20166 |
| 246 | Ga0207707_10075083 | 3300025912 | Bacteria | 2949 |
| 247 | Ga0207707_10397856 | 3300025912 | Bacteria | 1183 |
| 248 | Ga0207695_10000859 | 3300025913 | Bacteria | 55564 |
| 249 | Ga0207695_10004333 | 3300025913 | Bacteria | 19435 |
| 250 | Ga0207671_10003290 | 3300025914 | Bacteria | 16258 |
| 251 | Ga0207671_10118045 | 3300025914 | Bacteria | 2025 |
| 252 | Ga0207663_10317038 | 3300025916 | Bacteria | 1170 |
| 253 | Ga0207660_10001751 | 3300025917 | Bacteria | 14544 |
| 254 | Ga0207660_10157471 | 3300025917 | Bacteria | 1749 |
| 255 | Ga0207662_10115824 | 3300025918 | Bacteria | 1675 |
| 256 | Ga0207662_10712632 | 3300025918 | Bacteria | 704 |
| 257 | Ga0207657_10007522 | 3300025919 | Bacteria | 11165 |
| 258 | Ga0207657_10007728 | 3300025919 | Bacteria | 10979 |
| 259 | Ga0207657_10262140 | 3300025919 | Bacteria | 1375 |
| 260 | Ga0207649_10000488 | 3300025920 | Bacteria | 28138 |
| 261 | Ga0207649_10110506 | 3300025920 | Bacteria | 1835 |
| 262 | Ga0207649_10166551 | 3300025920 | Bacteria | 1531 |
| 263 | Ga0207652_10000072 | 3300025921 | Bacteria | 109080 |
| 264 | Ga0207652_10000418 | 3300025921 | Bacteria | 44135 |
| 265 | Ga0207652_10025724 | 3300025921 | Bacteria | 4896 |
| 266 | Ga0207652_10292771 | 3300025921 | Bacteria | 1469 |
| 267 | Ga0207652_10418761 | 3300025921 | Bacteria | 1208 |
| 268 | Ga0207681_10297090 | 3300025923 | Bacteria | 1277 |
| 269 | Ga0207694_10003183 | 3300025924 | Bacteria | 13094 |
| 270 | Ga0207694_10043783 | 3300025924 | Bacteria | 3455 |
| 271 | Ga0207694_10074869 | 3300025924 | Bacteria | 2650 |
| 272 | Ga0207650_10044940 | 3300025925 | Bacteria | 3248 |
| 273 | Ga0207659_10312564 | 3300025926 | Bacteria | 1294 |
| 274 | Ga0207664_10000030 | 3300025929 | Bacteria | 179903 |
| 275 | Ga0207644_10049464 | 3300025931 | Bacteria | 3010 |
| 276 | Ga0207644_10905835 | 3300025931 | Bacteria | 739 |
| 277 | Ga0207690_10001212 | 3300025932 | Bacteria | 16290 |
| 278 | Ga0207690_10002243 | 3300025932 | Bacteria | 11801 |
| 279 | Ga0207690_10003044 | 3300025932 | Bacteria | 10099 |
| 280 | Ga0207690_10003181 | 3300025932 | Bacteria | 9861 |
| 281 | Ga0207690_10029894 | 3300025932 | Bacteria | 3468 |
| 282 | Ga0207690_10203738 | 3300025932 | Bacteria | 1504 |
| 283 | Ga0207690_10782882 | 3300025932 | Bacteria | 788 |
| 284 | Ga0207706_10011045 | 3300025933 | Bacteria | 8230 |
| 285 | Ga0207706_10012233 | 3300025933 | Bacteria | 7820 |
| 286 | Ga0207670_10600569 | 3300025936 | Bacteria | 904 |
| 287 | Ga0207669_10263006 | 3300025937 | Bacteria | 1291 |
| 288 | Ga0207669_10305876 | 3300025937 | Bacteria | 1210 |
| 289 | Ga0207691_10002909 | 3300025940 | Bacteria | 16703 |
| 290 | Ga0207691_10090040 | 3300025940 | Bacteria | 2751 |
| 291 | Ga0207691_10131865 | 3300025940 | Bacteria | 2206 |
| 292 | Ga0207711_10179105 | 3300025941 | Bacteria | 1926 |
| 293 | Ga0207689_10533670 | 3300025942 | Bacteria | 985 |
| 294 | Ga0207661_10001043 | 3300025944 | Bacteria | 18426 |
| 295 | Ga0207661_10072020 | 3300025944 | Bacteria | 2826 |
| 296 | Ga0207679_10783622 | 3300025945 | Bacteria | 868 |
| 297 | Ga0207679_10848392 | 3300025945 | Bacteria | 834 |
| 298 | Ga0207667_10002947 | 3300025949 | Bacteria | 21120 |
| 299 | Ga0207667_10005890 | 3300025949 | Bacteria | 14928 |
| 300 | Ga0207667_10069645 | 3300025949 | Bacteria | 3662 |
| 301 | Ga0207651_10410680 | 3300025960 | Bacteria | 1153 |
| 302 | Ga0207651_10772673 | 3300025960 | Bacteria | 850 |
| 303 | Ga0207651_11266891 | 3300025960 | Bacteria | 662 |
| 304 | Ga0207668_10009932 | 3300025972 | Bacteria | 5724 |
| 305 | Ga0207640_10000318 | 3300025981 | Bacteria | 32231 |
| 306 | Ga0207677_10088512 | 3300026023 | Bacteria | 2245 |
| 307 | Ga0207639_10000702 | 3300026041 | Bacteria | 22962 |
| 308 | Ga0207639_10023502 | 3300026041 | Bacteria | 4452 |
| 309 | Ga0207639_10058612 | 3300026041 | Bacteria | 2963 |
| 310 | Ga0207639_10445995 | 3300026041 | Bacteria | 1174 |
| 311 | Ga0207639_10617976 | 3300026041 | Bacteria | 1000 |
| 312 | Ga0207639_10675673 | 3300026041 | Bacteria | 957 |
| 313 | Ga0207639_10853154 | 3300026041 | Bacteria | 850 |
| 314 | Ga0207678_10002600 | 3300026067 | Bacteria | 16445 |
| 315 | Ga0207678_10003732 | 3300026067 | Bacteria | 13700 |
| 316 | Ga0207678_10003991 | 3300026067 | Bacteria | 13275 |
| 317 | Ga0207702_10017644 | 3300026078 | Bacteria | 5906 |
| 318 | Ga0207702_10051560 | 3300026078 | Bacteria | 3478 |
| 319 | Ga0207702_10650531 | 3300026078 | Bacteria | 1037 |
| 320 | Ga0207702_10667831 | 3300026078 | Bacteria | 1023 |
| 321 | Ga0207641_10048240 | 3300026088 | Bacteria | 3594 |
| 322 | Ga0207641_10909023 | 3300026088 | Bacteria | 874 |
| 323 | Ga0207648_10027506 | 3300026089 | Bacteria | 5048 |
| 324 | Ga0207648_10652961 | 3300026089 | Bacteria | 972 |
| 325 | Ga0207676_10057020 | 3300026095 | Bacteria | 3075 |
| 326 | Ga0207676_10251675 | 3300026095 | Bacteria | 1590 |
| 327 | Ga0207674_10015162 | 3300026116 | Bacteria | 8481 |
| 328 | Ga0207674_10033350 | 3300026116 | Bacteria | 5392 |
| 329 | Ga0207674_10180112 | 3300026116 | Bacteria | 2065 |
| 330 | Ga0207674_10293846 | 3300026116 | Bacteria | 1573 |
| 331 | Ga0207675_100031005 | 3300026118 | Bacteria | 4979 |
| 332 | Ga0207683_10027254 | 3300026121 | Bacteria | 4937 |
| 333 | Ga0207683_10099625 | 3300026121 | Bacteria | 2594 |
| 334 | Ga0207683_10335066 | 3300026121 | Bacteria | 1387 |
| 335 | Ga0207683_11159051 | 3300026121 | Bacteria | 717 |
| 336 | Ga0207698_10000056 | 3300026142 | Bacteria | 80605 |
| 337 | Ga0207698_10085773 | 3300026142 | Bacteria | 2558 |
| 338 | Ga0207698_10359953 | 3300026142 | Bacteria | 1377 |
| 339 | Ga0209995_1022238 | 3300027471 | Bacteria | 1052 |
| 340 | Ga0209982_1003417 | 3300027552 | Bacteria | 2258 |
| 341 | Ga0209970_1040008 | 3300027614 | Bacteria | 832 |
| 342 | Ga0210002_1019676 | 3300027617 | Bacteria | 1085 |
| 343 | Ga0209983_1007180 | 3300027665 | Bacteria | 2286 |
| 344 | Ga0209998_10002040 | 3300027717 | Bacteria | 4737 |
| 345 | Ga0209974_10002282 | 3300027876 | Bacteria | 6961 |
