F450324

General Info

Members Datasets Scaffolds Average Seq Length
469 240 454 245

Family's Representative Sequence

Representative Sequence 3300053125|Ga0500618_001872|Ga0500618_001872_5167_6003
Length 278
Sequence MALASSSTCLSTFAPRHKFPKALTMTDNASQPAPQTASFGYEEVAIDEKVARVGEVFSSVAKKYDIMNDAMSAGMHRVWKDRFVRAVKPQPGEQILDMAGGTGDIAFRMAKRGAQITVSDINQDMLNVGMERAPKKLGDKAETLSWSCQNAEELSFESRSFDAYTIAFGIRNVTRVDKALAEAHRVLRYGGRFFCLEFSTTEWPGFREVYDAYSHKLVPQIGKMIAGDEDSYRYLIESIRRFPPMPEFEKMIRAAGFTQTKVEPIMGGLVAIHSGWKA

Samples

Sample ID Description Type Environment
1 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
4 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
5 2643221662 Devosia sp. Root413D1 Isolate Unclassified
6 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
7 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
8 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
9 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
10 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
11 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
12 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
13 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
14 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
15 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
16 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
17 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
21 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
22 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
23 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
74 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
141 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
145 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
146 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
147 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
151 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
152 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
153 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
154 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
155 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
156 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
157 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
158 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
159 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
160 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
161 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
162 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
163 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
167 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
168 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
171 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
174 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
206 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
207 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
208 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
209 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
210 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
211 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
222 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
223 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
224 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
225 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
226 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
227 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
228 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
229 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
230 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
231 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
232 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
233 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
234 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
235 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
236 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
237 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
240 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.8
Metatranscriptomes 0
Isolates 3.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.96
Nodule 0
Rhizoplane 5.12
Rhizosphere 76.33
Stem 0
Stem Tuber 0
Unclassified 9.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000281 3300001904 Bacteria 9332
2 JGI24736J21556_1000388 3300001904 Bacteria 8335
3 JGI24741J21665_1000248 3300001915 Bacteria 16054
4 JGI24752J21851_1010228 3300001976 Bacteria 1225
5 JGI24740J21852_10004796 3300001979 Bacteria 5767
6 JGI24737J22298_10001067 3300001990 Bacteria 9688
7 JGI24735J21928_10008771 3300002067 Bacteria 3262
8 JGI24750J21931_1007358 3300002070 Bacteria 1385
9 JGI24738J21930_10004918 3300002075 Bacteria 3240
10 JGI24749J21850_1000822 3300002076 Bacteria 4456
11 JGI24751J29686_10023264 3300002459 Bacteria 1285
12 Ga0065704_10035434 3300005289 Bacteria 1164
13 Ga0065707_10114849 3300005295 Bacteria 2285
14 Ga0065707_10161612 3300005295 Bacteria 1558
15 Ga0065707_10272658 3300005295 Bacteria 1067
16 Ga0070658_10018445 3300005327 Bacteria 5586
17 Ga0070670_100040533 3300005331 Bacteria 4003
18 Ga0070670_100134717 3300005331 Bacteria 2134
19 Ga0070670_100292819 3300005331 Bacteria 1423
20 Ga0070666_10000476 3300005335 Bacteria 24221
21 Ga0070666_10095383 3300005335 Bacteria 2047
22 Ga0070682_100135773 3300005337 Bacteria 1670
23 Ga0070660_100018569 3300005339 Bacteria 5084
24 Ga0070660_100072921 3300005339 Bacteria 2683
25 Ga0070661_100058277 3300005344 Bacteria 2830
26 Ga0070668_100000019 3300005347 Bacteria 98356
27 Ga0070668_100000064 3300005347 Bacteria 65793
28 Ga0070668_100019555 3300005347 Bacteria 5097
29 Ga0070668_100073222 3300005347 Bacteria 2671
30 Ga0070669_100000096 3300005353 Bacteria 86930
31 Ga0070669_100000483 3300005353 Bacteria 30250
32 Ga0070669_100035163 3300005353 Bacteria 3629
33 Ga0070669_100097726 3300005353 Bacteria 2211
34 Ga0070669_100110071 3300005353 Bacteria 2089
35 Ga0070669_100111697 3300005353 Bacteria 2075
36 Ga0070669_100122473 3300005353 Bacteria 1986
37 Ga0070671_100000045 3300005355 Bacteria 85779
38 Ga0070671_100000208 3300005355 Bacteria 38891
39 Ga0070671_100010845 3300005355 Bacteria 7312
40 Ga0070671_100339313 3300005355 Bacteria 1282
41 Ga0070659_100047783 3300005366 Bacteria 3359
42 Ga0070667_100000003 3300005367 Bacteria 447715
43 Ga0070667_100000094 3300005367 Bacteria 111140
44 Ga0070667_100000626 3300005367 Bacteria 34381
45 Ga0070667_100004495 3300005367 Bacteria 11767
46 Ga0070667_100154998 3300005367 Bacteria 2014
47 Ga0070705_100278344 3300005440 Bacteria 1188
48 Ga0070700_100247927 3300005441 Bacteria 1276
49 Ga0070708_100925942 3300005445 Bacteria 818
50 Ga0070663_100001800 3300005455 Bacteria 11922
51 Ga0070663_100120088 3300005455 Bacteria 1984
52 Ga0070685_10187421 3300005466 Bacteria 1336
53 Ga0068853_100787893 3300005539 Bacteria 910
54 Ga0070665_100016763 3300005548 Bacteria 7344
55 Ga0070665_100061760 3300005548 Bacteria 3757
56 Ga0070665_100779809 3300005548 Bacteria 969
57 Ga0068855_100003516 3300005563 Bacteria 19170
58 Ga0068855_100541765 3300005563 Bacteria 1261
59 Ga0068857_100024324 3300005577 Bacteria 5331
60 Ga0068857_100037860 3300005577 Bacteria 4273
61 Ga0068857_100467012 3300005577 Bacteria 1181
62 Ga0068854_100000822 3300005578 Bacteria 18526
63 Ga0068856_100358481 3300005614 Bacteria 1477
64 Ga0068852_100000232 3300005616 Bacteria 37715
65 Ga0068852_100187928 3300005616 Bacteria 1947
66 Ga0068852_100451877 3300005616 Bacteria 1272
67 Ga0068852_100560165 3300005616 Bacteria 1144
68 Ga0068859_100000162 3300005617 Bacteria 65033
69 Ga0068859_100014456 3300005617 Bacteria 7923
70 Ga0068859_100020051 3300005617 Bacteria 6714
71 Ga0068859_100118445 3300005617 Bacteria 2714
72 Ga0068859_100132544 3300005617 Bacteria 2564
73 Ga0068864_100000677 3300005618 Bacteria 28506
74 Ga0068864_100001835 3300005618 Bacteria 17465
75 Ga0068864_100004457 3300005618 Bacteria 11506
76 Ga0068864_100033443 3300005618 Bacteria 4371
77 Ga0068864_100270028 3300005618 Bacteria 1584
78 Ga0068861_100003029 3300005719 Bacteria 11100
79 Ga0068851_10026361 3300005834 Bacteria 2855
80 Ga0068863_100000052 3300005841 Bacteria 125430
81 Ga0068863_100000057 3300005841 Bacteria 123606
82 Ga0068863_100000784 3300005841 Bacteria 31931
83 Ga0068863_100028056 3300005841 Bacteria 5374
84 Ga0068863_100069154 3300005841 Bacteria 3339
85 Ga0068863_100173482 3300005841 Bacteria 2069
86 Ga0068858_100000892 3300005842 Bacteria 30965
87 Ga0068858_100002314 3300005842 Bacteria 19259
88 Ga0068858_100002691 3300005842 Bacteria 17896
89 Ga0068858_100015627 3300005842 Bacteria 7139
90 Ga0068858_100086913 3300005842 Bacteria 2908