| 346 | Ga0209974_10017167 | 3300027876 | Bacteria | 2401 |
| 347 | Ga0307408_100008900 | 3300031548 | Bacteria | 6633 |
| 348 | Ga0307408_101172619 | 3300031548 | Bacteria | 715 |
| 349 | Ga0307413_10013950 | 3300031824 | Bacteria | 4063 |
| 350 | Ga0307410_10006588 | 3300031852 | Bacteria | 6281 |
| 351 | Ga0307410_10541611 | 3300031852 | Bacteria | 963 |
| 352 | Ga0307406_10017628 | 3300031901 | Bacteria | 4160 |
| 353 | Ga0307406_10423582 | 3300031901 | Bacteria | 1061 |
| 354 | Ga0307407_10003544 | 3300031903 | Bacteria | 6436 |
| 355 | Ga0307407_10206885 | 3300031903 | Bacteria | 1319 |
| 356 | Ga0307407_10407207 | 3300031903 | Bacteria | 977 |
| 357 | Ga0307412_10267223 | 3300031911 | Bacteria | 1337 |
| 358 | Ga0307409_100002989 | 3300031995 | Bacteria | 9014 |
| 359 | Ga0307409_101095423 | 3300031995 | Bacteria | 817 |
| 360 | Ga0307416_100013899 | 3300032002 | Bacteria | 5489 |
| 361 | Ga0307416_100560858 | 3300032002 | Bacteria | 1217 |
| 362 | Ga0307416_100751352 | 3300032002 | Bacteria | 1068 |
| 363 | Ga0307416_101014260 | 3300032002 | Bacteria | 933 |
| 364 | Ga0307416_101225211 | 3300032002 | Bacteria | 856 |
| 365 | Ga0307414_10023504 | 3300032004 | Bacteria | 3911 |
| 366 | Ga0307414_11083210 | 3300032004 | Bacteria | 739 |
| 367 | Ga0307411_10027766 | 3300032005 | Bacteria | 3430 |
| 368 | Ga0307411_10112084 | 3300032005 | Bacteria | 1954 |
| 369 | Ga0307415_100029168 | 3300032126 | Bacteria | 3522 |
| 370 | Ga0307415_101473990 | 3300032126 | Bacteria | 650 |
| 371 | Ga0373936_0270722 | 3300035113 | Bacteria | 762 |
| 372 | Ga0373927_0501027 | 3300035695 | Bacteria | 802 |
| 373 | Ga0373937_0008060 | 3300036401 | Bacteria | 9139 |
| 374 | Ga0395899_0181288 | 3300037312 | Bacteria | 1478 |
| 375 | Ga0395900_0000648 | 3300037418 | Bacteria | 46594 |
| 376 | Ga0395900_0018592 | 3300037418 | Bacteria | 7087 |
| 377 | Ga0395900_0242070 | 3300037418 | Bacteria | 1809 |
| 378 | Ga0395900_0445675 | 3300037418 | Bacteria | 1251 |
| 379 | Ga0395900_0620869 | 3300037418 | Bacteria | 1020 |
| 380 | Ga0395900_1163521 | 3300037418 | Bacteria | 687 |
| 381 | Ga0395898_0057714 | 3300037466 | Bacteria | 3781 |
| 382 | Ga0395898_0069831 | 3300037466 | Bacteria | 3397 |
| 383 | Ga0395898_0663251 | 3300037466 | Bacteria | 985 |
| 384 | Ga0395905_0420309 | 3300037471 | Bacteria | 1233 |
| 385 | Ga0395901_0012767 | 3300038443 | Bacteria | 8521 |
| 386 | Ga0395901_0030757 | 3300038443 | Bacteria | 5532 |
| 387 | Ga0395901_0084784 | 3300038443 | Bacteria | 3311 |
| 388 | Ga0395901_0156609 | 3300038443 | Bacteria | 2392 |
| 389 | Ga0395901_0258576 | 3300038443 | Bacteria | 1812 |
| 390 | Ga0439432_134605 | 3300042006 | Bacteria | 728 |
| 391 | Ga0439450_020222 | 3300042008 | Bacteria | 1419 |
| 392 | Ga0439450_073609 | 3300042008 | Bacteria | 841 |
| 393 | Ga0439464_0102502 | 3300042439 | Bacteria | 871 |
| 394 | Ga0451577_0050191 | 3300042876 | Bacteria | 3725 |
| 395 | Ga0439440_0004579 | 3300042993 | Bacteria | 2720 |
| 396 | Ga0453684_0039427 | 3300044712 | Bacteria | 6437 |
| 397 | Ga0466959_0796989 | 3300045049 | Bacteria | 632 |
| 398 | Ga0451576_0026612 | 3300045051 | Bacteria | 6220 |
| 399 | Ga0451576_0369536 | 3300045051 | Bacteria | 1503 |
| 400 | Ga0495580_0491390 | 3300046472 | Bacteria | 820 |
| 401 | Ga0495664_0024312 | 3300046477 | Bacteria | 3520 |
| 402 | Ga0495594_0397530 | 3300046499 | Bacteria | 784 |
| 403 | Ga0495630_0540455 | 3300046517 | Bacteria | 894 |
| 404 | Ga0495642_0025950 | 3300046528 | Bacteria | 2325 |
| 405 | Ga0495598_0005697 | 3300046537 | Bacteria | 2777 |
| 406 | Ga0495621_0024615 | 3300046539 | Bacteria | 2013 |
| 407 | Ga0495621_0158940 | 3300046539 | Bacteria | 893 |
| 408 | Ga0495645_0069577 | 3300046543 | Bacteria | 2541 |
| 409 | Ga0495645_0302043 | 3300046543 | Bacteria | 1045 |
| 410 | Ga0495656_0001966 | 3300046615 | Bacteria | 6777 |
| 411 | Ga0495668_0067979 | 3300046616 | Bacteria | 1960 |
| 412 | Ga0495647_0033053 | 3300046681 | Bacteria | 1932 |
| 413 | Ga0495684_0349190 | 3300047471 | Bacteria | 1050 |
| 414 | Ga0496104_0000020 | 3300048907 | Bacteria | 247296 |
| 415 | Ga0496105_0000028 | 3300048908 | Bacteria | 145917 |
| 416 | Ga0496106_0078689 | 3300048909 | Bacteria | 2531 |
| 417 | Ga0496107_0697872 | 3300048910 | Bacteria | 746 |
| 418 | Ga0496110_0152213 | 3300048913 | Bacteria | 2095 |
| 419 | Ga0496125_0389351 | 3300048928 | Bacteria | 819 |
| 420 | Ga0501031_0160047 | 3300049568 | Bacteria | 1472 |
| 421 | Ga0501032_0139102 | 3300049569 | Bacteria | 1599 |
| 422 | Ga0501034_0001280 | 3300049571 | Bacteria | 33979 |
| 423 | Ga0501034_0078451 | 3300049571 | Bacteria | 3307 |
| 424 | Ga0501036_0048543 | 3300049572 | Bacteria | 3594 |
| 425 | Ga0501036_0466839 | 3300049572 | Unclassified | 1051 |
| 426 | Ga0501037_0155095 | 3300049573 | Bacteria | 1635 |
| 427 | Ga0501041_0472917 | 3300049577 | Bacteria | 796 |
| 428 | Ga0501046_0160951 | 3300049580 | Bacteria | 1688 |
| 429 | Ga0501047_0111326 | 3300049581 | Bacteria | 2620 |
| 430 | Ga0501070_0046489 | 3300049586 | Bacteria | 3609 |
| 431 | Ga0501070_0092195 | 3300049586 | Bacteria | 2507 |
| 432 | Ga0501071_0239842 | 3300049587 | Bacteria | 1367 |
| 433 | Ga0501073_0005025 | 3300049589 | Bacteria | 9918 |
| 434 | Ga0501074_0014850 | 3300049590 | Bacteria | 5662 |
| 435 | Ga0501076_0041556 | 3300049592 | Bacteria | 3618 |
| 436 | Ga0501077_0350921 | 3300049593 | Bacteria | 941 |
| 437 | Ga0501198_026847 | 3300049649 | Bacteria | 943 |
| 438 | Ga0501201_014520 | 3300049651 | Bacteria | 796 |
| 439 | Ga0501235_043377 | 3300049669 | Bacteria | 1032 |
| 440 | Ga0501243_067839 | 3300049675 | Bacteria | 673 |
| 441 | Ga0501252_020326 | 3300049682 | Bacteria | 863 |
| 442 | Ga0501079_0039714 | 3300049741 | Bacteria | 3630 |
| 443 | Ga0501080_0131259 | 3300049742 | Bacteria | 2319 |
| 444 | Ga0501080_0192401 | 3300049742 | Bacteria | 1874 |
| 445 | Ga0501035_0398880 | 3300049822 | Bacteria | 1145 |
| 446 | Ga0501044_0303582 | 3300049823 | Bacteria | 1525 |
| 447 | nmdc:mga00v17_175094_c1 | 3300050491 | Bacteria | 1384 |