91 Ga0068858_100293267 3300005842 Bacteria 1551
92 Ga0068860_100000007 3300005843 Bacteria 429329
93 Ga0068860_100000045 3300005843 Bacteria 223252
94 Ga0068860_100004945 3300005843 Bacteria 13583
95 Ga0068860_100009927 3300005843 Bacteria 9434
96 Ga0068860_100047625 3300005843 Bacteria 4085
97 Ga0068860_100228823 3300005843 Bacteria 1807
98 Ga0068860_100911790 3300005843 Bacteria 895
99 Ga0068862_100000385 3300005844 Bacteria 47562
100 Ga0068862_100001387 3300005844 Bacteria 22482
101 Ga0068862_100024968 3300005844 Bacteria 5017
102 Ga0068862_100078882 3300005844 Bacteria 2853
103 Ga0081455_10000187 3300005937 Bacteria 78623
104 Ga0081539_10069844 3300005985 Bacteria 1888
105 Ga0075368_10000241 3300006042 Bacteria 15395
106 Ga0075367_10000134 3300006178 Bacteria 22041
107 Ga0075370_10020641 3300006353 Bacteria 3604
108 Ga0075370_10030318 3300006353 Bacteria 3017
109 Ga0075370_10049565 3300006353 Bacteria 2381
110 Ga0075370_10101315 3300006353 Bacteria 1667
111 Ga0097620_100000162 3300006931 Bacteria 65033
112 Ga0097620_100014456 3300006931 Bacteria 7923
113 Ga0097620_100020051 3300006931 Bacteria 6714
114 Ga0097620_100118444 3300006931 Bacteria 2714
115 Ga0097620_100132551 3300006931 Bacteria 2564
116 Ga0105251_10012077 3300009011 Bacteria 4901
117 Ga0105240_10019610 3300009093 Bacteria 9033
118 Ga0111539_10354085 3300009094 Bacteria 1709
119 Ga0105247_10001548 3300009101 Bacteria 16396
120 Ga0114129_10738228 3300009147 Bacteria 1261
121 Ga0105243_10061762 3300009148 Bacteria 2998
122 Ga0105248_10029928 3300009177 Bacteria 6076
123 Ga0105248_10159422 3300009177 Bacteria 2545
124 Ga0105237_10025568 3300009545 Bacteria 6034
125 Ga0105237_10046314 3300009545 Bacteria 4374
126 Ga0105238_10585537 3300009551 Bacteria 1122
127 Ga0105249_10016302 3300009553 Bacteria 6590
128 Ga0105249_10246328 3300009553 Bacteria 1769
129 Ga0105249_10762832 3300009553 Bacteria 1030
130 Ga0105148_100217 3300009978 Bacteria 8303
131 Ga0105147_102038 3300009982 Bacteria 1657
132 Ga0105239_10082845 3300010375 Bacteria 3532
133 Ga0157370_10043502 3300013104 Bacteria 4321
134 Ga0163162_10000823 3300013306 Bacteria 28858
135 Ga0163163_10829050 3300014325 Bacteria 988
136 Ga0157380_10070278 3300014326 Bacteria 2828
137 Ga0157379_10011118 3300014968 Bacteria 7849
138 Ga0163161_10018115 3300017792 Bacteria 4937
139 Ga0213875_10000105 3300021388 Bacteria 96051
140 Ga0209147_100921 3300025229 Bacteria 13170
141 Ga0209050_1000262 3300025298 Bacteria 112798
142 Ga0207697_10001562 3300025315 Bacteria 12366
143 Ga0207656_10011306 3300025321 Bacteria 3371
144 Ga0207680_10000156 3300025903 Bacteria 33323
145 Ga0207680_10019218 3300025903 Bacteria 3649
146 Ga0207680_10037075 3300025903 Bacteria 2813
147 Ga0207647_10002267 3300025904 Bacteria 14654
148 Ga0207647_10003339 3300025904 Bacteria 12043
149 Ga0207705_10000199 3300025909 Bacteria 60726
150 Ga0207705_10000991 3300025909 Bacteria 23160
151 Ga0207705_10088132 3300025909 Bacteria 2270
152 Ga0207654_10019730 3300025911 Bacteria 3564
153 Ga0207695_10056638 3300025913 Bacteria 4078
154 Ga0207671_10016178 3300025914 Bacteria 5808
155 Ga0207671_10027757 3300025914 Bacteria 4232
156 Ga0207657_10012357 3300025919 Bacteria 8432
157 Ga0207657_10066767 3300025919 Bacteria 3061
158 Ga0207657_10412486 3300025919 Bacteria 1062
159 Ga0207649_10460549 3300025920 Bacteria 961
160 Ga0207652_10001433 3300025921 Bacteria 21127
161 Ga0207681_10000030 3300025923 Bacteria 173766
162 Ga0207681_10001967 3300025923 Bacteria 13174
163 Ga0207681_10007546 3300025923 Bacteria 6666
164 Ga0207681_10048748 3300025923 Bacteria 2860
165 Ga0207681_10077844 3300025923 Bacteria 2332
166 Ga0207681_10203010 3300025923 Bacteria 1523
167 Ga0207650_10004846 3300025925 Bacteria 9193
168 Ga0207650_10045369 3300025925 Bacteria 3234
169 Ga0207650_10483419 3300025925 Bacteria 1033
170 Ga0207644_10000017 3300025931 Bacteria 177818
171 Ga0207644_10000048 3300025931 Bacteria 102494
172 Ga0207644_10004676 3300025931 Bacteria 8901
173 Ga0207690_10168154 3300025932 Bacteria 1640
174 Ga0207706_10028297 3300025933 Bacteria 5006
175 Ga0207709_10052702 3300025935 Bacteria 2500
176 Ga0207711_10021763 3300025941 Bacteria 5354
177 Ga0207711_10146847 3300025941 Bacteria 2125
178 Ga0207711_10810677 3300025941 Bacteria 872
179 Ga0207667_10002574 3300025949 Bacteria 22543
180 Ga0207667_10007492 3300025949 Bacteria 13100
181 Ga0207667_10053873 3300025949 Bacteria 4232
182 Ga0207667_10058501 3300025949 Bacteria 4042
183 Ga0207712_10087039 3300025961 Bacteria 2290
184 Ga0207712_10148375 3300025961 Bacteria 1808
185 Ga0207668_10000030 3300025972 Bacteria 122797
186 Ga0207668_10000059 3300025972 Bacteria 91172
187 Ga0207668_10000620 3300025972 Bacteria 22083
188 Ga0207668_10271128 3300025972 Bacteria 1387
189 Ga0207640_10000687 3300025981 Bacteria 19687
190 Ga0207658_10000002 3300025986 Bacteria 1364188
191 Ga0207658_10000072 3300025986 Bacteria 112469
192 Ga0207658_10002739 3300025986 Bacteria 12726
193 Ga0207658_10041579 3300025986 Bacteria 3329
194 Ga0207658_10285590 3300025986 Bacteria 1416
195 Ga0207703_10000358 3300026035 Bacteria 49140
196 Ga0207703_10001073 3300026035 Bacteria 26059
197 Ga0207703_10003384 3300026035 Bacteria 13391
198 Ga0207703_10014527 3300026035 Bacteria 6143
199 Ga0207703_10016411 3300026035 Bacteria 5774
200 Ga0207703_10017723 3300026035 Bacteria 5560
201 Ga0207639_10000898 3300026041 Bacteria 20187
202 Ga0207639_10001983 3300026041 Bacteria 13774
203 Ga0207639_10870117 3300026041 Bacteria 842
204 Ga0207678_10000239 3300026067 Bacteria 49386
205 Ga0207678_10003769 3300026067 Bacteria 13635
206 Ga0207702_10001635 3300026078 Bacteria 22162
207 Ga0207641_10000042 3300026088 Bacteria 186384
208 Ga0207641_10000096 3300026088 Bacteria 123585
209 Ga0207641_10000720 3300026088 Bacteria 35557
210 Ga0207641_10001779 3300026088 Bacteria 20758
211 Ga0207641_10014895 3300026088 Bacteria 6375
212 Ga0207676_10001237 3300026095 Bacteria 19005
213 Ga0207676_10003709 3300026095 Bacteria 10800
214 Ga0207676_10038805 3300026095 Bacteria 3638
215 Ga0207676_10452109 3300026095 Bacteria 1211
216 Ga0207674_10005394 3300026116 Bacteria 15211
217 Ga0207674_10016029 3300026116 Bacteria 8209
218 Ga0207674_10033327 3300026116 Bacteria 5393
219 Ga0207674_10638166 3300026116 Bacteria 1028
220 Ga0207675_100000221 3300026118 Bacteria 53325
221 Ga0207698_10000005 3300026142 Bacteria 295687
222 Ga0207698_10037969 3300026142 Bacteria 3553
223 Ga0207698_10439482 3300026142 Bacteria 1256
224 Ga0209813_10000017 3300027866 Bacteria 75687
225 Ga0268266_10032911 3300028379 Bacteria 4406
226 Ga0268266_10062240 3300028379 Bacteria 3220
227 Ga0268266_10261839 3300028379 Bacteria 1603
228 Ga0268265_10000074 3300028380 Bacteria 127599
229 Ga0268265_10000469 3300028380 Bacteria 42727
230 Ga0268265_10019467 3300028380 Bacteria 4719
231 Ga0268264_10000101 3300028381 Bacteria 225109
232 Ga0268264_10000134 3300028381 Bacteria 179475
233 Ga0268264_10000215 3300028381 Bacteria 113994
234 Ga0268264_10018366 3300028381 Bacteria 5718
235 Ga0268264_10122258 3300028381 Bacteria 2296
236 Ga0265327_10127092 3300031251 Bacteria 1202
237 Ga0307408_100049577 3300031548 Bacteria 3016
238 Ga0307408_100065755 3300031548 Bacteria 2660
239 Ga0307408_100270885 3300031548 Bacteria 1409
240 Ga0307405_10077980 3300031731 Bacteria 2154
241 Ga0307413_10024961 3300031824 Bacteria 3267
242 Ga0307410_10035501 3300031852 Bacteria 3238
243 Ga0307410_10092571 3300031852 Bacteria 2149
244 Ga0307410_10542689 3300031852 Bacteria 962
245 Ga0307406_10213847 3300031901 Bacteria 1428
246 Ga0307407_10005829 3300031903 Bacteria 5397
247 Ga0307407_10019773 3300031903 Bacteria 3436
248 Ga0307407_10563674 3300031903 Bacteria 844
249 Ga0307412_10000495 3300031911 Bacteria 23495
250 Ga0307412_10016178 3300031911 Bacteria 4436
251 Ga0307412_10031934 3300031911 Bacteria 3330
252 Ga0307412_10032812 3300031911 Bacteria 3295
253 Ga0307412_10087525 3300031911 Bacteria 2170
254 Ga0307409_100050473 3300031995 Bacteria 3177
255 Ga0307409_100328443 3300031995 Bacteria 1434
256 Ga0307416_100047698 3300032002 Bacteria 3392
257 Ga0307416_100317116 3300032002 Bacteria 1559
258 Ga0307416_100389872 3300032002 Bacteria 1426
259 Ga0307414_10000684 3300032004 Bacteria 17354
260 Ga0307414_10624079 3300032004 Bacteria 969
261 Ga0307414_10897256 3300032004 Bacteria 812
262 Ga0307411_10017837 3300032005 Bacteria 4058
263 Ga0307411_10414183 3300032005 Bacteria 1117
264 Ga0307411_10644774 3300032005 Bacteria 916
265 Ga0307415_100083875 3300032126 Bacteria 2285
266 Ga0307415_100245238 3300032126 Bacteria 1452
267 Ga0307510_10262554 3300033180 Bacteria 1207
268 Ga0373927_0037237 3300035695 Bacteria 3163
269 Ga0373947_0209472 3300035725 Bacteria 1278
270 Ga0373925_0700626 3300037068 Bacteria 835
271 Ga0395901_0079668 3300038443 Bacteria 3420
272 Ga0451853_1393857 3300041512 Bacteria 1025
273 Ga0439462_0000217 3300042015 Bacteria 10109
274 Ga0450912_002471 3300042116 Bacteria 1245
275 Ga0453684_0176316 3300044712 Bacteria 2514
276 Ga0451576_0077646 3300045051 Bacteria 3456
277 Ga0451576_0758258 3300045051 Bacteria 1019
278 Ga0495627_000372 3300046453 Bacteria 41499
279 Ga0495627_000570 3300046453 Bacteria 29747
280 Ga0495627_001851 3300046453 Bacteria 11213
281 Ga0495650_0003903 3300046471 Bacteria 10531
282 Ga0495596_0000008 3300046500 Bacteria 150860
283 Ga0495596_0003454 3300046500 Bacteria 7990
284 Ga0495607_0004625 3300046501 Bacteria 10074
285 Ga0495583_0000072 3300046506 Bacteria 182057
286 Ga0495606_0003149 3300046507 Bacteria 17878
287 Ga0495610_0000033 3300046512 Bacteria 204151
288 Ga0495610_0000081 3300046512 Bacteria 113513
289 Ga0495610_0000268 3300046512 Bacteria 54316
290 Ga0495610_0003356 3300046512 Bacteria 12554
291 Ga0495616_0001098 3300046513 Bacteria 19261
292 Ga0495620_0003612 3300046515 Bacteria 8835
293 Ga0495631_0012804 3300046518 Bacteria 4087
294 Ga0495632_0000075 3300046519 Bacteria 102051
295 Ga0495632_0000171 3300046519 Bacteria 66639
296 Ga0495632_0000309 3300046519 Bacteria 47211
297 Ga0495632_0102618 3300046519 Bacteria 1347
298 Ga0495637_0000123 3300046520 Bacteria 57717
299 Ga0495637_0006355 3300046520 Bacteria 5938
300 Ga0495643_0000009 3300046522 Bacteria 344767
301 Ga0495643_0000077 3300046522 Bacteria 163843
302 Ga0495643_0002195 3300046522 Bacteria 15959
303 Ga0495643_0068907 3300046522 Bacteria 1861
304 Ga0495648_0000021 3300046524 Bacteria 246945
305 Ga0495648_0152164 3300046524 Bacteria 1206
306 Ga0495663_0000003 3300046525 Bacteria 362694
307 Ga0495654_0044457 3300046530 Bacteria 2197
308 Ga0495609_0002388 3300046538 Bacteria 11560
309 Ga0495597_0026417 3300046542 Bacteria 2667
310 Ga0495597_0097779 3300046542 Bacteria 1240
311 Ga0495622_0041861 3300046557 Bacteria 2130
312 Ga0495633_0000173 3300046558 Bacteria 84576
313 Ga0495633_0000834 3300046558 Bacteria 27197
314 Ga0495633_0005456 3300046558 Bacteria 7764
315 Ga0495633_0197982 3300046558 Bacteria 923
316 Ga0495668_0006451 3300046616 Bacteria 7679
317 Ga0495668_0017868 3300046616 Bacteria 4109
318 Ga0495668_0068107 3300046616 Bacteria 1958
319 Ga0495668_0304761 3300046616 Bacteria 873
320 Ga0495625_0012995 3300046660 Bacteria 6718
321 Ga0495625_0082093 3300046660 Bacteria 2242
322 Ga0495661_0141175 3300046665 Bacteria 1310
323 Ga0495671_0000013 3300046692 Bacteria 344767
324 Ga0495671_0000028 3300046692 Bacteria 234938
325 Ga0495671_0026112 3300046692 Bacteria 3030
326 Ga0495660_0179634 3300046810 Bacteria 1025
327 Ga0495672_0066763 3300047320 Bacteria 2051
328 Ga0495673_0000058 3300047469 Bacteria 235044
329 Ga0495673_0059329 3300047469 Bacteria 1645
330 Ga0495681_0000041 3300047470 Bacteria 119251
331 Ga0495681_0000059 3300047470 Bacteria 102400
332 Ga0495681_0001690 3300047470 Bacteria 16347
333 Ga0495686_0032850 3300047472 Bacteria 3356
334 Ga0495686_0045298 3300047472 Bacteria 2783
335 Ga0495615_0000301 3300048090 Bacteria 8555
336 Ga0495626_0002802 3300048091 Bacteria 11691
337 Ga0496100_0416374 3300048903 Bacteria 1025
338 Ga0496102_0000034 3300048905 Bacteria 213826
339 Ga0496103_0000026 3300048906 Bacteria 213826
340 Ga0496103_0036666 3300048906 Bacteria 3003
341 Ga0496103_0150097 3300048906 Bacteria 1493
342 Ga0496104_0055124 3300048907 Bacteria 3758
343 Ga0496105_0002144 3300048908 Bacteria 14295
344 Ga0496106_0005674 3300048909 Bacteria 9236
345 Ga0496107_0073171 3300048910 Bacteria 2492
346 Ga0496108_0140141 3300048911 Bacteria 2083
347 Ga0496109_0125714 3300048912 Bacteria 2391
348 Ga0496109_0277808 3300048912 Bacteria 1578
349 Ga0496110_0022610 3300048913 Bacteria 5341
350 Ga0496110_0034268 3300048913 Bacteria 4397
351 Ga0496110_0059304 3300048913 Bacteria 3373
352 Ga0496111_0081339 3300048914 Bacteria 2364
353 Ga0496111_0164716 3300048914 Bacteria 1646
354 Ga0496111_0204608 3300048914 Bacteria 1467
355 Ga0496111_0499392 3300048914 Bacteria 895
356 Ga0496112_0202578 3300048915 Bacteria 1943
357 Ga0496113_0288784 3300048916 Bacteria 1312
358 Ga0496113_0652246 3300048916 Bacteria 842
359 Ga0496114_0179412 3300048917 Bacteria 1849
360 Ga0496115_0316127 3300048918 Bacteria 1278
361 Ga0496116_0000062 3300048919 Bacteria 271104
362 Ga0496116_0010032 3300048919 Bacteria 7989
363 Ga0496117_0000072 3300048920 Bacteria 238366
364 Ga0496117_0014507 3300048920 Bacteria 6783
365 Ga0496117_0015022 3300048920 Bacteria 6633
366 Ga0496117_0024307 3300048920 Bacteria 4797
367 Ga0496118_0000030 3300048921 Bacteria 339946
368 Ga0496118_0022739 3300048921 Bacteria 5468
369 Ga0496118_0027419 3300048921 Bacteria 4820
370 Ga0496118_0076954 3300048921 Bacteria 2369
371 Ga0496119_0026304 3300048922 Bacteria 4038
372 Ga0496119_0049832 3300048922 Bacteria 2586
373 Ga0496121_0000065 3300048924 Bacteria 269310
374 Ga0496121_0000087 3300048924 Bacteria 222451
375 Ga0496121_0000196 3300048924 Bacteria 135812
376 Ga0496121_0015255 3300048924 Bacteria 8071
377 Ga0496122_0004355 3300048925 Bacteria 17692
378 Ga0496122_0010052 3300048925 Bacteria 9831
379 Ga0496122_0020834 3300048925 Bacteria 5900
380 Ga0496122_0061498 3300048925 Bacteria 2756
381 Ga0496123_0000545 3300048926 Bacteria 64687
382 Ga0496123_0000944 3300048926 Bacteria 45323
383 Ga0496123_0077549 3300048926 Bacteria 2040
384 Ga0496124_0000061 3300048927 Bacteria 238225
385 Ga0496124_0013522 3300048927 Bacteria 7960
386 Ga0496124_0014784 3300048927 Bacteria 7527
387 Ga0496124_0026937 3300048927 Bacteria 5173
388 Ga0496124_0080968 3300048927 Bacteria 2671
389 Ga0496124_0117392 3300048927 Bacteria 2131
390 Ga0496125_0041750 3300048928 Bacteria 3917
391 Ga0496125_0051925 3300048928 Bacteria 3376
392 Ga0496125_0054369 3300048928 Bacteria 3272
393 Ga0496125_0058919 3300048928 Bacteria 3098
394 Ga0496125_0074461 3300048928 Bacteria 2632
395 Ga0496126_0000801 3300048929 Bacteria 56279
396 Ga0496126_0006880 3300048929 Bacteria 12599
397 Ga0496126_0007548 3300048929 Bacteria 11899
398 Ga0496126_0087053 3300048929 Bacteria 2753
399 Ga0495678_027495 3300049459 Bacteria 2413
400 Ga0501034_0014247 3300049571 Bacteria 8196
401 Ga0501034_0032927 3300049571 Bacteria 5262
402 Ga0501072_0249747 3300049588 Bacteria 1413
403 Ga0501075_0212176 3300049591 Bacteria 1477
404 Ga0501076_0185418 3300049592 Bacteria 1697
405 Ga0501211_006620 3300049658 Bacteria 1143
406 Ga0501223_000056 3300049663 Bacteria 38016
407 Ga0501223_000072 3300049663 Bacteria 30438
408 Ga0501224_000004 3300049664 Bacteria 169090
409 Ga0501235_001470 3300049669 Bacteria 5037
410 Ga0501235_015594 3300049669 Bacteria 1676
411 Ga0501225_0000002 3300049705 Bacteria 147414
412 Ga0501225_0000060 3300049705 Bacteria 35405
413 Ga0501225_0001161 3300049705 Bacteria 8231
414 Ga0501225_0011492 3300049705 Bacteria 2489
415 Ga0501234_000247 3300049707 Bacteria 7831
416 Ga0501245_004415 3300049708 Bacteria 1930
417 Ga0501035_0327064 3300049822 Bacteria 1287
418 Ga0501045_0455482 3300049824 Bacteria 951
419 Ga0501226_000018 3300049853 Bacteria 147268
420 nmdc:mga00v17_45994_c1 3300050491 Bacteria 2639
421 nmdc:mga0k408_45398_c1 3300050493 Bacteria 2535
422 nmdc:mga06z11_20_c1 3300050494 Bacteria 75712
423 nmdc:mga04h51_108_c1 3300050495 Bacteria 24818
424 nmdc:mga07m45_37166_c1 3300050496 Bacteria 2715
425 nmdc:mga07m45_39006_c1 3300050496 Bacteria 2653
426 nmdc:mga07m45_58847_c1 3300050496 Bacteria 2174
427 nmdc:mga07m45_80608_c1 3300050496 Bacteria 1858
428 nmdc:mga08y16_390695_c1 3300050511 Bacteria 1425
429 Ga0500643_000172 3300053087 Bacteria 63436
430 Ga0500643_000195 3300053087 Bacteria 57960
431 Ga0500643_011200 3300053087 Bacteria 3286
432 Ga0500651_0001347 3300053093 Bacteria 12292
433 Ga0500556_0000025 3300053104 Bacteria 167307
434 Ga0500557_043441 3300053105 Bacteria 1418
435 Ga0500562_013826 3300053108 Bacteria 2064
436 Ga0500562_020333 3300053108 Bacteria 1723
437 Ga0500592_000031 3300053116 Bacteria 47686
438 Ga0500594_0111308 3300053118 Bacteria 852
439 Ga0500607_000077 3300053121 Bacteria 71543
440 Ga0500618_001872 3300053125 Bacteria 8758
441 Ga0500618_003530 3300053125 Bacteria 5325
442 Ga0500642_0000001 3300053130 Bacteria 1468402
443 Ga0500655_000024 3300053133 Bacteria 43300
444 Ga0500559_0000782 3300053136 Bacteria 20805
445 Ga0500559_0001720 3300053136 Bacteria 12005
446 Ga0500559_0017236 3300053136 Bacteria 3050
447 Ga0500590_001145 3300053148 Bacteria 10463
448 Ga0500590_001222 3300053148 Bacteria 10251
449 Ga0500622_0106262 3300053156 Bacteria 1376
450 Ga0500622_0224541 3300053156 Bacteria 840
451 Ga0500624_000028 3300053157 Bacteria 106675
452 Ga0500570_016370 3300053724 Bacteria 4154
453 Ga0500645_003231 3300053730 Bacteria 6744
454 Ga0501082_0590672 3300060353 Bacteria 972