| 448 | nmdc:mga0yw44_4335_c1 | 3300050492 | Bacteria | 6483 |
| 449 | nmdc:mga0k408_24267_c1 | 3300050493 | Bacteria | 3427 |
| 450 | nmdc:mga06z11_323223_c1 | 3300050494 | Bacteria | 921 |
| 451 | nmdc:mga07m45_185353_c1 | 3300050496 | Bacteria | 1210 |
| 452 | nmdc:mga05p37_642327_c1 | 3300050507 | Bacteria | 1190 |
| 453 | nmdc:mga09592_281441_c1 | 3300050508 | Bacteria | 1442 |
| 454 | nmdc:mga06r32_201907_c1 | 3300050510 | Bacteria | 1976 |
| 455 | nmdc:mga08y16_408074_c1 | 3300050511 | Bacteria | 1390 |
| 456 | nmdc:mga08y16_553342_c1 | 3300050511 | Bacteria | 1164 |
| 457 | nmdc:mga0n895_1228359_c1 | 3300050512 | Bacteria | 722 |
| 458 | Ga0500651_0125372 | 3300053093 | Bacteria | 1556 |
| 459 | Ga0500594_0000655 | 3300053118 | Bacteria | 7358 |
| 460 | Ga0501084_0863975 | 3300054114 | Bacteria | 761 |
| 461 | Ga0501082_0641585 | 3300060353 | Bacteria | 929 |
| 462 | Ga0530510_0332154 | 3300061734 | Bacteria | 1140 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037418 | Ga0395900_1163521 | Ga0395900_1163521_10_621 | 179 |
| 2 | 3300037466 | Ga0395898_0663251 | Ga0395898_0663251_42_653 | 179 |
| 3 | 3300037471 | Ga0395905_0420309 | Ga0395905_0420309_22_633 | 179 |
| 4 | iso_pu_bacteria | 2512875016 | 2512930659 | 186 |
| 5 | iso_pu_bacteria | 2876363079 | 2876367994 | 186 |
| 6 | iso_pu_bacteria | 2903448605 | 2903449755 | 186 |
| 7 | iso_pu_bacteria | 2903521522 | 2903526990 | 186 |
| 8 | iso_pu_bacteria | 2903528002 | 2903533217 | 186 |
| 9 | iso_pu_bacteria | 2963644680 | 2963648567 | 186 |
| 10 | iso_pu_bacteria | 2968083720 | 2968083795 | 186 |
| 11 | iso_pu_bacteria | 637000159 | 637073649 | 186 |
| 12 | 3300005455 | Ga0070663_100667363 | Ga0070663_1006673631 | 188 |
| 13 | 3300005434 | Ga0070709_10258019 | Ga0070709_102580192 | 189 |
| 14 | 3300005435 | Ga0070714_100603653 | Ga0070714_1006036532 | 189 |
| 15 | 3300005616 | Ga0068852_100255923 | Ga0068852_1002559232 | 189 |
| 16 | 3300009093 | Ga0105240_10212093 | Ga0105240_102120932 | 189 |
| 17 | 3300009174 | Ga0105241_10010803 | Ga0105241_100108035 | 189 |
| 18 | 3300013104 | Ga0157370_10031252 | Ga0157370_100312524 | 189 |
| 19 | 3300013104 | Ga0157370_10189546 | Ga0157370_101895463 | 189 |
| 20 | 3300025911 | Ga0207654_10002688 | Ga0207654_100026885 | 189 |
| 21 | 3300025942 | Ga0207689_10533670 | Ga0207689_105336701 | 189 |
| 22 | 3300026078 | Ga0207702_10650531 | Ga0207702_106505311 | 189 |
| 23 | 3300026142 | Ga0207698_10359953 | Ga0207698_103599532 | 189 |
| 24 | 3300032002 | Ga0307416_100560858 | Ga0307416_1005608582 | 189 |
| 25 | 3300042008 | Ga0439450_073609 | Ga0439450_073609_90_668 | 189 |
| 26 | 3300042439 | Ga0439464_0102502 | Ga0439464_0102502_185_754 | 189 |
| 27 | 3300042993 | Ga0439440_0004579 | Ga0439440_0004579_1970_2548 | 189 |
| 28 | 3300049569 | Ga0501032_0139102 | Ga0501032_0139102_564_1133 | 189 |
| 29 | 3300049571 | Ga0501034_0001280 | Ga0501034_0001280_32236_32805 | 189 |
| 30 | 3300049572 | Ga0501036_0048543 | Ga0501036_0048543_1921_2490 | 189 |
| 31 | 3300049573 | Ga0501037_0155095 | Ga0501037_0155095_135_704 | 189 |
| 32 | 3300049580 | Ga0501046_0160951 | Ga0501046_0160951_55_624 | 189 |
| 33 | 3300049581 | Ga0501047_0111326 | Ga0501047_0111326_1175_1744 | 189 |
| 34 | 3300049586 | Ga0501070_0046489 | Ga0501070_0046489_2163_2732 | 189 |
| 35 | 3300049589 | Ga0501073_0005025 | Ga0501073_0005025_238_807 | 189 |
| 36 | 3300049590 | Ga0501074_0014850 | Ga0501074_0014850_3539_4108 | 189 |
| 37 | 3300049741 | Ga0501079_0039714 | Ga0501079_0039714_914_1483 | 189 |
| 38 | 3300049742 | Ga0501080_0131259 | Ga0501080_0131259_22_624 | 189 |
| 39 | 3300049742 | Ga0501080_0192401 | Ga0501080_0192401_1176_1745 | 189 |
| 40 | 3300049822 | Ga0501035_0398880 | Ga0501035_0398880_116_685 | 189 |
| 41 | 3300053093 | Ga0500651_0125372 | Ga0500651_0125372_601_1170 | 189 |
| 42 | 3300060353 | Ga0501082_0641585 | Ga0501082_0641585_22_591 | 189 |
| 43 | 3300001915 | JGI24741J21665_1001160 | JGI24741J21665_10011602 | 190 |
| 44 | 3300001915 | JGI24741J21665_1001330 | JGI24741J21665_10013302 | 190 |
| 45 | 3300001979 | JGI24740J21852_10000202 | JGI24740J21852_1000020214 | 190 |
| 46 | 3300002705 | JGI25156J39149_1018438 | JGI25156J39149_10184382 | 190 |
| 47 | 3300002741 | JGI25157J39369_1006909 | JGI25157J39369_10069092 | 190 |
| 48 | 3300003659 | JGI25404J52841_10070237 | JGI25404J52841_100702371 | 190 |
| 49 | 3300004803 | Ga0058862_12784152 | Ga0058862_127841521 | 190 |
| 50 | 3300005293 | Ga0065715_10465578 | Ga0065715_104655781 | 190 |
| 51 | 3300005295 | Ga0065707_10475207 | Ga0065707_104752071 | 190 |
| 52 | 3300005327 | Ga0070658_10009260 | Ga0070658_100092607 | 190 |
| 53 | 3300005327 | Ga0070658_10509219 | Ga0070658_105092192 | 190 |
| 54 | 3300005327 | Ga0070658_10616608 | Ga0070658_106166081 | 190 |
| 55 | 3300005327 | Ga0070658_10762154 | Ga0070658_107621542 | 190 |
| 56 | 3300005329 | Ga0070683_100000254 | Ga0070683_10000025423 | 190 |
| 57 | 3300005329 | Ga0070683_101196940 | Ga0070683_1011969401 | 190 |
| 58 | 3300005330 | Ga0070690_100030282 | Ga0070690_1000302823 | 190 |
| 59 | 3300005330 | Ga0070690_100697045 | Ga0070690_1006970451 | 190 |
| 60 | 3300005331 | Ga0070670_100088907 | Ga0070670_1000889074 | 190 |
| 61 | 3300005333 | Ga0070677_10142031 | Ga0070677_101420312 | 190 |
| 62 | 3300005335 | Ga0070666_10099307 | Ga0070666_100993072 | 190 |
| 63 | 3300005335 | Ga0070666_10250992 | Ga0070666_102509922 | 190 |
| 64 | 3300005335 | Ga0070666_10697072 | Ga0070666_106970722 | 190 |
| 65 | 3300005336 | Ga0070680_100002497 | Ga0070680_10000249716 | 190 |
| 66 | 3300005336 | Ga0070680_100214804 | Ga0070680_1002148042 | 190 |
| 67 | 3300005336 | Ga0070680_100539787 | Ga0070680_1005397872 | 190 |
| 68 | 3300005337 | Ga0070682_100001210 | Ga0070682_10000121018 | 190 |
| 69 | 3300005337 | Ga0070682_100060196 | Ga0070682_1000601961 | 190 |
| 70 | 3300005337 | Ga0070682_100070723 | Ga0070682_1000707232 | 190 |
| 71 | 3300005337 | Ga0070682_100237085 | Ga0070682_1002370852 | 190 |
| 72 | 3300005338 | Ga0068868_100406825 | Ga0068868_1004068251 | 190 |