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053136 Ga0500559_0001720 Ga0500559_0001720_11363_11992 209
2 3300048914 Ga0496111_0164716 Ga0496111_0164716_19_717 232
3 3300046522 Ga0495643_0068907 Ga0495643_0068907_279_986 234
4 3300005985 Ga0081539_10069844 Ga0081539_100698442 238
5 iso_pu_bacteria 2512564014 2512645016 239
6 iso_pu_bacteria 2582581305 2585260477 239
7 iso_pu_bacteria 2643221588 2643950760 239
8 iso_pu_bacteria 2643221662 2644346296 239
9 iso_pu_bacteria 2775507255 2778126811 239
10 iso_pu_bacteria 2808606401 2809064884 239
11 iso_pu_bacteria 2808606404 2809080950 239
12 iso_pu_bacteria 2808606405 2809085216 239
13 iso_pu_bacteria 2818991438 2819554691 239
14 iso_pu_bacteria 2880518877 2880521949 239
15 iso_pu_bacteria 2919709256 2919709869 239
16 iso_pu_bacteria 8057101203 8057104511 239
17 iso_pu_bacteria 2510917021 2511126454 240
18 3300001904 JGI24736J21556_1000281 JGI24736J21556_100028111 242
19 3300001904 JGI24736J21556_1000388 JGI24736J21556_10003882 242
20 3300001915 JGI24741J21665_1000248 JGI24741J21665_10002489 242
21 3300001976 JGI24752J21851_1010228 JGI24752J21851_10102282 242
22 3300001979 JGI24740J21852_10004796 JGI24740J21852_100047962 242
23 3300001990 JGI24737J22298_10001067 JGI24737J22298_100010678 242
24 3300002067 JGI24735J21928_10008771 JGI24735J21928_100087712 242
25 3300002070 JGI24750J21931_1007358 JGI24750J21931_10073581 242
26 3300002075 JGI24738J21930_10004918 JGI24738J21930_100049182 242
27 3300002076 JGI24749J21850_1000822 JGI24749J21850_10008222 242
28 3300002459 JGI24751J29686_10023264 JGI24751J29686_100232642 242
29 3300005289 Ga0065704_10035434 Ga0065704_100354342 242
30 3300005295 Ga0065707_10114849 Ga0065707_101148493 242
31 3300005295 Ga0065707_10161612 Ga0065707_101616122 242
32 3300005295 Ga0065707_10272658 Ga0065707_102726582 242
33 3300005327 Ga0070658_10018445 Ga0070658_100184453 242
34 3300005331 Ga0070670_100040533 Ga0070670_1000405334 242
35 3300005331 Ga0070670_100134717 Ga0070670_1001347172 242
36 3300005331 Ga0070670_100292819 Ga0070670_1002928192 242
37 3300005335 Ga0070666_10000476 Ga0070666_1000047620 242
38 3300005335 Ga0070666_10095383 Ga0070666_100953832 242
39 3300005337 Ga0070682_100135773 Ga0070682_1001357732 242
40 3300005339 Ga0070660_100018569 Ga0070660_1000185692 242
41 3300005339 Ga0070660_100072921 Ga0070660_1000729212 242
42 3300005344 Ga0070661_100058277 Ga0070661_1000582773 242
43 3300005347 Ga0070668_100000019 Ga0070668_10000001937 242
44 3300005347 Ga0070668_100000064 Ga0070668_10000006430 242
45 3300005347 Ga0070668_100019555 Ga0070668_1000195554 242
46 3300005347 Ga0070668_100073222 Ga0070668_1000732222 242
47 3300005353 Ga0070669_100000096 Ga0070669_10000009660 242
48 3300005353 Ga0070669_100000483 Ga0070669_10000048326 242
49 3300005353 Ga0070669_100035163 Ga0070669_1000351633 242
50 3300005353 Ga0070669_100097726 Ga0070669_1000977262 242
51 3300005353 Ga0070669_100110071 Ga0070669_1001100712 242
52 3300005353 Ga0070669_100111697 Ga0070669_1001116972 242
53 3300005353 Ga0070669_100122473 Ga0070669_1001224731 242
54 3300005355 Ga0070671_100000045 Ga0070671_10000004552 242
55 3300005355 Ga0070671_100000208 Ga0070671_10000020823 242
56 3300005355 Ga0070671_100010845 Ga0070671_1000108452 242
57 3300005355 Ga0070671_100339313 Ga0070671_1003393131 242
58 3300005366 Ga0070659_100047783 Ga0070659_1000477832 242
59 3300005367 Ga0070667_100000003 Ga0070667_100000003293 242
60 3300005367 Ga0070667_100000094 Ga0070667_10000009453 242
61 3300005367 Ga0070667_100000626 Ga0070667_10000062623 242
62 3300005367 Ga0070667_100004495 Ga0070667_10000449513 242
63 3300005367 Ga0070667_100154998 Ga0070667_1001549982 242
64 3300005440 Ga0070705_100278344 Ga0070705_1002783441 242
65 3300005441 Ga0070700_100247927 Ga0070700_1002479272 242
66 3300005445 Ga0070708_100925942 Ga0070708_1009259421 242
67 3300005455 Ga0070663_100001800 Ga0070663_10000180011 242
68 3300005455 Ga0070663_100120088 Ga0070663_1001200883 242
69 3300005466 Ga0070685_10187421 Ga0070685_101874212 242
70 3300005539 Ga0068853_100787893 Ga0068853_1007878931 242
71 3300005548 Ga0070665_100016763 Ga0070665_1000167635 242
72 3300005548 Ga0070665_100061760 Ga0070665_1000617602 242
73 3300005548 Ga0070665_100779809 Ga0070665_1007798092 242
74 3300005563 Ga0068855_100003516 Ga0068855_1000035165 242
75 3300005563 Ga0068855_100541765 Ga0068855_1005417651 242
76 3300005577 Ga0068857_100024324 Ga0068857_1000243245 242
77 3300005577 Ga0068857_100037860 Ga0068857_1000378605 242
78 3300005577 Ga0068857_100467012 Ga0068857_1004670122 242
79 3300005578 Ga0068854_100000822 Ga0068854_1000008227 242
80 3300005614 Ga0068856_100358481 Ga0068856_1003584812 242
81 3300005616 Ga0068852_100000232 Ga0068852_10000023212 242
82 3300005616 Ga0068852_100187928 Ga0068852_1001879282 242
83 3300005616 Ga0068852_100451877 Ga0068852_1004518772 242
84 3300005616 Ga0068852_100560165 Ga0068852_1005601652 242
85 3300005617 Ga0068859_100000162 Ga0068859_10000016252 242
86 3300005617 Ga0068859_100014456 Ga0068859_1000144567 242
87 3300005617 Ga0068859_100020051 Ga0068859_1000200517 242
88 3300005617 Ga0068859_100118445 Ga0068859_1001184453 242
89 3300005617 Ga0068859_100132544 Ga0068859_1001325442 242
90 3300005618 Ga0068864_100000677 Ga0068864_1000006775 242
91 3300005618 Ga0068864_100001835 Ga0068864_10000183516 242
92 3300005618 Ga0068864_100004457 Ga0068864_1000044573 242
93 3300005618 Ga0068864_100033443 Ga0068864_1000334433 242
94 3300005618 Ga0068864_100270028 Ga0068864_1002700282 242
95 3300005719 Ga0068861_100003029 Ga0068861_1000030295 242
96 3300005834 Ga0068851_10026361 Ga0068851_100263611 242
97 3300005841 Ga0068863_100000052 Ga0068863_10000005273 242
98 3300005841 Ga0068863_100000057 Ga0068863_10000005753 242
99 3300005841 Ga0068863_100000784 Ga0068863_10000078439 242
100 3300005841 Ga0068863_100028056 Ga0068863_1000280562 242
101 3300005841 Ga0068863_100069154 Ga0068863_1000691542 242
102 3300005841 Ga0068863_100173482 Ga0068863_1001734822 242
103 3300005842 Ga0068858_100000892 Ga0068858_10000089219 242
104 3300005842 Ga0068858_100002314 Ga0068858_1000023144 242
105 3300005842 Ga0068858_100002691 Ga0068858_10000269114 242
106 3300005842 Ga0068858_100015627 Ga0068858_1000156277 242
107 3300005842 Ga0068858_100086913 Ga0068858_1000869132 242
108 3300005842 Ga0068858_100293267 Ga0068858_1002932672 242
109 3300005843 Ga0068860_100000007 Ga0068860_100000007344 242
110 3300005843 Ga0068860_100000045 Ga0068860_10000004562 242
111 3300005843 Ga0068860_100004945 Ga0068860_10000494514 242
112 3300005843 Ga0068860_100009927 Ga0068860_1000099279 242
113 3300005843 Ga0068860_100047625 Ga0068860_1000476252 242
114 3300005843 Ga0068860_100228823 Ga0068860_1002288232 242
115 3300005843 Ga0068860_100911790 Ga0068860_1009117902 242
116 3300005844 Ga0068862_100000385 Ga0068862_10000038536 242
117 3300005844 Ga0068862_100001387 Ga0068862_10000138716 242
118 3300005844 Ga0068862_100024968 Ga0068862_1000249682 242
119 3300005844 Ga0068862_100078882 Ga0068862_1000788823 242
120 3300005937 Ga0081455_10000187 Ga0081455_1000018744 242
121 3300006042 Ga0075368_10000241 Ga0075368_1000024111 242
122 3300006178 Ga0075367_10000134 Ga0075367_1000013419 242