| 73 | 3300005338 | Ga0068868_100449600 | Ga0068868_1004496002 | 190 |
| 74 | 3300005339 | Ga0070660_100055748 | Ga0070660_1000557483 | 190 |
| 75 | 3300005339 | Ga0070660_100231172 | Ga0070660_1002311722 | 190 |
| 76 | 3300005339 | Ga0070660_100237886 | Ga0070660_1002378862 | 190 |
| 77 | 3300005339 | Ga0070660_100397908 | Ga0070660_1003979081 | 190 |
| 78 | 3300005341 | Ga0070691_10019796 | Ga0070691_100197962 | 190 |
| 79 | 3300005341 | Ga0070691_10064634 | Ga0070691_100646342 | 190 |
| 80 | 3300005343 | Ga0070687_100166333 | Ga0070687_1001663331 | 190 |
| 81 | 3300005344 | Ga0070661_100008467 | Ga0070661_1000084673 | 190 |
| 82 | 3300005344 | Ga0070661_100008845 | Ga0070661_10000884510 | 190 |
| 83 | 3300005344 | Ga0070661_100094254 | Ga0070661_1000942542 | 190 |
| 84 | 3300005347 | Ga0070668_100139691 | Ga0070668_1001396911 | 190 |
| 85 | 3300005354 | Ga0070675_100129771 | Ga0070675_1001297712 | 190 |
| 86 | 3300005354 | Ga0070675_100249263 | Ga0070675_1002492632 | 190 |
| 87 | 3300005355 | Ga0070671_100203420 | Ga0070671_1002034202 | 190 |
| 88 | 3300005356 | Ga0070674_100147298 | Ga0070674_1001472983 | 190 |
| 89 | 3300005356 | Ga0070674_100417404 | Ga0070674_1004174042 | 190 |
| 90 | 3300005364 | Ga0070673_100169805 | Ga0070673_1001698055 | 190 |
| 91 | 3300005364 | Ga0070673_100358139 | Ga0070673_1003581392 | 190 |
| 92 | 3300005365 | Ga0070688_100029070 | Ga0070688_1000290701 | 190 |
| 93 | 3300005366 | Ga0070659_100004598 | Ga0070659_1000045987 | 190 |
| 94 | 3300005366 | Ga0070659_100019650 | Ga0070659_1000196505 | 190 |
| 95 | 3300005366 | Ga0070659_100024181 | Ga0070659_1000241814 | 190 |
| 96 | 3300005366 | Ga0070659_100143028 | Ga0070659_1001430283 | 190 |
| 97 | 3300005366 | Ga0070659_100146921 | Ga0070659_1001469211 | 190 |
| 98 | 3300005366 | Ga0070659_100311412 | Ga0070659_1003114121 | 190 |
| 99 | 3300005366 | Ga0070659_100578789 | Ga0070659_1005787892 | 190 |
| 100 | 3300005367 | Ga0070667_100285914 | Ga0070667_1002859142 | 190 |
| 101 | 3300005367 | Ga0070667_100912396 | Ga0070667_1009123961 | 190 |
| 102 | 3300005434 | Ga0070709_10284872 | Ga0070709_102848722 | 190 |
| 103 | 3300005435 | Ga0070714_100000055 | Ga0070714_10000005576 | 190 |
| 104 | 3300005438 | Ga0070701_10062720 | Ga0070701_100627204 | 190 |
| 105 | 3300005441 | Ga0070700_100021191 | Ga0070700_1000211912 | 190 |
| 106 | 3300005444 | Ga0070694_100755071 | Ga0070694_1007550711 | 190 |
| 107 | 3300005455 | Ga0070663_100006002 | Ga0070663_1000060024 | 190 |
| 108 | 3300005455 | Ga0070663_100152955 | Ga0070663_1001529552 | 190 |
| 109 | 3300005455 | Ga0070663_100230712 | Ga0070663_1002307122 | 190 |
| 110 | 3300005455 | Ga0070663_100618300 | Ga0070663_1006183001 | 190 |
| 111 | 3300005456 | Ga0070678_100148262 | Ga0070678_1001482622 | 190 |
| 112 | 3300005456 | Ga0070678_101056149 | Ga0070678_1010561491 | 190 |
| 113 | 3300005456 | Ga0070678_101154658 | Ga0070678_1011546581 | 190 |
| 114 | 3300005458 | Ga0070681_10002073 | Ga0070681_1000207316 | 190 |
| 115 | 3300005458 | Ga0070681_10117557 | Ga0070681_101175574 | 190 |
| 116 | 3300005458 | Ga0070681_10593700 | Ga0070681_105937002 | 190 |
| 117 | 3300005459 | Ga0068867_100014208 | Ga0068867_1000142083 | 190 |
| 118 | 3300005459 | Ga0068867_100619834 | Ga0068867_1006198342 | 190 |
| 119 | 3300005466 | Ga0070685_10063519 | Ga0070685_100635192 | 190 |
| 120 | 3300005466 | Ga0070685_10385769 | Ga0070685_103857691 | 190 |
| 121 | 3300005530 | Ga0070679_100000657 | Ga0070679_1000006575 | 190 |
| 122 | 3300005530 | Ga0070679_100010956 | Ga0070679_1000109569 | 190 |
| 123 | 3300005530 | Ga0070679_100054843 | Ga0070679_1000548433 | 190 |
| 124 | 3300005530 | Ga0070679_100354508 | Ga0070679_1003545082 | 190 |
| 125 | 3300005535 | Ga0070684_100000388 | Ga0070684_10000038818 | 190 |
| 126 | 3300005535 | Ga0070684_100034303 | Ga0070684_1000343032 | 190 |
| 127 | 3300005535 | Ga0070684_100171903 | Ga0070684_1001719031 | 190 |
| 128 | 3300005539 | Ga0068853_100265686 | Ga0068853_1002656862 | 190 |
| 129 | 3300005539 | Ga0068853_100284215 | Ga0068853_1002842152 | 190 |
| 130 | 3300005539 | Ga0068853_100433836 | Ga0068853_1004338361 | 190 |
| 131 | 3300005539 | Ga0068853_100805817 | Ga0068853_1008058171 | 190 |
| 132 | 3300005539 | Ga0068853_101285318 | Ga0068853_1012853181 | 190 |
| 133 | 3300005543 | Ga0070672_100042467 | Ga0070672_1000424672 | 190 |
| 134 | 3300005543 | Ga0070672_100105350 | Ga0070672_1001053503 | 190 |
| 135 | 3300005544 | Ga0070686_100208328 | Ga0070686_1002083281 | 190 |
| 136 | 3300005546 | Ga0070696_100001869 | Ga0070696_10000186917 | 190 |
| 137 | 3300005546 | Ga0070696_100013230 | Ga0070696_1000132307 | 190 |
| 138 | 3300005547 | Ga0070693_100009309 | Ga0070693_1000093095 | 190 |
| 139 | 3300005547 | Ga0070693_100038084 | Ga0070693_1000380842 | 190 |
| 140 | 3300005563 | Ga0068855_100131146 | Ga0068855_1001311462 | 190 |
| 141 | 3300005563 | Ga0068855_100389994 | Ga0068855_1003899943 | 190 |
| 142 | 3300005563 | Ga0068855_101125796 | Ga0068855_1011257962 | 190 |
| 143 | 3300005564 | Ga0070664_100025397 | Ga0070664_1000253975 | 190 |
| 144 | 3300005564 | Ga0070664_100193979 | Ga0070664_1001939791 | 190 |
| 145 | 3300005577 | Ga0068857_100026096 | Ga0068857_1000260962 | 190 |
| 146 | 3300005577 | Ga0068857_100035213 | Ga0068857_1000352135 | 190 |
| 147 | 3300005577 | Ga0068857_100097458 | Ga0068857_1000974584 | 190 |
| 148 | 3300005577 | Ga0068857_100418768 | Ga0068857_1004187681 | 190 |
| 149 | 3300005577 | Ga0068857_100517926 | Ga0068857_1005179262 | 190 |
| 150 | 3300005578 | Ga0068854_100084609 | Ga0068854_1000846092 | 190 |
| 151 | 3300005578 | Ga0068854_100457610 | Ga0068854_1004576101 | 190 |
| 152 | 3300005614 | Ga0068856_100218897 | Ga0068856_1002188973 | 190 |
| 153 | 3300005614 | Ga0068856_100715707 | Ga0068856_1007157071 | 190 |
| 154 | 3300005616 | Ga0068852_100060326 | Ga0068852_1000603263 | 190 |
| 155 | 3300005616 | Ga0068852_100293898 | Ga0068852_1002938983 | 190 |
| 156 | 3300005617 | Ga0068859_100846768 | Ga0068859_1008467682 | 190 |
| 157 | 3300005718 | Ga0068866_10014063 | Ga0068866_100140633 | 190 |
| 158 | 3300005719 | Ga0068861_100391040 | Ga0068861_1003910402 | 190 |
| 159 | 3300005841 | Ga0068863_100071994 | Ga0068863_1000719944 | 190 |
| 160 | 3300005842 | Ga0068858_100808869 | Ga0068858_1008088692 | 190 |
| 161 | 3300005983 | Ga0081540_1020852 | Ga0081540_10208524 | 190 |
| 162 | 3300006178 | Ga0075367_10004088 | Ga0075367_100040887 | 190 |
| 163 | 3300006195 | Ga0075366_10016146 | Ga0075366_100161465 | 190 |
| 164 | 3300006237 | Ga0097621_100099950 | Ga0097621_1000999502 | 190 |
| 165 | 3300006358 | Ga0068871_100005657 | Ga0068871_1000056576 | 190 |
| 166 | 3300006358 | Ga0068871_100190869 | Ga0068871_1001908694 | 190 |
| 167 | 3300006844 | Ga0075428_100041295 | Ga0075428_1000412959 | 190 |
| 168 | 3300006844 | Ga0075428_100724647 | Ga0075428_1007246471 | 190 |
| 169 | 3300006844 | Ga0075428_101208001 | Ga0075428_1012080011 | 190 |
| 170 | 3300006847 | Ga0075431_100124821 | Ga0075431_1001248212 | 190 |
| 171 | 3300006880 | Ga0075429_100054833 | Ga0075429_1000548332 | 190 |
| 172 | 3300006881 | Ga0068865_100003452 | Ga0068865_1000034525 | 190 |
| 173 | 3300006881 | Ga0068865_100009525 | Ga0068865_1000095252 | 190 |
| 174 | 3300006881 | Ga0068865_100072955 | Ga0068865_1000729551 | 190 |
| 175 | 3300006931 | Ga0097620_100846816 | Ga0097620_1008468162 | 190 |
| 176 | 3300009093 | Ga0105240_10005265 | Ga0105240_1000526514 | 190 |
| 177 | 3300009093 | Ga0105240_10251675 | Ga0105240_102516752 | 190 |
| 178 | 3300009093 | Ga0105240_10712886 | Ga0105240_107128862 | 190 |
| 179 | 3300009094 | Ga0111539_10273344 | Ga0111539_102733442 | 190 |
| 180 | 3300009094 | Ga0111539_10428958 | Ga0111539_104289582 | 190 |
| 181 | 3300009098 | Ga0105245_10519858 | Ga0105245_105198582 | 190 |
| 182 | 3300009147 | Ga0114129_10334822 | Ga0114129_103348222 | 190 |
| 183 | 3300009147 | Ga0114129_11444505 | Ga0114129_114445051 | 190 |
| 184 | 3300009148 | Ga0105243_11205097 | Ga0105243_112050971 | 190 |
| 185 | 3300009174 | Ga0105241_10140369 | Ga0105241_101403693 | 190 |
| 186 | 3300009174 | Ga0105241_10371532 | Ga0105241_103715322 | 190 |
| 187 | 3300009176 | Ga0105242_10170130 | Ga0105242_101701302 | 190 |
| 188 | 3300009176 | Ga0105242_10310994 | Ga0105242_103109942 | 190 |
| 189 | 3300009176 | Ga0105242_10494727 | Ga0105242_104947271 | 190 |
| 190 | 3300009177 | Ga0105248_10045905 | Ga0105248_100459053 | 190 |
| 191 | 3300009545 | Ga0105237_10012614 | Ga0105237_100126145 | 190 |
| 192 | 3300009545 | Ga0105237_10195176 | Ga0105237_101951762 | 190 |
| 193 | 3300009551 | Ga0105238_10004755 | Ga0105238_1000475517 | 190 |
| 194 | 3300009551 | Ga0105238_10051006 | Ga0105238_100510065 | 190 |
| 195 | 3300010375 | Ga0105239_10025635 | Ga0105239_100256357 | 190 |
| 196 | 3300010375 | Ga0105239_10166896 | Ga0105239_101668961 | 190 |
| 197 | 3300010375 | Ga0105239_10494532 | Ga0105239_104945322 | 190 |
| 198 | 3300011119 | Ga0105246_11019220 | Ga0105246_110192201 | 190 |
| 199 | 3300012480 | Ga0157346_1004119 | Ga0157346_10041191 | 190 |
| 200 | 3300012498 | Ga0157345_1007949 | Ga0157345_10079491 | 190 |
| 201 | 3300012500 | Ga0157314_1005956 | Ga0157314_10059561 | 190 |
| 202 | 3300013100 | Ga0157373_10091253 | Ga0157373_100912532 | 190 |
| 203 | 3300013100 | Ga0157373_10121839 | Ga0157373_101218392 | 190 |
| 204 | 3300013102 | Ga0157371_10086657 | Ga0157371_100866572 | 190 |
| 205 | 3300013102 | Ga0157371_10108338 | Ga0157371_101083382 | 190 |
| 206 | 3300013104 | Ga0157370_10002917 | Ga0157370_100029172 | 190 |
| 207 | 3300013104 | Ga0157370_10019520 | Ga0157370_100195201 | 190 |
| 208 | 3300013104 | Ga0157370_10057980 | Ga0157370_100579803 | 190 |
| 209 | 3300013104 | Ga0157370_10058800 | Ga0157370_100588004 | 190 |
| 210 | 3300013104 | Ga0157370_10192612 | Ga0157370_101926122 | 190 |
| 211 | 3300013105 | Ga0157369_10043031 | Ga0157369_100430315 | 190 |
| 212 | 3300013105 | Ga0157369_10105676 | Ga0157369_101056762 | 190 |
| 213 | 3300013105 | Ga0157369_10659029 | Ga0157369_106590293 | 190 |
| 214 | 3300013105 | Ga0157369_10766748 | Ga0157369_107667482 | 190 |
| 215 | 3300013296 | Ga0157374_10382933 | Ga0157374_103829332 | 190 |
| 216 | 3300013306 | Ga0163162_10051932 | Ga0163162_100519322 | 190 |
| 217 | 3300013306 | Ga0163162_10137974 | Ga0163162_101379741 | 190 |
| 218 | 3300013306 | Ga0163162_10155119 | Ga0163162_101551192 | 190 |
| 219 | 3300013306 | Ga0163162_10226497 | Ga0163162_102264973 | 190 |
| 220 | 3300013306 | Ga0163162_10826839 | Ga0163162_108268391 | 190 |
| 221 | 3300013307 | Ga0157372_10027442 | Ga0157372_100274429 | 190 |
| 222 | 3300013307 | Ga0157372_10039973 | Ga0157372_100399732 | 190 |
| 223 | 3300013307 | Ga0157372_10079596 | Ga0157372_100795963 | 190 |
| 224 | 3300013307 | Ga0157372_10080562 | Ga0157372_100805624 | 190 |
| 225 | 3300013307 | Ga0157372_10084219 | Ga0157372_100842192 | 190 |
| 226 | 3300013307 | Ga0157372_10084578 | Ga0157372_100845782 | 190 |
| 227 | 3300013307 | Ga0157372_10972635 | Ga0157372_109726351 | 190 |
| 228 | 3300013308 | Ga0157375_10000515 | Ga0157375_1000051532 | 190 |
| 229 | 3300013308 | Ga0157375_10122265 | Ga0157375_101222653 | 190 |
| 230 | 3300013308 | Ga0157375_10129493 | Ga0157375_101294933 | 190 |
| 231 | 3300013308 | Ga0157375_10260294 | Ga0157375_102602941 | 190 |
| 232 | 3300013308 | Ga0157375_10344393 | Ga0157375_103443932 | 190 |
| 233 | 3300013308 | Ga0157375_10818340 | Ga0157375_108183401 | 190 |
| 234 | 3300014325 | Ga0163163_10005444 | Ga0163163_1000544412 | 190 |
| 235 | 3300014325 | Ga0163163_10235613 | Ga0163163_102356131 | 190 |
| 236 | 3300014326 | Ga0157380_10112106 | Ga0157380_101121063 | 190 |
| 237 | 3300014326 | Ga0157380_10212156 | Ga0157380_102121561 | 190 |
| 238 | 3300014326 | Ga0157380_10432841 | Ga0157380_104328412 | 190 |
| 239 | 3300014497 | Ga0182008_10048342 | Ga0182008_100483423 | 190 |
| 240 | 3300014968 | Ga0157379_10337272 | Ga0157379_103372722 | 190 |
| 241 | 3300014968 | Ga0157379_11096169 | Ga0157379_110961691 | 190 |
| 242 | 3300014969 | Ga0157376_10027258 | Ga0157376_100272583 | 190 |