123 3300006353 Ga0075370_10020641 Ga0075370_100206413 242
124 3300006353 Ga0075370_10030318 Ga0075370_100303182 242
125 3300006353 Ga0075370_10049565 Ga0075370_100495652 242
126 3300006353 Ga0075370_10101315 Ga0075370_101013152 242
127 3300006931 Ga0097620_100000162 Ga0097620_10000016252 242
128 3300006931 Ga0097620_100014456 Ga0097620_1000144567 242
129 3300006931 Ga0097620_100020051 Ga0097620_1000200517 242
130 3300006931 Ga0097620_100118444 Ga0097620_1001184443 242
131 3300006931 Ga0097620_100132551 Ga0097620_1001325512 242
132 3300009011 Ga0105251_10012077 Ga0105251_100120772 242
133 3300009093 Ga0105240_10019610 Ga0105240_100196104 242
134 3300009094 Ga0111539_10354085 Ga0111539_103540852 242
135 3300009101 Ga0105247_10001548 Ga0105247_100015484 242
136 3300009147 Ga0114129_10738228 Ga0114129_107382282 242
137 3300009148 Ga0105243_10061762 Ga0105243_100617622 242
138 3300009177 Ga0105248_10029928 Ga0105248_100299282 242
139 3300009177 Ga0105248_10159422 Ga0105248_101594222 242
140 3300009545 Ga0105237_10025568 Ga0105237_100255683 242
141 3300009545 Ga0105237_10046314 Ga0105237_100463144 242
142 3300009551 Ga0105238_10585537 Ga0105238_105855372 242
143 3300009553 Ga0105249_10016302 Ga0105249_100163027 242
144 3300009553 Ga0105249_10246328 Ga0105249_102463282 242
145 3300009553 Ga0105249_10762832 Ga0105249_107628321 242
146 3300009978 Ga0105148_100217 Ga0105148_1002171 242
147 3300009982 Ga0105147_102038 Ga0105147_1020382 242
148 3300010375 Ga0105239_10082845 Ga0105239_100828452 242
149 3300013104 Ga0157370_10043502 Ga0157370_100435022 242
150 3300013306 Ga0163162_10000823 Ga0163162_1000082322 242
151 3300014325 Ga0163163_10829050 Ga0163163_108290501 242
152 3300014326 Ga0157380_10070278 Ga0157380_100702782 242
153 3300014968 Ga0157379_10011118 Ga0157379_100111182 242
154 3300017792 Ga0163161_10018115 Ga0163161_100181152 242
155 3300021388 Ga0213875_10000105 Ga0213875_1000010577 242
156 3300025229 Ga0209147_100921 Ga0209147_10092115 242
157 3300025298 Ga0209050_1000262 Ga0209050_100026274 242
158 3300025315 Ga0207697_10001562 Ga0207697_100015624 242
159 3300025321 Ga0207656_10011306 Ga0207656_100113062 242
160 3300025903 Ga0207680_10000156 Ga0207680_100001569 242
161 3300025903 Ga0207680_10019218 Ga0207680_100192182 242
162 3300025903 Ga0207680_10037075 Ga0207680_100370752 242
163 3300025904 Ga0207647_10002267 Ga0207647_100022675 242
164 3300025904 Ga0207647_10003339 Ga0207647_100033393 242
165 3300025909 Ga0207705_10000199 Ga0207705_1000019915 242
166 3300025909 Ga0207705_10000991 Ga0207705_1000099119 242
167 3300025909 Ga0207705_10088132 Ga0207705_100881322 242
168 3300025911 Ga0207654_10019730 Ga0207654_100197302 242
169 3300025913 Ga0207695_10056638 Ga0207695_100566383 242
170 3300025914 Ga0207671_10016178 Ga0207671_100161783 242
171 3300025914 Ga0207671_10027757 Ga0207671_100277573 242
172 3300025919 Ga0207657_10012357 Ga0207657_100123575 242
173 3300025919 Ga0207657_10066767 Ga0207657_100667672 242
174 3300025919 Ga0207657_10412486 Ga0207657_104124862 242
175 3300025920 Ga0207649_10460549 Ga0207649_104605491 242
176 3300025921 Ga0207652_10001433 Ga0207652_1000143319 242
177 3300025923 Ga0207681_10000030 Ga0207681_10000030141 242
178 3300025923 Ga0207681_10001967 Ga0207681_1000196710 242
179 3300025923 Ga0207681_10007546 Ga0207681_1000754610 242
180 3300025923 Ga0207681_10048748 Ga0207681_100487483 242
181 3300025923 Ga0207681_10077844 Ga0207681_100778442 242
182 3300025923 Ga0207681_10203010 Ga0207681_102030102 242
183 3300025925 Ga0207650_10004846 Ga0207650_100048467 242
184 3300025925 Ga0207650_10045369 Ga0207650_100453693 242
185 3300025925 Ga0207650_10483419 Ga0207650_104834191 242
186 3300025931 Ga0207644_10000017 Ga0207644_10000017143 242
187 3300025931 Ga0207644_10000048 Ga0207644_1000004821 242
188 3300025931 Ga0207644_10004676 Ga0207644_100046763 242
189 3300025932 Ga0207690_10168154 Ga0207690_101681542 242
190 3300025933 Ga0207706_10028297 Ga0207706_100282972 242
191 3300025935 Ga0207709_10052702 Ga0207709_100527021 242
192 3300025941 Ga0207711_10021763 Ga0207711_100217633 242
193 3300025941 Ga0207711_10146847 Ga0207711_101468472 242
194 3300025941 Ga0207711_10810677 Ga0207711_108106771 242
195 3300025949 Ga0207667_10002574 Ga0207667_1000257422 242
196 3300025949 Ga0207667_10007492 Ga0207667_100074924 242
197 3300025949 Ga0207667_10053873 Ga0207667_100538734 242
198 3300025949 Ga0207667_10058501 Ga0207667_100585012 242
199 3300025961 Ga0207712_10087039 Ga0207712_100870392 242
200 3300025961 Ga0207712_10148375 Ga0207712_101483752 242
201 3300025972 Ga0207668_10000030 Ga0207668_1000003088 242
202 3300025972 Ga0207668_10000059 Ga0207668_1000005940 242
203 3300025972 Ga0207668_10000620 Ga0207668_100006207 242
204 3300025972 Ga0207668_10271128 Ga0207668_102711282 242
205 3300025981 Ga0207640_10000687 Ga0207640_1000068710 242
206 3300025986 Ga0207658_10000002 Ga0207658_100000021194 242
207 3300025986 Ga0207658_10000072 Ga0207658_1000007265 242
208 3300025986 Ga0207658_10002739 Ga0207658_1000273913 242
209 3300025986 Ga0207658_10041579 Ga0207658_100415792 242
210 3300025986 Ga0207658_10285590 Ga0207658_102855902 242
211 3300026035 Ga0207703_10000358 Ga0207703_1000035830 242
212 3300026035 Ga0207703_10001073 Ga0207703_100010732 242
213 3300026035 Ga0207703_10003384 Ga0207703_100033847 242
214 3300026035 Ga0207703_10014527 Ga0207703_100145275 242
215 3300026035 Ga0207703_10016411 Ga0207703_100164112 242
216 3300026035 Ga0207703_10017723 Ga0207703_100177235 242
217 3300026041 Ga0207639_10000898 Ga0207639_100008983 242
218 3300026041 Ga0207639_10001983 Ga0207639_1000198311 242
219 3300026041 Ga0207639_10870117 Ga0207639_108701172 242
220 3300026067 Ga0207678_10000239 Ga0207678_1000023936 242
221 3300026067 Ga0207678_10003769 Ga0207678_1000376910 242
222 3300026078 Ga0207702_10001635 Ga0207702_100016356 242
223 3300026088 Ga0207641_10000042 Ga0207641_1000004273 242
224 3300026088 Ga0207641_10000096 Ga0207641_1000009652 242
225 3300026088 Ga0207641_10000720 Ga0207641_100007206 242
226 3300026088 Ga0207641_10001779 Ga0207641_100017792 242
227 3300026088 Ga0207641_10014895 Ga0207641_100148953 242
228 3300026095 Ga0207676_10001237 Ga0207676_1000123717 242
229 3300026095 Ga0207676_10003709 Ga0207676_100037097 242
230 3300026095 Ga0207676_10038805 Ga0207676_100388052 242
231 3300026095 Ga0207676_10452109 Ga0207676_104521091 242
232 3300026116 Ga0207674_10005394 Ga0207674_1000539411 242
233 3300026116 Ga0207674_10016029 Ga0207674_100160296 242
234 3300026116 Ga0207674_10033327 Ga0207674_100333275 242
235 3300026116 Ga0207674_10638166 Ga0207674_106381661 242
236 3300026118 Ga0207675_100000221 Ga0207675_10000022152 242
237 3300026142 Ga0207698_10000005 Ga0207698_1000000529 242
238 3300026142 Ga0207698_10037969 Ga0207698_100379693 242
239 3300026142 Ga0207698_10439482 Ga0207698_104394822 242
240 3300027866 Ga0209813_10000017 Ga0209813_1000001723 242
241 3300028379 Ga0268266_10032911 Ga0268266_100329112 242
242 3300028379 Ga0268266_10062240 Ga0268266_100622402 242
243 3300028379 Ga0268266_10261839 Ga0268266_102618392 242
244 3300028380 Ga0268265_10000074 Ga0268265_1000007434 242
245 3300028380 Ga0268265_10000469 Ga0268265_1000046923 242