| 243 | 3300014969 | Ga0157376_10070177 | Ga0157376_100701772 | 190 |
| 244 | 3300014969 | Ga0157376_10240530 | Ga0157376_102405301 | 190 |
| 245 | 3300014969 | Ga0157376_10603434 | Ga0157376_106034342 | 190 |
| 246 | 3300014969 | Ga0157376_10633827 | Ga0157376_106338271 | 190 |
| 247 | 3300014969 | Ga0157376_10848875 | Ga0157376_108488751 | 190 |
| 248 | 3300015261 | Ga0182006_1016788 | Ga0182006_10167881 | 190 |
| 249 | 3300020069 | Ga0197907_10891830 | Ga0197907_108918301 | 190 |
| 250 | 3300020077 | Ga0206351_10345552 | Ga0206351_103455522 | 190 |
| 251 | 3300020078 | Ga0206352_10817169 | Ga0206352_108171691 | 190 |
| 252 | 3300020081 | Ga0206354_10417735 | Ga0206354_104177352 | 190 |
| 253 | 3300020082 | Ga0206353_11010918 | Ga0206353_110109182 | 190 |
| 254 | 3300020082 | Ga0206353_11851917 | Ga0206353_118519171 | 190 |
| 255 | 3300025246 | Ga0209646_1002458 | Ga0209646_10024584 | 190 |
| 256 | 3300025250 | Ga0209026_1000191 | Ga0209026_10001918 | 190 |
| 257 | 3300025256 | Ga0209759_1015071 | Ga0209759_10150712 | 190 |
| 258 | 3300025272 | Ga0209455_1000254 | Ga0209455_100025445 | 190 |
| 259 | 3300025315 | Ga0207697_10028515 | Ga0207697_100285154 | 190 |
| 260 | 3300025321 | Ga0207656_10204503 | Ga0207656_102045033 | 190 |
| 261 | 3300025893 | Ga0207682_10000698 | Ga0207682_100006981 | 190 |
| 262 | 3300025899 | Ga0207642_10015259 | Ga0207642_100152593 | 190 |
| 263 | 3300025899 | Ga0207642_10166560 | Ga0207642_101665601 | 190 |
| 264 | 3300025901 | Ga0207688_10034384 | Ga0207688_100343842 | 190 |
| 265 | 3300025903 | Ga0207680_10322244 | Ga0207680_103222442 | 190 |
| 266 | 3300025903 | Ga0207680_10622650 | Ga0207680_106226501 | 190 |
| 267 | 3300025904 | Ga0207647_10001470 | Ga0207647_100014706 | 190 |
| 268 | 3300025904 | Ga0207647_10003895 | Ga0207647_1000389510 | 190 |
| 269 | 3300025906 | Ga0207699_10320359 | Ga0207699_103203591 | 190 |
| 270 | 3300025909 | Ga0207705_10000087 | Ga0207705_1000008767 | 190 |
| 271 | 3300025909 | Ga0207705_10001012 | Ga0207705_100010122 | 190 |
| 272 | 3300025909 | Ga0207705_10005258 | Ga0207705_100052581 | 190 |
| 273 | 3300025909 | Ga0207705_10044574 | Ga0207705_100445742 | 190 |
| 274 | 3300025909 | Ga0207705_10461998 | Ga0207705_104619982 | 190 |
| 275 | 3300025911 | Ga0207654_10587387 | Ga0207654_105873872 | 190 |
| 276 | 3300025911 | Ga0207654_10741112 | Ga0207654_107411121 | 190 |
| 277 | 3300025912 | Ga0207707_10000389 | Ga0207707_1000038930 | 190 |
| 278 | 3300025912 | Ga0207707_10001714 | Ga0207707_1000171410 | 190 |
| 279 | 3300025912 | Ga0207707_10075083 | Ga0207707_100750832 | 190 |
| 280 | 3300025912 | Ga0207707_10397856 | Ga0207707_103978562 | 190 |
| 281 | 3300025913 | Ga0207695_10000859 | Ga0207695_1000085920 | 190 |
| 282 | 3300025913 | Ga0207695_10004333 | Ga0207695_1000433314 | 190 |
| 283 | 3300025914 | Ga0207671_10003290 | Ga0207671_100032905 | 190 |
| 284 | 3300025914 | Ga0207671_10118045 | Ga0207671_101180452 | 190 |
| 285 | 3300025916 | Ga0207663_10317038 | Ga0207663_103170382 | 190 |
| 286 | 3300025917 | Ga0207660_10001751 | Ga0207660_100017515 | 190 |
| 287 | 3300025917 | Ga0207660_10157471 | Ga0207660_101574712 | 190 |
| 288 | 3300025918 | Ga0207662_10115824 | Ga0207662_101158242 | 190 |
| 289 | 3300025918 | Ga0207662_10712632 | Ga0207662_107126321 | 190 |
| 290 | 3300025919 | Ga0207657_10007522 | Ga0207657_100075224 | 190 |
| 291 | 3300025919 | Ga0207657_10007728 | Ga0207657_100077285 | 190 |
| 292 | 3300025919 | Ga0207657_10262140 | Ga0207657_102621402 | 190 |
| 293 | 3300025920 | Ga0207649_10000488 | Ga0207649_1000048820 | 190 |
| 294 | 3300025920 | Ga0207649_10110506 | Ga0207649_101105063 | 190 |
| 295 | 3300025920 | Ga0207649_10166551 | Ga0207649_101665512 | 190 |
| 296 | 3300025921 | Ga0207652_10000072 | Ga0207652_1000007216 | 190 |
| 297 | 3300025921 | Ga0207652_10000418 | Ga0207652_100004182 | 190 |
| 298 | 3300025921 | Ga0207652_10025724 | Ga0207652_100257244 | 190 |
| 299 | 3300025921 | Ga0207652_10292771 | Ga0207652_102927712 | 190 |
| 300 | 3300025921 | Ga0207652_10418761 | Ga0207652_104187611 | 190 |
| 301 | 3300025923 | Ga0207681_10297090 | Ga0207681_102970902 | 190 |
| 302 | 3300025924 | Ga0207694_10003183 | Ga0207694_1000318311 | 190 |
| 303 | 3300025924 | Ga0207694_10043783 | Ga0207694_100437836 | 190 |
| 304 | 3300025924 | Ga0207694_10074869 | Ga0207694_100748692 | 190 |
| 305 | 3300025925 | Ga0207650_10044940 | Ga0207650_100449403 | 190 |
| 306 | 3300025926 | Ga0207659_10312564 | Ga0207659_103125642 | 190 |
| 307 | 3300025929 | Ga0207664_10000030 | Ga0207664_10000030100 | 190 |
| 308 | 3300025931 | Ga0207644_10049464 | Ga0207644_100494644 | 190 |
| 309 | 3300025931 | Ga0207644_10905835 | Ga0207644_109058351 | 190 |
| 310 | 3300025932 | Ga0207690_10001212 | Ga0207690_100012124 | 190 |
| 311 | 3300025932 | Ga0207690_10002243 | Ga0207690_1000224313 | 190 |
| 312 | 3300025932 | Ga0207690_10003044 | Ga0207690_100030444 | 190 |
| 313 | 3300025932 | Ga0207690_10003181 | Ga0207690_100031812 | 190 |
| 314 | 3300025932 | Ga0207690_10029894 | Ga0207690_100298944 | 190 |
| 315 | 3300025932 | Ga0207690_10203738 | Ga0207690_102037381 | 190 |
| 316 | 3300025932 | Ga0207690_10782882 | Ga0207690_107828821 | 190 |
| 317 | 3300025933 | Ga0207706_10011045 | Ga0207706_100110455 | 190 |
| 318 | 3300025933 | Ga0207706_10012233 | Ga0207706_100122333 | 190 |
| 319 | 3300025936 | Ga0207670_10600569 | Ga0207670_106005692 | 190 |
| 320 | 3300025937 | Ga0207669_10263006 | Ga0207669_102630061 | 190 |
| 321 | 3300025937 | Ga0207669_10305876 | Ga0207669_103058761 | 190 |
| 322 | 3300025940 | Ga0207691_10002909 | Ga0207691_100029099 | 190 |
| 323 | 3300025940 | Ga0207691_10090040 | Ga0207691_100900402 | 190 |
| 324 | 3300025940 | Ga0207691_10131865 | Ga0207691_101318654 | 190 |
| 325 | 3300025941 | Ga0207711_10179105 | Ga0207711_101791052 | 190 |
| 326 | 3300025944 | Ga0207661_10001043 | Ga0207661_100010432 | 190 |
| 327 | 3300025944 | Ga0207661_10072020 | Ga0207661_100720206 | 190 |
| 328 | 3300025945 | Ga0207679_10783622 | Ga0207679_107836221 | 190 |
| 329 | 3300025945 | Ga0207679_10848392 | Ga0207679_108483922 | 190 |
| 330 | 3300025949 | Ga0207667_10002947 | Ga0207667_100029474 | 190 |
| 331 | 3300025949 | Ga0207667_10005890 | Ga0207667_100058902 | 190 |
| 332 | 3300025949 | Ga0207667_10069645 | Ga0207667_100696452 | 190 |
| 333 | 3300025960 | Ga0207651_10410680 | Ga0207651_104106801 | 190 |
| 334 | 3300025960 | Ga0207651_10772673 | Ga0207651_107726732 | 190 |
| 335 | 3300025960 | Ga0207651_11266891 | Ga0207651_112668911 | 190 |
| 336 | 3300025972 | Ga0207668_10009932 | Ga0207668_100099324 | 190 |
| 337 | 3300025981 | Ga0207640_10000318 | Ga0207640_1000031817 | 190 |
| 338 | 3300026023 | Ga0207677_10088512 | Ga0207677_100885122 | 190 |
| 339 | 3300026041 | Ga0207639_10000702 | Ga0207639_1000070214 | 190 |
| 340 | 3300026041 | Ga0207639_10023502 | Ga0207639_100235022 | 190 |
| 341 | 3300026041 | Ga0207639_10058612 | Ga0207639_100586124 | 190 |
| 342 | 3300026041 | Ga0207639_10445995 | Ga0207639_104459951 | 190 |
| 343 | 3300026041 | Ga0207639_10617976 | Ga0207639_106179761 | 190 |
| 344 | 3300026041 | Ga0207639_10675673 | Ga0207639_106756732 | 190 |
| 345 | 3300026041 | Ga0207639_10853154 | Ga0207639_108531541 | 190 |
| 346 | 3300026067 | Ga0207678_10002600 | Ga0207678_1000260011 | 190 |
| 347 | 3300026067 | Ga0207678_10003732 | Ga0207678_100037325 | 190 |
| 348 | 3300026067 | Ga0207678_10003991 | Ga0207678_100039911 | 190 |
| 349 | 3300026078 | Ga0207702_10017644 | Ga0207702_100176445 | 190 |
| 350 | 3300026078 | Ga0207702_10051560 | Ga0207702_100515601 | 190 |
| 351 | 3300026078 | Ga0207702_10667831 | Ga0207702_106678311 | 190 |
| 352 | 3300026088 | Ga0207641_10048240 | Ga0207641_100482402 | 190 |
| 353 | 3300026088 | Ga0207641_10909023 | Ga0207641_109090231 | 190 |
| 354 | 3300026089 | Ga0207648_10027506 | Ga0207648_100275062 | 190 |
| 355 | 3300026089 | Ga0207648_10652961 | Ga0207648_106529611 | 190 |
| 356 | 3300026095 | Ga0207676_10057020 | Ga0207676_100570203 | 190 |
| 357 | 3300026095 | Ga0207676_10251675 | Ga0207676_102516751 | 190 |
| 358 | 3300026116 | Ga0207674_10015162 | Ga0207674_1001516211 | 190 |
| 359 | 3300026116 | Ga0207674_10033350 | Ga0207674_100333502 | 190 |
| 360 | 3300026116 | Ga0207674_10180112 | Ga0207674_101801123 | 190 |
| 361 | 3300026116 | Ga0207674_10293846 | Ga0207674_102938461 | 190 |
| 362 | 3300026118 | Ga0207675_100031005 | Ga0207675_1000310054 | 190 |
| 363 | 3300026121 | Ga0207683_10027254 | Ga0207683_100272545 | 190 |
| 364 | 3300026121 | Ga0207683_10099625 | Ga0207683_100996251 | 190 |
| 365 | 3300026121 | Ga0207683_10335066 | Ga0207683_103350661 | 190 |
| 366 | 3300026121 | Ga0207683_11159051 | Ga0207683_111590511 | 190 |
| 367 | 3300026142 | Ga0207698_10000056 | Ga0207698_1000005622 | 190 |
| 368 | 3300026142 | Ga0207698_10085773 | Ga0207698_100857733 | 190 |
| 369 | 3300027471 | Ga0209995_1022238 | Ga0209995_10222382 | 190 |
| 370 | 3300027552 | Ga0209982_1003417 | Ga0209982_10034172 | 190 |
| 371 | 3300027614 | Ga0209970_1040008 | Ga0209970_10400081 | 190 |
| 372 | 3300027617 | Ga0210002_1019676 | Ga0210002_10196761 | 190 |
| 373 | 3300027665 | Ga0209983_1007180 | Ga0209983_10071802 | 190 |
| 374 | 3300027717 | Ga0209998_10002040 | Ga0209998_100020405 | 190 |
| 375 | 3300027876 | Ga0209974_10002282 | Ga0209974_100022826 | 190 |
| 376 | 3300027876 | Ga0209974_10017167 | Ga0209974_100171673 | 190 |
| 377 | 3300031548 | Ga0307408_100008900 | Ga0307408_1000089002 | 190 |
| 378 | 3300031548 | Ga0307408_101172619 | Ga0307408_1011726191 | 190 |
| 379 | 3300031824 | Ga0307413_10013950 | Ga0307413_100139503 | 190 |
| 380 | 3300031852 | Ga0307410_10006588 | Ga0307410_100065882 | 190 |
| 381 | 3300031852 | Ga0307410_10541611 | Ga0307410_105416111 | 190 |
| 382 | 3300031901 | Ga0307406_10017628 | Ga0307406_100176283 | 190 |
| 383 | 3300031901 | Ga0307406_10423582 | Ga0307406_104235821 | 190 |
| 384 | 3300031903 | Ga0307407_10003544 | Ga0307407_100035445 | 190 |
| 385 | 3300031903 | Ga0307407_10206885 | Ga0307407_102068851 | 190 |
| 386 | 3300031903 | Ga0307407_10407207 | Ga0307407_104072072 | 190 |
| 387 | 3300031911 | Ga0307412_10267223 | Ga0307412_102672232 | 190 |
| 388 | 3300031995 | Ga0307409_100002989 | Ga0307409_1000029898 | 190 |
| 389 | 3300031995 | Ga0307409_101095423 | Ga0307409_1010954231 | 190 |
| 390 | 3300032002 | Ga0307416_100013899 | Ga0307416_1000138991 | 190 |
| 391 | 3300032002 | Ga0307416_100751352 | Ga0307416_1007513522 | 190 |
| 392 | 3300032002 | Ga0307416_101014260 | Ga0307416_1010142602 | 190 |
| 393 | 3300032002 | Ga0307416_101225211 | Ga0307416_1012252111 | 190 |
| 394 | 3300032004 | Ga0307414_10023504 | Ga0307414_100235042 | 190 |
| 395 | 3300032004 | Ga0307414_11083210 | Ga0307414_110832101 | 190 |
| 396 | 3300032005 | Ga0307411_10027766 | Ga0307411_100277662 | 190 |
| 397 | 3300032005 | Ga0307411_10112084 | Ga0307411_101120842 | 190 |
| 398 | 3300032126 | Ga0307415_100029168 | Ga0307415_1000291682 | 190 |
| 399 | 3300032126 | Ga0307415_101473990 | Ga0307415_1014739901 | 190 |
| 400 | 3300035113 | Ga0373936_0270722 | Ga0373936_0270722_57_674 | 190 |
| 401 | 3300035695 | Ga0373927_0501027 | Ga0373927_0501027_101_673 | 190 |
| 402 | 3300036401 | Ga0373937_0008060 | Ga0373937_0008060_5873_6490 | 190 |
| 403 | 3300037312 | Ga0395899_0181288 | Ga0395899_0181288_765_1337 | 190 |
| 404 | 3300037418 | Ga0395900_0000648 | Ga0395900_0000648_19731_20306 | 190 |
| 405 | 3300037418 | Ga0395900_0018592 | Ga0395900_0018592_4329_4901 | 190 |
| 406 | 3300037418 | Ga0395900_0242070 | Ga0395900_0242070_1215_1787 | 190 |
| 407 | 3300037418 | Ga0395900_0445675 | Ga0395900_0445675_417_989 | 190 |
| 408 | 3300037418 | Ga0395900_0620869 | Ga0395900_0620869_95_754 | 190 |
| 409 | 3300037466 | Ga0395898_0057714 | Ga0395898_0057714_453_1028 | 190 |
| 410 | 3300037466 | Ga0395898_0069831 | Ga0395898_0069831_2544_3116 | 190 |
| 411 | 3300038443 | Ga0395901_0012767 | Ga0395901_0012767_7531_8106 | 190 |
| 412 | 3300038443 | Ga0395901_0030757 | Ga0395901_0030757_2368_2940 | 190 |
| 413 | 3300038443 | Ga0395901_0084784 | Ga0395901_0084784_143_715 | 190 |