246 3300028380 Ga0268265_10019467 Ga0268265_100194675 242
247 3300028381 Ga0268264_10000101 Ga0268264_1000010164 242
248 3300028381 Ga0268264_10000134 Ga0268264_1000013471 242
249 3300028381 Ga0268264_10000215 Ga0268264_1000021578 242
250 3300028381 Ga0268264_10018366 Ga0268264_100183662 242
251 3300028381 Ga0268264_10122258 Ga0268264_101222582 242
252 3300031251 Ga0265327_10127092 Ga0265327_101270922 242
253 3300031548 Ga0307408_100049577 Ga0307408_1000495772 242
254 3300031548 Ga0307408_100065755 Ga0307408_1000657553 242
255 3300031548 Ga0307408_100270885 Ga0307408_1002708852 242
256 3300031731 Ga0307405_10077980 Ga0307405_100779802 242
257 3300031824 Ga0307413_10024961 Ga0307413_100249612 242
258 3300031852 Ga0307410_10035501 Ga0307410_100355014 242
259 3300031852 Ga0307410_10092571 Ga0307410_100925713 242
260 3300031852 Ga0307410_10542689 Ga0307410_105426891 242
261 3300031901 Ga0307406_10213847 Ga0307406_102138472 242
262 3300031903 Ga0307407_10005829 Ga0307407_100058295 242
263 3300031903 Ga0307407_10019773 Ga0307407_100197733 242
264 3300031903 Ga0307407_10563674 Ga0307407_105636741 242
265 3300031911 Ga0307412_10000495 Ga0307412_1000049515 242
266 3300031911 Ga0307412_10016178 Ga0307412_100161784 242
267 3300031911 Ga0307412_10031934 Ga0307412_100319343 242
268 3300031911 Ga0307412_10032812 Ga0307412_100328123 242
269 3300031911 Ga0307412_10087525 Ga0307412_100875252 242
270 3300031995 Ga0307409_100050473 Ga0307409_1000504734 242
271 3300031995 Ga0307409_100328443 Ga0307409_1003284432 242
272 3300032002 Ga0307416_100047698 Ga0307416_1000476983 242
273 3300032002 Ga0307416_100317116 Ga0307416_1003171162 242
274 3300032002 Ga0307416_100389872 Ga0307416_1003898722 242
275 3300032004 Ga0307414_10000684 Ga0307414_100006846 242
276 3300032004 Ga0307414_10624079 Ga0307414_106240791 242
277 3300032004 Ga0307414_10897256 Ga0307414_108972561 242
278 3300032005 Ga0307411_10017837 Ga0307411_100178372 242
279 3300032005 Ga0307411_10414183 Ga0307411_104141832 242
280 3300032005 Ga0307411_10644774 Ga0307411_106447741 242
281 3300032126 Ga0307415_100083875 Ga0307415_1000838752 242
282 3300032126 Ga0307415_100245238 Ga0307415_1002452382 242
283 3300033180 Ga0307510_10262554 Ga0307510_102625542 242
284 3300035695 Ga0373927_0037237 Ga0373927_0037237_36_767 242
285 3300035725 Ga0373947_0209472 Ga0373947_0209472_90_821 242
286 3300037068 Ga0373925_0700626 Ga0373925_0700626_53_784 242
287 3300038443 Ga0395901_0079668 Ga0395901_0079668_1823_2641 242
288 3300041512 Ga0451853_1393857 Ga0451853_1393857_214_945 242
289 3300042015 Ga0439462_0000217 Ga0439462_0000217_6281_7012 242
290 3300042116 Ga0450912_002471 Ga0450912_002471_434_1165 242
291 3300044712 Ga0453684_0176316 Ga0453684_0176316_140_871 242
292 3300045051 Ga0451576_0077646 Ga0451576_0077646_2437_3180 242
293 3300045051 Ga0451576_0758258 Ga0451576_0758258_238_969 242
294 3300046453 Ga0495627_000372 Ga0495627_000372_13835_14566 242
295 3300046453 Ga0495627_000570 Ga0495627_000570_23249_23980 242
296 3300046453 Ga0495627_001851 Ga0495627_001851_9259_9990 242
297 3300046471 Ga0495650_0003903 Ga0495650_0003903_1441_2172 242
298 3300046500 Ga0495596_0000008 Ga0495596_0000008_21838_22578 242
299 3300046500 Ga0495596_0003454 Ga0495596_0003454_4291_5022 242
300 3300046501 Ga0495607_0004625 Ga0495607_0004625_5770_6510 242
301 3300046506 Ga0495583_0000072 Ga0495583_0000072_130597_131328 242
302 3300046507 Ga0495606_0003149 Ga0495606_0003149_8848_9588 242
303 3300046512 Ga0495610_0000033 Ga0495610_0000033_137604_138335 242
304 3300046512 Ga0495610_0000081 Ga0495610_0000081_12403_13143 242
305 3300046512 Ga0495610_0000268 Ga0495610_0000268_38290_39021 242
306 3300046512 Ga0495610_0003356 Ga0495610_0003356_5527_6258 242
307 3300046513 Ga0495616_0001098 Ga0495616_0001098_16748_17479 242
308 3300046515 Ga0495620_0003612 Ga0495620_0003612_5059_5790 242
309 3300046518 Ga0495631_0012804 Ga0495631_0012804_1444_2175 242
310 3300046519 Ga0495632_0000075 Ga0495632_0000075_52057_52788 242
311 3300046519 Ga0495632_0000171 Ga0495632_0000171_45257_45988 242
312 3300046519 Ga0495632_0000309 Ga0495632_0000309_38460_39191 242
313 3300046519 Ga0495632_0102618 Ga0495632_0102618_522_1262 242
314 3300046520 Ga0495637_0000123 Ga0495637_0000123_49250_49981 242
315 3300046520 Ga0495637_0006355 Ga0495637_0006355_4303_5034 242
316 3300046522 Ga0495643_0000009 Ga0495643_0000009_270144_270875 242
317 3300046522 Ga0495643_0000077 Ga0495643_0000077_106193_106933 242
318 3300046522 Ga0495643_0002195 Ga0495643_0002195_13317_14057 242
319 3300046524 Ga0495648_0000021 Ga0495648_0000021_50850_51581 242
320 3300046524 Ga0495648_0152164 Ga0495648_0152164_181_912 242
321 3300046525 Ga0495663_0000003 Ga0495663_0000003_98741_99472 242
322 3300046530 Ga0495654_0044457 Ga0495654_0044457_436_1167 242
323 3300046538 Ga0495609_0002388 Ga0495609_0002388_7468_8208 242
324 3300046542 Ga0495597_0026417 Ga0495597_0026417_1131_1862 242
325 3300046542 Ga0495597_0097779 Ga0495597_0097779_468_1199 242
326 3300046557 Ga0495622_0041861 Ga0495622_0041861_499_1230 242
327 3300046558 Ga0495633_0000173 Ga0495633_0000173_18592_19323 242
328 3300046558 Ga0495633_0000834 Ga0495633_0000834_17050_17781 242
329 3300046558 Ga0495633_0005456 Ga0495633_0005456_2920_3651 242
330 3300046558 Ga0495633_0197982 Ga0495633_0197982_13_744 242
331 3300046616 Ga0495668_0006451 Ga0495668_0006451_3935_4666 242
332 3300046616 Ga0495668_0017868 Ga0495668_0017868_2004_2735 242
333 3300046616 Ga0495668_0068107 Ga0495668_0068107_1024_1755 242
334 3300046616 Ga0495668_0304761 Ga0495668_0304761_97_837 242
335 3300046660 Ga0495625_0012995 Ga0495625_0012995_1168_1908 242
336 3300046660 Ga0495625_0082093 Ga0495625_0082093_102_833 242
337 3300046665 Ga0495661_0141175 Ga0495661_0141175_173_904 242
338 3300046692 Ga0495671_0000013 Ga0495671_0000013_270144_270875 242
339 3300046692 Ga0495671_0000028 Ga0495671_0000028_183425_184156 242
340 3300046692 Ga0495671_0026112 Ga0495671_0026112_2244_2975 242
341 3300046810 Ga0495660_0179634 Ga0495660_0179634_29_769 242
342 3300047320 Ga0495672_0066763 Ga0495672_0066763_619_1350 242
343 3300047469 Ga0495673_0000058 Ga0495673_0000058_50835_51566 242
344 3300047469 Ga0495673_0059329 Ga0495673_0059329_436_1167 242
345 3300047470 Ga0495681_0000041 Ga0495681_0000041_25917_26648 242
346 3300047470 Ga0495681_0000059 Ga0495681_0000059_96305_97036 242
347 3300047470 Ga0495681_0001690 Ga0495681_0001690_8579_9310 242
348 3300047472 Ga0495686_0032850 Ga0495686_0032850_1354_2085 242
349 3300047472 Ga0495686_0045298 Ga0495686_0045298_227_958 242
350 3300048090 Ga0495615_0000301 Ga0495615_0000301_1009_1779 242
351 3300048091 Ga0495626_0002802 Ga0495626_0002802_5094_5825 242
352 3300048903 Ga0496100_0416374 Ga0496100_0416374_239_985 242
353 3300048905 Ga0496102_0000034 Ga0496102_0000034_181621_182352 242
354 3300048906 Ga0496103_0000026 Ga0496103_0000026_181621_182352 242
355 3300048906 Ga0496103_0036666 Ga0496103_0036666_354_1091 242
356 3300048906 Ga0496103_0150097 Ga0496103_0150097_690_1436 242
357 3300048907 Ga0496104_0055124 Ga0496104_0055124_1780_2517 242
358 3300048908 Ga0496105_0002144 Ga0496105_0002144_11602_12339 242
359 3300048909 Ga0496106_0005674 Ga0496106_0005674_5937_6683 242
360 3300048910 Ga0496107_0073171 Ga0496107_0073171_366_1112 242
361 3300048911 Ga0496108_0140141 Ga0496108_0140141_389_1135 242
362 3300048912 Ga0496109_0125714 Ga0496109_0125714_750_1496 242
363 3300048912 Ga0496109_0277808 Ga0496109_0277808_325_1071 242
364 3300048913 Ga0496110_0022610 Ga0496110_0022610_3356_4102 242
365 3300048913 Ga0496110_0034268 Ga0496110_0034268_834_1565 242
366 3300048913 Ga0496110_0059304 Ga0496110_0059304_1520_2251 242
367 3300048914 Ga0496111_0081339 Ga0496111_0081339_514_1260 242
368 3300048914 Ga0496111_0204608 Ga0496111_0204608_13_744 242
369 3300048914 Ga0496111_0499392 Ga0496111_0499392_70_816 242
370 3300048915 Ga0496112_0202578 Ga0496112_0202578_898_1644 242
371 3300048916 Ga0496113_0288784 Ga0496113_0288784_192_923 242
372 3300048916 Ga0496113_0652246 Ga0496113_0652246_32_778 242
373 3300048917 Ga0496114_0179412 Ga0496114_0179412_512_1258 242
374 3300048918 Ga0496115_0316127 Ga0496115_0316127_24_770 242
375 3300048919 Ga0496116_0000062 Ga0496116_0000062_210693_211424 242
376 3300048919 Ga0496116_0010032 Ga0496116_0010032_3200_3931 242
377 3300048920 Ga0496117_0000072 Ga0496117_0000072_206161_206892 242
378 3300048920 Ga0496117_0014507 Ga0496117_0014507_3791_4522 242
379 3300048920 Ga0496117_0015022 Ga0496117_0015022_1671_2402 242
380 3300048920 Ga0496117_0024307 Ga0496117_0024307_174_911 242
381 3300048921 Ga0496118_0000030 Ga0496118_0000030_31475_32206 242
382 3300048921 Ga0496118_0022739 Ga0496118_0022739_1104_1835 242
383 3300048921 Ga0496118_0027419 Ga0496118_0027419_695_1432 242
384 3300048921 Ga0496118_0076954 Ga0496118_0076954_1020_1775 242
385 3300048922 Ga0496119_0026304 Ga0496119_0026304_2785_3516 242
386 3300048922 Ga0496119_0049832 Ga0496119_0049832_705_1436 242
387 3300048924 Ga0496121_0000065 Ga0496121_0000065_31171_31926 242
388 3300048924 Ga0496121_0000087 Ga0496121_0000087_7227_7988 242
389 3300048924 Ga0496121_0000196 Ga0496121_0000196_117243_117980 242
390 3300048924 Ga0496121_0015255 Ga0496121_0015255_1602_2333 242
391 3300048925 Ga0496122_0004355 Ga0496122_0004355_10605_11336 242
392 3300048925 Ga0496122_0010052 Ga0496122_0010052_3907_4677 242
393 3300048925 Ga0496122_0020834 Ga0496122_0020834_2299_3030 242
394 3300048925 Ga0496122_0061498 Ga0496122_0061498_357_1112 242
395 3300048926 Ga0496123_0000545 Ga0496123_0000545_59697_60428 242
396 3300048926 Ga0496123_0000944 Ga0496123_0000944_37719_38489 242
397 3300048926 Ga0496123_0077549 Ga0496123_0077549_1119_1850 242
398 3300048927 Ga0496124_0000061 Ga0496124_0000061_31475_32206 242
399 3300048927 Ga0496124_0013522 Ga0496124_0013522_4636_5391 242
400 3300048927 Ga0496124_0014784 Ga0496124_0014784_3580_4311 242
401 3300048927 Ga0496124_0026937 Ga0496124_0026937_3225_3956 242
402 3300048927 Ga0496124_0080968 Ga0496124_0080968_677_1447 242
403 3300048927 Ga0496124_0117392 Ga0496124_0117392_289_1020 242
404 3300048928 Ga0496125_0041750 Ga0496125_0041750_834_1589 242
405 3300048928 Ga0496125_0051925 Ga0496125_0051925_1389_2120 242
406 3300048928 Ga0496125_0054369 Ga0496125_0054369_1749_2480 242
407 3300048928 Ga0496125_0058919 Ga0496125_0058919_161_892 242
408 3300048928 Ga0496125_0074461 Ga0496125_0074461_933_1664 242
409 3300048929 Ga0496126_0000801 Ga0496126_0000801_51808_52539 242
410 3300048929 Ga0496126_0006880 Ga0496126_0006880_3524_4279 242
411 3300048929 Ga0496126_0007548 Ga0496126_0007548_7015_7761 242
412 3300048929 Ga0496126_0087053 Ga0496126_0087053_960_1691 242
413 3300049459 Ga0495678_027495 Ga0495678_027495_893_1624 242
414 3300049571 Ga0501034_0014247 Ga0501034_0014247_5938_6669 242
415 3300049571 Ga0501034_0032927 Ga0501034_0032927_3528_4337 242
416 3300049588 Ga0501072_0249747 Ga0501072_0249747_614_1393 242
417 3300049591 Ga0501075_0212176 Ga0501075_0212176_461_1240 242
418 3300049592 Ga0501076_0185418 Ga0501076_0185418_826_1605 242
419 3300049658 Ga0501211_006620 Ga0501211_006620_180_911 242
420 3300049663 Ga0501223_000056 Ga0501223_000056_1040_1771 242
421 3300049663 Ga0501223_000072 Ga0501223_000072_26025_26756 242
422 3300049664 Ga0501224_000004 Ga0501224_000004_92646_93377 242
423 3300049669 Ga0501235_001470 Ga0501235_001470_380_1111 242
424 3300049669 Ga0501235_015594 Ga0501235_015594_748_1479 242
425 3300049705 Ga0501225_0000002 Ga0501225_0000002_127211_127942 242
426 3300049705 Ga0501225_0000060 Ga0501225_0000060_28456_29187 242
427 3300049705 Ga0501225_0001161 Ga0501225_0001161_233_964 242
428 3300049705 Ga0501225_0011492 Ga0501225_0011492_595_1326 242
429 3300049707 Ga0501234_000247 Ga0501234_000247_5433_6164 242
430 3300049708 Ga0501245_004415 Ga0501245_004415_638_1369 242
431 3300049822 Ga0501035_0327064 Ga0501035_0327064_149_880 242
432 3300049824 Ga0501045_0455482 Ga0501045_0455482_58_891 242
433 3300049853 Ga0501226_000018 Ga0501226_000018_75693_76424 242
434 3300050491 nmdc:mga00v17_45994_c1 nmdc:mga00v17_45994_c1_799_1530 242
435 3300050493 nmdc:mga0k408_45398_c1 nmdc:mga0k408_45398_c1_115_846 242
436 3300050494 nmdc:mga06z11_20_c1 nmdc:mga06z11_20_c1_53263_53994 242
437 3300050495 nmdc:mga04h51_108_c1 nmdc:mga04h51_108_c1_21710_22441 242
438 3300050496 nmdc:mga07m45_37166_c1 nmdc:mga07m45_37166_c1_929_1660 242
439 3300050496 nmdc:mga07m45_39006_c1 nmdc:mga07m45_39006_c1_453_1199 242
440 3300050496 nmdc:mga07m45_58847_c1 nmdc:mga07m45_58847_c1_634_1365 242
441 3300050496 nmdc:mga07m45_80608_c1 nmdc:mga07m45_80608_c1_531_1262 242
442 3300050511 nmdc:mga08y16_390695_c1 nmdc:mga08y16_390695_c1_411_1142 242
443 3300053087 Ga0500643_000172 Ga0500643_000172_34423_35154 242
444 3300053087 Ga0500643_000195 Ga0500643_000195_53278_54006 242
445 3300053087 Ga0500643_011200 Ga0500643_011200_2215_2946 242
446 3300053093 Ga0500651_0001347 Ga0500651_0001347_7113_7844 242
447 3300053104 Ga0500556_0000025 Ga0500556_0000025_6957_7688 242
448 3300053105 Ga0500557_043441 Ga0500557_043441_22_753 242
449 3300053108 Ga0500562_013826 Ga0500562_013826_1046_1777 242
450 3300053108 Ga0500562_020333 Ga0500562_020333_850_1581 242
451 3300053116 Ga0500592_000031 Ga0500592_000031_5403_6131 242
452 3300053118 Ga0500594_0111308 Ga0500594_0111308_28_759 242
453 3300053121 Ga0500607_000077 Ga0500607_000077_23444_24175 242
454 3300053125 Ga0500618_001872 Ga0500618_001872_5167_6003 242
455 3300053125 Ga0500618_003530 Ga0500618_003530_709_1440 242
456 3300053130 Ga0500642_0000001 Ga0500642_0000001_5916_6647 242
457 3300053133 Ga0500655_000024 Ga0500655_000024_31922_32653 242
458 3300053136 Ga0500559_0000782 Ga0500559_0000782_8256_8987 242
459 3300053136 Ga0500559_0017236 Ga0500559_0017236_1047_1781 242
460 3300053148 Ga0500590_001145 Ga0500590_001145_6838_7569 242
461 3300053148 Ga0500590_001222 Ga0500590_001222_6275_7006 242
462 3300053156 Ga0500622_0106262 Ga0500622_0106262_549_1280 242
463 3300053156 Ga0500622_0224541 Ga0500622_0224541_36_767 242
464 3300053157 Ga0500624_000028 Ga0500624_000028_92358_93089 242
465 3300053724 Ga0500570_016370 Ga0500570_016370_890_1621 242
466 3300053730 Ga0500645_003231 Ga0500645_003231_4852_5583 242
467 3300060353 Ga0501082_0590672 Ga0501082_0590672_25_804 242
468 iso_pu_bacteria 2919138771 2919142104 242
469 iso_pu_bacteria 8054302542 8054305241 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08242

Methyltransf_12

Methyltransferase domain

96

193

0.98

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

45

277

0.95

PF08241

Methyltransf_11

Methyltransferase domain

96

195

0.92

PF13649

Methyltransf_25

Methyltransferase domain

95

191

0.9

PF13847

Methyltransf_31

Methyltransferase domain

89

240

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.9363 27 242
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.8598 27 242
3grz-assembly1.cif.gz_B crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.8494 47 242
3grz-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.8416 47 242
1vl5-assembly4.cif.gz_D crystal structure of a putative methyltransferase (bh2331) from bacillus halodurans c-125 at 1.95 a resolution 0.8383 47 227
ID Description Score Start End Superfamily
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9781 27 242 3.40.50.150
af_Q9VYF8_68_301_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9579 27 242 3.40.50.150
af_Q59ZE2_70_306_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9553 27 242 3.40.50.150
af_P9WFR3_19_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9521 28 242 3.40.50.150
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.952 27 242 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2P8Y1N3-F1-model_v4 deleted 0.9806 2 242
AF-B4JNM4-F1-model_v4 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (EC 2.1.1.201) (Ubiquinone biosynthesis methyltransferase COQ5) 0.98 2 242 GO:0008425
GO:0031314
GO:0032259
AF-A0A1W4XF56-F1-model_v4 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (EC 2.1.1.201) (Ubiquinone biosynthesis methyltransferase COQ5) 0.9793 2 242 GO:0008425
GO:0031314
GO:0032259
AF-A0A2E2SF17-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9757 2 242 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770
AF-A0A0D6P4T0-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9737 1 242 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770

Feature Viewer

pLDDT pTM Quality
85.94 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map