| 414 | 3300038443 | Ga0395901_0156609 | Ga0395901_0156609_1303_1875 | 190 |
| 415 | 3300038443 | Ga0395901_0258576 | Ga0395901_0258576_1215_1787 | 190 |
| 416 | 3300042006 | Ga0439432_134605 | Ga0439432_134605_74_649 | 190 |
| 417 | 3300042008 | Ga0439450_020222 | Ga0439450_020222_351_923 | 190 |
| 418 | 3300042876 | Ga0451577_0050191 | Ga0451577_0050191_3129_3701 | 190 |
| 419 | 3300044712 | Ga0453684_0039427 | Ga0453684_0039427_2989_3561 | 190 |
| 420 | 3300045049 | Ga0466959_0796989 | Ga0466959_0796989_29_604 | 190 |
| 421 | 3300045051 | Ga0451576_0026612 | Ga0451576_0026612_291_863 | 190 |
| 422 | 3300045051 | Ga0451576_0369536 | Ga0451576_0369536_845_1417 | 190 |
| 423 | 3300046472 | Ga0495580_0491390 | Ga0495580_0491390_71_688 | 190 |
| 424 | 3300046477 | Ga0495664_0024312 | Ga0495664_0024312_2738_3310 | 190 |
| 425 | 3300046499 | Ga0495594_0397530 | Ga0495594_0397530_110_682 | 190 |
| 426 | 3300046517 | Ga0495630_0540455 | Ga0495630_0540455_82_699 | 190 |
| 427 | 3300046528 | Ga0495642_0025950 | Ga0495642_0025950_311_883 | 190 |
| 428 | 3300046537 | Ga0495598_0005697 | Ga0495598_0005697_344_919 | 190 |
| 429 | 3300046539 | Ga0495621_0024615 | Ga0495621_0024615_260_841 | 190 |
| 430 | 3300046539 | Ga0495621_0158940 | Ga0495621_0158940_244_816 | 190 |
| 431 | 3300046543 | Ga0495645_0069577 | Ga0495645_0069577_438_1010 | 190 |
| 432 | 3300046543 | Ga0495645_0302043 | Ga0495645_0302043_268_885 | 190 |
| 433 | 3300046615 | Ga0495656_0001966 | Ga0495656_0001966_5239_5811 | 190 |
| 434 | 3300046616 | Ga0495668_0067979 | Ga0495668_0067979_800_1375 | 190 |
| 435 | 3300046681 | Ga0495647_0033053 | Ga0495647_0033053_244_861 | 190 |
| 436 | 3300047471 | Ga0495684_0349190 | Ga0495684_0349190_129_746 | 190 |
| 437 | 3300048907 | Ga0496104_0000020 | Ga0496104_0000020_195959_196531 | 190 |
| 438 | 3300048908 | Ga0496105_0000028 | Ga0496105_0000028_128221_128793 | 190 |
| 439 | 3300048909 | Ga0496106_0078689 | Ga0496106_0078689_350_922 | 190 |
| 440 | 3300048910 | Ga0496107_0697872 | Ga0496107_0697872_63_635 | 190 |
| 441 | 3300048913 | Ga0496110_0152213 | Ga0496110_0152213_140_712 | 190 |
| 442 | 3300048928 | Ga0496125_0389351 | Ga0496125_0389351_138_782 | 190 |
| 443 | 3300049568 | Ga0501031_0160047 | Ga0501031_0160047_91_663 | 190 |
| 444 | 3300049571 | Ga0501034_0078451 | Ga0501034_0078451_2398_2970 | 190 |
| 445 | 3300049572 | Ga0501036_0466839 | Ga0501036_0466839_208_780 | 190 |
| 446 | 3300049577 | Ga0501041_0472917 | Ga0501041_0472917_133_756 | 190 |
| 447 | 3300049586 | Ga0501070_0092195 | Ga0501070_0092195_179_751 | 190 |
| 448 | 3300049587 | Ga0501071_0239842 | Ga0501071_0239842_371_994 | 190 |
| 449 | 3300049592 | Ga0501076_0041556 | Ga0501076_0041556_2890_3513 | 190 |
| 450 | 3300049593 | Ga0501077_0350921 | Ga0501077_0350921_180_752 | 190 |
| 451 | 3300049649 | Ga0501198_026847 | Ga0501198_026847_294_869 | 190 |
| 452 | 3300049651 | Ga0501201_014520 | Ga0501201_014520_31_606 | 190 |
| 453 | 3300049669 | Ga0501235_043377 | Ga0501235_043377_20_595 | 190 |
| 454 | 3300049675 | Ga0501243_067839 | Ga0501243_067839_20_595 | 190 |
| 455 | 3300049682 | Ga0501252_020326 | Ga0501252_020326_45_620 | 190 |
| 456 | 3300049823 | Ga0501044_0303582 | Ga0501044_0303582_905_1477 | 190 |
| 457 | 3300050491 | nmdc:mga00v17_175094_c1 | nmdc:mga00v17_175094_c1_371_946 | 190 |
| 458 | 3300050492 | nmdc:mga0yw44_4335_c1 | nmdc:mga0yw44_4335_c1_306_878 | 190 |
| 459 | 3300050493 | nmdc:mga0k408_24267_c1 | nmdc:mga0k408_24267_c1_285_860 | 190 |
| 460 | 3300050494 | nmdc:mga06z11_323223_c1 | nmdc:mga06z11_323223_c1_56_631 | 190 |
| 461 | 3300050496 | nmdc:mga07m45_185353_c1 | nmdc:mga07m45_185353_c1_233_811 | 190 |
| 462 | 3300050507 | nmdc:mga05p37_642327_c1 | nmdc:mga05p37_642327_c1_309_881 | 190 |
| 463 | 3300050508 | nmdc:mga09592_281441_c1 | nmdc:mga09592_281441_c1_558_1133 | 190 |
| 464 | 3300050510 | nmdc:mga06r32_201907_c1 | nmdc:mga06r32_201907_c1_1131_1703 | 190 |
| 465 | 3300050511 | nmdc:mga08y16_408074_c1 | nmdc:mga08y16_408074_c1_326_898 | 190 |
| 466 | 3300050511 | nmdc:mga08y16_553342_c1 | nmdc:mga08y16_553342_c1_23_595 | 190 |
| 467 | 3300050512 | nmdc:mga0n895_1228359_c1 | nmdc:mga0n895_1228359_c1_23_595 | 190 |
| 468 | 3300053118 | Ga0500594_0000655 | Ga0500594_0000655_3003_3575 | 190 |
| 469 | 3300054114 | Ga0501084_0863975 | Ga0501084_0863975_163_744 | 190 |
| 470 | 3300061734 | Ga0530510_0332154 | Ga0530510_0332154_175_798 | 190 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3u7r-assembly1.cif.gz_A | ferb - flavoenzyme nad(p)h:(acceptor) oxidoreductase (ferb) from paracoccus denitrificans | 0.8662 | 3 | 184 |
| 1x77-assembly1.cif.gz_B | crystal structure of a nad(p)h-dependent fmn reductase complexed with fmn | 0.8621 | 5 | 176 |
| 4hs4-assembly1.cif.gz_G-1 | crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a y129n substitution. | 0.8594 | 2 | 182 |
| 4h6p-assembly1.cif.gz_A | crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a r101a substitution. | 0.8584 | 2 | 182 |
| 3u7r-assembly1.cif.gz_A | ferb - flavoenzyme nad(p)h:(acceptor) oxidoreductase (ferb) from paracoccus denitrificans | 0.8486 | 3 | 184 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1x77B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8621 | 5 | 176 | 3.40.50.360 |
| 3u7rB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8605 | 3 | 184 | 3.40.50.360 |
| 1x77B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8485 | 5 | 176 | 3.40.50.360 |
| 3u7rB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8425 | 3 | 184 | 3.40.50.360 |
| 3svlA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8395 | 3 | 179 | 3.40.50.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0M3GD83-F1-model_v4 | deleted | 0.9385 | 1 | 184 |
|
| AF-A0A544XEI9-F1-model_v4 | deleted | 0.9355 | 1 | 186 |
|
| AF-A0A3S1RJN2-F1-model_v4 | deleted | 0.9349 | 1 | 176 |
|
| AF-A0A848QE11-F1-model_v4 | deleted | 0.9309 | 1 | 114 |
|
| AF-A0A3S1RJN2-F1-model_v4 | deleted | 0.9298 | 1 | 176 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar