F450324
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 469 | 240 | 454 | 245 |
Family's Representative Sequence
| Representative Sequence | 3300053125|Ga0500618_001872|Ga0500618_001872_5167_6003 |
| Length | 278 |
| Sequence | MALASSSTCLSTFAPRHKFPKALTMTDNASQPAPQTASFGYEEVAIDEKVARVGEVFSSVAKKYDIMNDAMSAGMHRVWKDRFVRAVKPQPGEQILDMAGGTGDIAFRMAKRGAQITVSDINQDMLNVGMERAPKKLGDKAETLSWSCQNAEELSFESRSFDAYTIAFGIRNVTRVDKALAEAHRVLRYGGRFFCLEFSTTEWPGFREVYDAYSHKLVPQIGKMIAGDEDSYRYLIESIRRFPPMPEFEKMIRAAGFTQTKVEPIMGGLVAIHSGWKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 2 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 3 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 4 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 5 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 6 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 7 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 8 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 9 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 10 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 11 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 12 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 13 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 14 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 15 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 16 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 17 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 18 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 19 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 20 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 21 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 22 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 23 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 74 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 83 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 122 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 123 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 124 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 125 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 126 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 127 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 128 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 129 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 130 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 131 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 132 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 133 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 134 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 135 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 136 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 137 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 139 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 140 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 141 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 142 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 143 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 144 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 177 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 178 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 179 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 180 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 181 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 182 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 185 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 186 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 187 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 188 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 189 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 190 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 191 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 192 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 193 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 194 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 195 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 196 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 197 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 198 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 199 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 200 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 206 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 207 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 208 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 209 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 210 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 211 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 212 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 215 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 216 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 217 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 218 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 219 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 220 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 222 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 223 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 224 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 225 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 226 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 227 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 228 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 229 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 230 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 231 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 232 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 233 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 234 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 235 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 236 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 237 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 238 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 240 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.8 |
| Metatranscriptomes | 0 |
| Isolates | 3.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.96 |
| Nodule | 0 |
| Rhizoplane | 5.12 |
| Rhizosphere | 76.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000281 | 3300001904 | Bacteria | 9332 |
| 2 | JGI24736J21556_1000388 | 3300001904 | Bacteria | 8335 |
| 3 | JGI24741J21665_1000248 | 3300001915 | Bacteria | 16054 |
| 4 | JGI24752J21851_1010228 | 3300001976 | Bacteria | 1225 |
| 5 | JGI24740J21852_10004796 | 3300001979 | Bacteria | 5767 |
| 6 | JGI24737J22298_10001067 | 3300001990 | Bacteria | 9688 |
| 7 | JGI24735J21928_10008771 | 3300002067 | Bacteria | 3262 |
| 8 | JGI24750J21931_1007358 | 3300002070 | Bacteria | 1385 |
| 9 | JGI24738J21930_10004918 | 3300002075 | Bacteria | 3240 |
| 10 | JGI24749J21850_1000822 | 3300002076 | Bacteria | 4456 |
| 11 | JGI24751J29686_10023264 | 3300002459 | Bacteria | 1285 |
| 12 | Ga0065704_10035434 | 3300005289 | Bacteria | 1164 |
| 13 | Ga0065707_10114849 | 3300005295 | Bacteria | 2285 |
| 14 | Ga0065707_10161612 | 3300005295 | Bacteria | 1558 |
| 15 | Ga0065707_10272658 | 3300005295 | Bacteria | 1067 |
| 16 | Ga0070658_10018445 | 3300005327 | Bacteria | 5586 |
| 17 | Ga0070670_100040533 | 3300005331 | Bacteria | 4003 |
| 18 | Ga0070670_100134717 | 3300005331 | Bacteria | 2134 |
| 19 | Ga0070670_100292819 | 3300005331 | Bacteria | 1423 |
| 20 | Ga0070666_10000476 | 3300005335 | Bacteria | 24221 |
| 21 | Ga0070666_10095383 | 3300005335 | Bacteria | 2047 |
| 22 | Ga0070682_100135773 | 3300005337 | Bacteria | 1670 |
| 23 | Ga0070660_100018569 | 3300005339 | Bacteria | 5084 |
| 24 | Ga0070660_100072921 | 3300005339 | Bacteria | 2683 |
| 25 | Ga0070661_100058277 | 3300005344 | Bacteria | 2830 |
| 26 | Ga0070668_100000019 | 3300005347 | Bacteria | 98356 |
| 27 | Ga0070668_100000064 | 3300005347 | Bacteria | 65793 |
| 28 | Ga0070668_100019555 | 3300005347 | Bacteria | 5097 |
| 29 | Ga0070668_100073222 | 3300005347 | Bacteria | 2671 |
| 30 | Ga0070669_100000096 | 3300005353 | Bacteria | 86930 |
| 31 | Ga0070669_100000483 | 3300005353 | Bacteria | 30250 |
| 32 | Ga0070669_100035163 | 3300005353 | Bacteria | 3629 |
| 33 | Ga0070669_100097726 | 3300005353 | Bacteria | 2211 |
| 34 | Ga0070669_100110071 | 3300005353 | Bacteria | 2089 |
| 35 | Ga0070669_100111697 | 3300005353 | Bacteria | 2075 |
| 36 | Ga0070669_100122473 | 3300005353 | Bacteria | 1986 |
| 37 | Ga0070671_100000045 | 3300005355 | Bacteria | 85779 |
| 38 | Ga0070671_100000208 | 3300005355 | Bacteria | 38891 |
| 39 | Ga0070671_100010845 | 3300005355 | Bacteria | 7312 |
| 40 | Ga0070671_100339313 | 3300005355 | Bacteria | 1282 |
| 41 | Ga0070659_100047783 | 3300005366 | Bacteria | 3359 |
| 42 | Ga0070667_100000003 | 3300005367 | Bacteria | 447715 |
| 43 | Ga0070667_100000094 | 3300005367 | Bacteria | 111140 |
| 44 | Ga0070667_100000626 | 3300005367 | Bacteria | 34381 |
| 45 | Ga0070667_100004495 | 3300005367 | Bacteria | 11767 |
| 46 | Ga0070667_100154998 | 3300005367 | Bacteria | 2014 |
| 47 | Ga0070705_100278344 | 3300005440 | Bacteria | 1188 |
| 48 | Ga0070700_100247927 | 3300005441 | Bacteria | 1276 |
| 49 | Ga0070708_100925942 | 3300005445 | Bacteria | 818 |
| 50 | Ga0070663_100001800 | 3300005455 | Bacteria | 11922 |
| 51 | Ga0070663_100120088 | 3300005455 | Bacteria | 1984 |
| 52 | Ga0070685_10187421 | 3300005466 | Bacteria | 1336 |
| 53 | Ga0068853_100787893 | 3300005539 | Bacteria | 910 |
| 54 | Ga0070665_100016763 | 3300005548 | Bacteria | 7344 |
| 55 | Ga0070665_100061760 | 3300005548 | Bacteria | 3757 |
| 56 | Ga0070665_100779809 | 3300005548 | Bacteria | 969 |
| 57 | Ga0068855_100003516 | 3300005563 | Bacteria | 19170 |
| 58 | Ga0068855_100541765 | 3300005563 | Bacteria | 1261 |
| 59 | Ga0068857_100024324 | 3300005577 | Bacteria | 5331 |
| 60 | Ga0068857_100037860 | 3300005577 | Bacteria | 4273 |
| 61 | Ga0068857_100467012 | 3300005577 | Bacteria | 1181 |
| 62 | Ga0068854_100000822 | 3300005578 | Bacteria | 18526 |
| 63 | Ga0068856_100358481 | 3300005614 | Bacteria | 1477 |
| 64 | Ga0068852_100000232 | 3300005616 | Bacteria | 37715 |
| 65 | Ga0068852_100187928 | 3300005616 | Bacteria | 1947 |
| 66 | Ga0068852_100451877 | 3300005616 | Bacteria | 1272 |
| 67 | Ga0068852_100560165 | 3300005616 | Bacteria | 1144 |
| 68 | Ga0068859_100000162 | 3300005617 | Bacteria | 65033 |
| 69 | Ga0068859_100014456 | 3300005617 | Bacteria | 7923 |
| 70 | Ga0068859_100020051 | 3300005617 | Bacteria | 6714 |
| 71 | Ga0068859_100118445 | 3300005617 | Bacteria | 2714 |
| 72 | Ga0068859_100132544 | 3300005617 | Bacteria | 2564 |
| 73 | Ga0068864_100000677 | 3300005618 | Bacteria | 28506 |
| 74 | Ga0068864_100001835 | 3300005618 | Bacteria | 17465 |
| 75 | Ga0068864_100004457 | 3300005618 | Bacteria | 11506 |
| 76 | Ga0068864_100033443 | 3300005618 | Bacteria | 4371 |
| 77 | Ga0068864_100270028 | 3300005618 | Bacteria | 1584 |
| 78 | Ga0068861_100003029 | 3300005719 | Bacteria | 11100 |
| 79 | Ga0068851_10026361 | 3300005834 | Bacteria | 2855 |
| 80 | Ga0068863_100000052 | 3300005841 | Bacteria | 125430 |
| 81 | Ga0068863_100000057 | 3300005841 | Bacteria | 123606 |
| 82 | Ga0068863_100000784 | 3300005841 | Bacteria | 31931 |
| 83 | Ga0068863_100028056 | 3300005841 | Bacteria | 5374 |
| 84 | Ga0068863_100069154 | 3300005841 | Bacteria | 3339 |
| 85 | Ga0068863_100173482 | 3300005841 | Bacteria | 2069 |
| 86 | Ga0068858_100000892 | 3300005842 | Bacteria | 30965 |
| 87 | Ga0068858_100002314 | 3300005842 | Bacteria | 19259 |
| 88 | Ga0068858_100002691 | 3300005842 | Bacteria | 17896 |
| 89 | Ga0068858_100015627 | 3300005842 | Bacteria | 7139 |
| 90 | Ga0068858_100086913 | 3300005842 | Bacteria | 2908 |
| 91 | Ga0068858_100293267 | 3300005842 | Bacteria | 1551 |
| 92 | Ga0068860_100000007 | 3300005843 | Bacteria | 429329 |
| 93 | Ga0068860_100000045 | 3300005843 | Bacteria | 223252 |
| 94 | Ga0068860_100004945 | 3300005843 | Bacteria | 13583 |
| 95 | Ga0068860_100009927 | 3300005843 | Bacteria | 9434 |
| 96 | Ga0068860_100047625 | 3300005843 | Bacteria | 4085 |
| 97 | Ga0068860_100228823 | 3300005843 | Bacteria | 1807 |
| 98 | Ga0068860_100911790 | 3300005843 | Bacteria | 895 |
| 99 | Ga0068862_100000385 | 3300005844 | Bacteria | 47562 |
| 100 | Ga0068862_100001387 | 3300005844 | Bacteria | 22482 |
| 101 | Ga0068862_100024968 | 3300005844 | Bacteria | 5017 |
| 102 | Ga0068862_100078882 | 3300005844 | Bacteria | 2853 |
| 103 | Ga0081455_10000187 | 3300005937 | Bacteria | 78623 |
| 104 | Ga0081539_10069844 | 3300005985 | Bacteria | 1888 |
| 105 | Ga0075368_10000241 | 3300006042 | Bacteria | 15395 |
| 106 | Ga0075367_10000134 | 3300006178 | Bacteria | 22041 |
| 107 | Ga0075370_10020641 | 3300006353 | Bacteria | 3604 |
| 108 | Ga0075370_10030318 | 3300006353 | Bacteria | 3017 |
| 109 | Ga0075370_10049565 | 3300006353 | Bacteria | 2381 |
| 110 | Ga0075370_10101315 | 3300006353 | Bacteria | 1667 |
| 111 | Ga0097620_100000162 | 3300006931 | Bacteria | 65033 |
| 112 | Ga0097620_100014456 | 3300006931 | Bacteria | 7923 |
| 113 | Ga0097620_100020051 | 3300006931 | Bacteria | 6714 |
| 114 | Ga0097620_100118444 | 3300006931 | Bacteria | 2714 |
| 115 | Ga0097620_100132551 | 3300006931 | Bacteria | 2564 |
| 116 | Ga0105251_10012077 | 3300009011 | Bacteria | 4901 |
| 117 | Ga0105240_10019610 | 3300009093 | Bacteria | 9033 |
| 118 | Ga0111539_10354085 | 3300009094 | Bacteria | 1709 |
| 119 | Ga0105247_10001548 | 3300009101 | Bacteria | 16396 |
| 120 | Ga0114129_10738228 | 3300009147 | Bacteria | 1261 |
| 121 | Ga0105243_10061762 | 3300009148 | Bacteria | 2998 |
| 122 | Ga0105248_10029928 | 3300009177 | Bacteria | 6076 |
| 123 | Ga0105248_10159422 | 3300009177 | Bacteria | 2545 |
| 124 | Ga0105237_10025568 | 3300009545 | Bacteria | 6034 |
| 125 | Ga0105237_10046314 | 3300009545 | Bacteria | 4374 |
| 126 | Ga0105238_10585537 | 3300009551 | Bacteria | 1122 |
| 127 | Ga0105249_10016302 | 3300009553 | Bacteria | 6590 |
| 128 | Ga0105249_10246328 | 3300009553 | Bacteria | 1769 |
| 129 | Ga0105249_10762832 | 3300009553 | Bacteria | 1030 |
| 130 | Ga0105148_100217 | 3300009978 | Bacteria | 8303 |
| 131 | Ga0105147_102038 | 3300009982 | Bacteria | 1657 |
| 132 | Ga0105239_10082845 | 3300010375 | Bacteria | 3532 |
| 133 | Ga0157370_10043502 | 3300013104 | Bacteria | 4321 |
| 134 | Ga0163162_10000823 | 3300013306 | Bacteria | 28858 |
| 135 | Ga0163163_10829050 | 3300014325 | Bacteria | 988 |
| 136 | Ga0157380_10070278 | 3300014326 | Bacteria | 2828 |
| 137 | Ga0157379_10011118 | 3300014968 | Bacteria | 7849 |
| 138 | Ga0163161_10018115 | 3300017792 | Bacteria | 4937 |
| 139 | Ga0213875_10000105 | 3300021388 | Bacteria | 96051 |
| 140 | Ga0209147_100921 | 3300025229 | Bacteria | 13170 |
| 141 | Ga0209050_1000262 | 3300025298 | Bacteria | 112798 |
| 142 | Ga0207697_10001562 | 3300025315 | Bacteria | 12366 |
| 143 | Ga0207656_10011306 | 3300025321 | Bacteria | 3371 |
| 144 | Ga0207680_10000156 | 3300025903 | Bacteria | 33323 |
| 145 | Ga0207680_10019218 | 3300025903 | Bacteria | 3649 |
| 146 | Ga0207680_10037075 | 3300025903 | Bacteria | 2813 |
| 147 | Ga0207647_10002267 | 3300025904 | Bacteria | 14654 |
| 148 | Ga0207647_10003339 | 3300025904 | Bacteria | 12043 |
| 149 | Ga0207705_10000199 | 3300025909 | Bacteria | 60726 |
| 150 | Ga0207705_10000991 | 3300025909 | Bacteria | 23160 |
| 151 | Ga0207705_10088132 | 3300025909 | Bacteria | 2270 |
| 152 | Ga0207654_10019730 | 3300025911 | Bacteria | 3564 |
| 153 | Ga0207695_10056638 | 3300025913 | Bacteria | 4078 |
| 154 | Ga0207671_10016178 | 3300025914 | Bacteria | 5808 |
| 155 | Ga0207671_10027757 | 3300025914 | Bacteria | 4232 |
| 156 | Ga0207657_10012357 | 3300025919 | Bacteria | 8432 |
| 157 | Ga0207657_10066767 | 3300025919 | Bacteria | 3061 |
| 158 | Ga0207657_10412486 | 3300025919 | Bacteria | 1062 |
| 159 | Ga0207649_10460549 | 3300025920 | Bacteria | 961 |
| 160 | Ga0207652_10001433 | 3300025921 | Bacteria | 21127 |
| 161 | Ga0207681_10000030 | 3300025923 | Bacteria | 173766 |
| 162 | Ga0207681_10001967 | 3300025923 | Bacteria | 13174 |
| 163 | Ga0207681_10007546 | 3300025923 | Bacteria | 6666 |
| 164 | Ga0207681_10048748 | 3300025923 | Bacteria | 2860 |
| 165 | Ga0207681_10077844 | 3300025923 | Bacteria | 2332 |
| 166 | Ga0207681_10203010 | 3300025923 | Bacteria | 1523 |
| 167 | Ga0207650_10004846 | 3300025925 | Bacteria | 9193 |
| 168 | Ga0207650_10045369 | 3300025925 | Bacteria | 3234 |
| 169 | Ga0207650_10483419 | 3300025925 | Bacteria | 1033 |
| 170 | Ga0207644_10000017 | 3300025931 | Bacteria | 177818 |
| 171 | Ga0207644_10000048 | 3300025931 | Bacteria | 102494 |
| 172 | Ga0207644_10004676 | 3300025931 | Bacteria | 8901 |
| 173 | Ga0207690_10168154 | 3300025932 | Bacteria | 1640 |
| 174 | Ga0207706_10028297 | 3300025933 | Bacteria | 5006 |
| 175 | Ga0207709_10052702 | 3300025935 | Bacteria | 2500 |
| 176 | Ga0207711_10021763 | 3300025941 | Bacteria | 5354 |
| 177 | Ga0207711_10146847 | 3300025941 | Bacteria | 2125 |
| 178 | Ga0207711_10810677 | 3300025941 | Bacteria | 872 |
| 179 | Ga0207667_10002574 | 3300025949 | Bacteria | 22543 |
| 180 | Ga0207667_10007492 | 3300025949 | Bacteria | 13100 |
| 181 | Ga0207667_10053873 | 3300025949 | Bacteria | 4232 |
| 182 | Ga0207667_10058501 | 3300025949 | Bacteria | 4042 |
| 183 | Ga0207712_10087039 | 3300025961 | Bacteria | 2290 |
| 184 | Ga0207712_10148375 | 3300025961 | Bacteria | 1808 |
| 185 | Ga0207668_10000030 | 3300025972 | Bacteria | 122797 |
| 186 | Ga0207668_10000059 | 3300025972 | Bacteria | 91172 |
| 187 | Ga0207668_10000620 | 3300025972 | Bacteria | 22083 |
| 188 | Ga0207668_10271128 | 3300025972 | Bacteria | 1387 |
| 189 | Ga0207640_10000687 | 3300025981 | Bacteria | 19687 |
| 190 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 191 | Ga0207658_10000072 | 3300025986 | Bacteria | 112469 |
| 192 | Ga0207658_10002739 | 3300025986 | Bacteria | 12726 |
| 193 | Ga0207658_10041579 | 3300025986 | Bacteria | 3329 |
| 194 | Ga0207658_10285590 | 3300025986 | Bacteria | 1416 |
| 195 | Ga0207703_10000358 | 3300026035 | Bacteria | 49140 |
| 196 | Ga0207703_10001073 | 3300026035 | Bacteria | 26059 |
| 197 | Ga0207703_10003384 | 3300026035 | Bacteria | 13391 |
| 198 | Ga0207703_10014527 | 3300026035 | Bacteria | 6143 |
| 199 | Ga0207703_10016411 | 3300026035 | Bacteria | 5774 |
| 200 | Ga0207703_10017723 | 3300026035 | Bacteria | 5560 |
| 201 | Ga0207639_10000898 | 3300026041 | Bacteria | 20187 |
| 202 | Ga0207639_10001983 | 3300026041 | Bacteria | 13774 |
| 203 | Ga0207639_10870117 | 3300026041 | Bacteria | 842 |
| 204 | Ga0207678_10000239 | 3300026067 | Bacteria | 49386 |
| 205 | Ga0207678_10003769 | 3300026067 | Bacteria | 13635 |
| 206 | Ga0207702_10001635 | 3300026078 | Bacteria | 22162 |
| 207 | Ga0207641_10000042 | 3300026088 | Bacteria | 186384 |
| 208 | Ga0207641_10000096 | 3300026088 | Bacteria | 123585 |
| 209 | Ga0207641_10000720 | 3300026088 | Bacteria | 35557 |
| 210 | Ga0207641_10001779 | 3300026088 | Bacteria | 20758 |
| 211 | Ga0207641_10014895 | 3300026088 | Bacteria | 6375 |
| 212 | Ga0207676_10001237 | 3300026095 | Bacteria | 19005 |
| 213 | Ga0207676_10003709 | 3300026095 | Bacteria | 10800 |
| 214 | Ga0207676_10038805 | 3300026095 | Bacteria | 3638 |
| 215 | Ga0207676_10452109 | 3300026095 | Bacteria | 1211 |
| 216 | Ga0207674_10005394 | 3300026116 | Bacteria | 15211 |
| 217 | Ga0207674_10016029 | 3300026116 | Bacteria | 8209 |
| 218 | Ga0207674_10033327 | 3300026116 | Bacteria | 5393 |
| 219 | Ga0207674_10638166 | 3300026116 | Bacteria | 1028 |
| 220 | Ga0207675_100000221 | 3300026118 | Bacteria | 53325 |
| 221 | Ga0207698_10000005 | 3300026142 | Bacteria | 295687 |
| 222 | Ga0207698_10037969 | 3300026142 | Bacteria | 3553 |
| 223 | Ga0207698_10439482 | 3300026142 | Bacteria | 1256 |
| 224 | Ga0209813_10000017 | 3300027866 | Bacteria | 75687 |
| 225 | Ga0268266_10032911 | 3300028379 | Bacteria | 4406 |
| 226 | Ga0268266_10062240 | 3300028379 | Bacteria | 3220 |
| 227 | Ga0268266_10261839 | 3300028379 | Bacteria | 1603 |
| 228 | Ga0268265_10000074 | 3300028380 | Bacteria | 127599 |
| 229 | Ga0268265_10000469 | 3300028380 | Bacteria | 42727 |
| 230 | Ga0268265_10019467 | 3300028380 | Bacteria | 4719 |
| 231 | Ga0268264_10000101 | 3300028381 | Bacteria | 225109 |
| 232 | Ga0268264_10000134 | 3300028381 | Bacteria | 179475 |
| 233 | Ga0268264_10000215 | 3300028381 | Bacteria | 113994 |
| 234 | Ga0268264_10018366 | 3300028381 | Bacteria | 5718 |
| 235 | Ga0268264_10122258 | 3300028381 | Bacteria | 2296 |
| 236 | Ga0265327_10127092 | 3300031251 | Bacteria | 1202 |
| 237 | Ga0307408_100049577 | 3300031548 | Bacteria | 3016 |
| 238 | Ga0307408_100065755 | 3300031548 | Bacteria | 2660 |
| 239 | Ga0307408_100270885 | 3300031548 | Bacteria | 1409 |
| 240 | Ga0307405_10077980 | 3300031731 | Bacteria | 2154 |
| 241 | Ga0307413_10024961 | 3300031824 | Bacteria | 3267 |
| 242 | Ga0307410_10035501 | 3300031852 | Bacteria | 3238 |
| 243 | Ga0307410_10092571 | 3300031852 | Bacteria | 2149 |
| 244 | Ga0307410_10542689 | 3300031852 | Bacteria | 962 |
| 245 | Ga0307406_10213847 | 3300031901 | Bacteria | 1428 |
| 246 | Ga0307407_10005829 | 3300031903 | Bacteria | 5397 |
| 247 | Ga0307407_10019773 | 3300031903 | Bacteria | 3436 |
| 248 | Ga0307407_10563674 | 3300031903 | Bacteria | 844 |
| 249 | Ga0307412_10000495 | 3300031911 | Bacteria | 23495 |
| 250 | Ga0307412_10016178 | 3300031911 | Bacteria | 4436 |
| 251 | Ga0307412_10031934 | 3300031911 | Bacteria | 3330 |
| 252 | Ga0307412_10032812 | 3300031911 | Bacteria | 3295 |
| 253 | Ga0307412_10087525 | 3300031911 | Bacteria | 2170 |
| 254 | Ga0307409_100050473 | 3300031995 | Bacteria | 3177 |
| 255 | Ga0307409_100328443 | 3300031995 | Bacteria | 1434 |
| 256 | Ga0307416_100047698 | 3300032002 | Bacteria | 3392 |
| 257 | Ga0307416_100317116 | 3300032002 | Bacteria | 1559 |
| 258 | Ga0307416_100389872 | 3300032002 | Bacteria | 1426 |
| 259 | Ga0307414_10000684 | 3300032004 | Bacteria | 17354 |
| 260 | Ga0307414_10624079 | 3300032004 | Bacteria | 969 |
| 261 | Ga0307414_10897256 | 3300032004 | Bacteria | 812 |
| 262 | Ga0307411_10017837 | 3300032005 | Bacteria | 4058 |
| 263 | Ga0307411_10414183 | 3300032005 | Bacteria | 1117 |
| 264 | Ga0307411_10644774 | 3300032005 | Bacteria | 916 |
| 265 | Ga0307415_100083875 | 3300032126 | Bacteria | 2285 |
| 266 | Ga0307415_100245238 | 3300032126 | Bacteria | 1452 |
| 267 | Ga0307510_10262554 | 3300033180 | Bacteria | 1207 |
| 268 | Ga0373927_0037237 | 3300035695 | Bacteria | 3163 |
| 269 | Ga0373947_0209472 | 3300035725 | Bacteria | 1278 |
| 270 | Ga0373925_0700626 | 3300037068 | Bacteria | 835 |
| 271 | Ga0395901_0079668 | 3300038443 | Bacteria | 3420 |
| 272 | Ga0451853_1393857 | 3300041512 | Bacteria | 1025 |
| 273 | Ga0439462_0000217 | 3300042015 | Bacteria | 10109 |
| 274 | Ga0450912_002471 | 3300042116 | Bacteria | 1245 |
| 275 | Ga0453684_0176316 | 3300044712 | Bacteria | 2514 |
| 276 | Ga0451576_0077646 | 3300045051 | Bacteria | 3456 |
| 277 | Ga0451576_0758258 | 3300045051 | Bacteria | 1019 |
| 278 | Ga0495627_000372 | 3300046453 | Bacteria | 41499 |
| 279 | Ga0495627_000570 | 3300046453 | Bacteria | 29747 |
| 280 | Ga0495627_001851 | 3300046453 | Bacteria | 11213 |
| 281 | Ga0495650_0003903 | 3300046471 | Bacteria | 10531 |
| 282 | Ga0495596_0000008 | 3300046500 | Bacteria | 150860 |
| 283 | Ga0495596_0003454 | 3300046500 | Bacteria | 7990 |
| 284 | Ga0495607_0004625 | 3300046501 | Bacteria | 10074 |
| 285 | Ga0495583_0000072 | 3300046506 | Bacteria | 182057 |
| 286 | Ga0495606_0003149 | 3300046507 | Bacteria | 17878 |
| 287 | Ga0495610_0000033 | 3300046512 | Bacteria | 204151 |
| 288 | Ga0495610_0000081 | 3300046512 | Bacteria | 113513 |
| 289 | Ga0495610_0000268 | 3300046512 | Bacteria | 54316 |
| 290 | Ga0495610_0003356 | 3300046512 | Bacteria | 12554 |
| 291 | Ga0495616_0001098 | 3300046513 | Bacteria | 19261 |
| 292 | Ga0495620_0003612 | 3300046515 | Bacteria | 8835 |
| 293 | Ga0495631_0012804 | 3300046518 | Bacteria | 4087 |
| 294 | Ga0495632_0000075 | 3300046519 | Bacteria | 102051 |
| 295 | Ga0495632_0000171 | 3300046519 | Bacteria | 66639 |
| 296 | Ga0495632_0000309 | 3300046519 | Bacteria | 47211 |
| 297 | Ga0495632_0102618 | 3300046519 | Bacteria | 1347 |
| 298 | Ga0495637_0000123 | 3300046520 | Bacteria | 57717 |
| 299 | Ga0495637_0006355 | 3300046520 | Bacteria | 5938 |
| 300 | Ga0495643_0000009 | 3300046522 | Bacteria | 344767 |
| 301 | Ga0495643_0000077 | 3300046522 | Bacteria | 163843 |
| 302 | Ga0495643_0002195 | 3300046522 | Bacteria | 15959 |
| 303 | Ga0495643_0068907 | 3300046522 | Bacteria | 1861 |
| 304 | Ga0495648_0000021 | 3300046524 | Bacteria | 246945 |
| 305 | Ga0495648_0152164 | 3300046524 | Bacteria | 1206 |
| 306 | Ga0495663_0000003 | 3300046525 | Bacteria | 362694 |
| 307 | Ga0495654_0044457 | 3300046530 | Bacteria | 2197 |
| 308 | Ga0495609_0002388 | 3300046538 | Bacteria | 11560 |
| 309 | Ga0495597_0026417 | 3300046542 | Bacteria | 2667 |
| 310 | Ga0495597_0097779 | 3300046542 | Bacteria | 1240 |
| 311 | Ga0495622_0041861 | 3300046557 | Bacteria | 2130 |
| 312 | Ga0495633_0000173 | 3300046558 | Bacteria | 84576 |
| 313 | Ga0495633_0000834 | 3300046558 | Bacteria | 27197 |
| 314 | Ga0495633_0005456 | 3300046558 | Bacteria | 7764 |
| 315 | Ga0495633_0197982 | 3300046558 | Bacteria | 923 |
| 316 | Ga0495668_0006451 | 3300046616 | Bacteria | 7679 |
| 317 | Ga0495668_0017868 | 3300046616 | Bacteria | 4109 |
| 318 | Ga0495668_0068107 | 3300046616 | Bacteria | 1958 |
| 319 | Ga0495668_0304761 | 3300046616 | Bacteria | 873 |
| 320 | Ga0495625_0012995 | 3300046660 | Bacteria | 6718 |
| 321 | Ga0495625_0082093 | 3300046660 | Bacteria | 2242 |
| 322 | Ga0495661_0141175 | 3300046665 | Bacteria | 1310 |
| 323 | Ga0495671_0000013 | 3300046692 | Bacteria | 344767 |
| 324 | Ga0495671_0000028 | 3300046692 | Bacteria | 234938 |
| 325 | Ga0495671_0026112 | 3300046692 | Bacteria | 3030 |
| 326 | Ga0495660_0179634 | 3300046810 | Bacteria | 1025 |
| 327 | Ga0495672_0066763 | 3300047320 | Bacteria | 2051 |
| 328 | Ga0495673_0000058 | 3300047469 | Bacteria | 235044 |
| 329 | Ga0495673_0059329 | 3300047469 | Bacteria | 1645 |
| 330 | Ga0495681_0000041 | 3300047470 | Bacteria | 119251 |
| 331 | Ga0495681_0000059 | 3300047470 | Bacteria | 102400 |
| 332 | Ga0495681_0001690 | 3300047470 | Bacteria | 16347 |
| 333 | Ga0495686_0032850 | 3300047472 | Bacteria | 3356 |
| 334 | Ga0495686_0045298 | 3300047472 | Bacteria | 2783 |
| 335 | Ga0495615_0000301 | 3300048090 | Bacteria | 8555 |
| 336 | Ga0495626_0002802 | 3300048091 | Bacteria | 11691 |
| 337 | Ga0496100_0416374 | 3300048903 | Bacteria | 1025 |
| 338 | Ga0496102_0000034 | 3300048905 | Bacteria | 213826 |
| 339 | Ga0496103_0000026 | 3300048906 | Bacteria | 213826 |
| 340 | Ga0496103_0036666 | 3300048906 | Bacteria | 3003 |
| 341 | Ga0496103_0150097 | 3300048906 | Bacteria | 1493 |
| 342 | Ga0496104_0055124 | 3300048907 | Bacteria | 3758 |
| 343 | Ga0496105_0002144 | 3300048908 | Bacteria | 14295 |
| 344 | Ga0496106_0005674 | 3300048909 | Bacteria | 9236 |
| 345 | Ga0496107_0073171 | 3300048910 | Bacteria | 2492 |
| 346 | Ga0496108_0140141 | 3300048911 | Bacteria | 2083 |
| 347 | Ga0496109_0125714 | 3300048912 | Bacteria | 2391 |
| 348 | Ga0496109_0277808 | 3300048912 | Bacteria | 1578 |
| 349 | Ga0496110_0022610 | 3300048913 | Bacteria | 5341 |
| 350 | Ga0496110_0034268 | 3300048913 | Bacteria | 4397 |
| 351 | Ga0496110_0059304 | 3300048913 | Bacteria | 3373 |
| 352 | Ga0496111_0081339 | 3300048914 | Bacteria | 2364 |
| 353 | Ga0496111_0164716 | 3300048914 | Bacteria | 1646 |
| 354 | Ga0496111_0204608 | 3300048914 | Bacteria | 1467 |
| 355 | Ga0496111_0499392 | 3300048914 | Bacteria | 895 |
| 356 | Ga0496112_0202578 | 3300048915 | Bacteria | 1943 |
| 357 | Ga0496113_0288784 | 3300048916 | Bacteria | 1312 |
| 358 | Ga0496113_0652246 | 3300048916 | Bacteria | 842 |
| 359 | Ga0496114_0179412 | 3300048917 | Bacteria | 1849 |
| 360 | Ga0496115_0316127 | 3300048918 | Bacteria | 1278 |
| 361 | Ga0496116_0000062 | 3300048919 | Bacteria | 271104 |
| 362 | Ga0496116_0010032 | 3300048919 | Bacteria | 7989 |
| 363 | Ga0496117_0000072 | 3300048920 | Bacteria | 238366 |
| 364 | Ga0496117_0014507 | 3300048920 | Bacteria | 6783 |
| 365 | Ga0496117_0015022 | 3300048920 | Bacteria | 6633 |
| 366 | Ga0496117_0024307 | 3300048920 | Bacteria | 4797 |
| 367 | Ga0496118_0000030 | 3300048921 | Bacteria | 339946 |
| 368 | Ga0496118_0022739 | 3300048921 | Bacteria | 5468 |
| 369 | Ga0496118_0027419 | 3300048921 | Bacteria | 4820 |
| 370 | Ga0496118_0076954 | 3300048921 | Bacteria | 2369 |
| 371 | Ga0496119_0026304 | 3300048922 | Bacteria | 4038 |
| 372 | Ga0496119_0049832 | 3300048922 | Bacteria | 2586 |
| 373 | Ga0496121_0000065 | 3300048924 | Bacteria | 269310 |
| 374 | Ga0496121_0000087 | 3300048924 | Bacteria | 222451 |
| 375 | Ga0496121_0000196 | 3300048924 | Bacteria | 135812 |
| 376 | Ga0496121_0015255 | 3300048924 | Bacteria | 8071 |
| 377 | Ga0496122_0004355 | 3300048925 | Bacteria | 17692 |
| 378 | Ga0496122_0010052 | 3300048925 | Bacteria | 9831 |
| 379 | Ga0496122_0020834 | 3300048925 | Bacteria | 5900 |
| 380 | Ga0496122_0061498 | 3300048925 | Bacteria | 2756 |
| 381 | Ga0496123_0000545 | 3300048926 | Bacteria | 64687 |
| 382 | Ga0496123_0000944 | 3300048926 | Bacteria | 45323 |
| 383 | Ga0496123_0077549 | 3300048926 | Bacteria | 2040 |
| 384 | Ga0496124_0000061 | 3300048927 | Bacteria | 238225 |
| 385 | Ga0496124_0013522 | 3300048927 | Bacteria | 7960 |
| 386 | Ga0496124_0014784 | 3300048927 | Bacteria | 7527 |
| 387 | Ga0496124_0026937 | 3300048927 | Bacteria | 5173 |
| 388 | Ga0496124_0080968 | 3300048927 | Bacteria | 2671 |
| 389 | Ga0496124_0117392 | 3300048927 | Bacteria | 2131 |
| 390 | Ga0496125_0041750 | 3300048928 | Bacteria | 3917 |
| 391 | Ga0496125_0051925 | 3300048928 | Bacteria | 3376 |
| 392 | Ga0496125_0054369 | 3300048928 | Bacteria | 3272 |
| 393 | Ga0496125_0058919 | 3300048928 | Bacteria | 3098 |
| 394 | Ga0496125_0074461 | 3300048928 | Bacteria | 2632 |
| 395 | Ga0496126_0000801 | 3300048929 | Bacteria | 56279 |
| 396 | Ga0496126_0006880 | 3300048929 | Bacteria | 12599 |
| 397 | Ga0496126_0007548 | 3300048929 | Bacteria | 11899 |
| 398 | Ga0496126_0087053 | 3300048929 | Bacteria | 2753 |
| 399 | Ga0495678_027495 | 3300049459 | Bacteria | 2413 |
| 400 | Ga0501034_0014247 | 3300049571 | Bacteria | 8196 |
| 401 | Ga0501034_0032927 | 3300049571 | Bacteria | 5262 |
| 402 | Ga0501072_0249747 | 3300049588 | Bacteria | 1413 |
| 403 | Ga0501075_0212176 | 3300049591 | Bacteria | 1477 |
| 404 | Ga0501076_0185418 | 3300049592 | Bacteria | 1697 |
| 405 | Ga0501211_006620 | 3300049658 | Bacteria | 1143 |
| 406 | Ga0501223_000056 | 3300049663 | Bacteria | 38016 |
| 407 | Ga0501223_000072 | 3300049663 | Bacteria | 30438 |
| 408 | Ga0501224_000004 | 3300049664 | Bacteria | 169090 |
| 409 | Ga0501235_001470 | 3300049669 | Bacteria | 5037 |
| 410 | Ga0501235_015594 | 3300049669 | Bacteria | 1676 |
| 411 | Ga0501225_0000002 | 3300049705 | Bacteria | 147414 |
| 412 | Ga0501225_0000060 | 3300049705 | Bacteria | 35405 |
| 413 | Ga0501225_0001161 | 3300049705 | Bacteria | 8231 |
| 414 | Ga0501225_0011492 | 3300049705 | Bacteria | 2489 |
| 415 | Ga0501234_000247 | 3300049707 | Bacteria | 7831 |
| 416 | Ga0501245_004415 | 3300049708 | Bacteria | 1930 |
| 417 | Ga0501035_0327064 | 3300049822 | Bacteria | 1287 |
| 418 | Ga0501045_0455482 | 3300049824 | Bacteria | 951 |
| 419 | Ga0501226_000018 | 3300049853 | Bacteria | 147268 |
| 420 | nmdc:mga00v17_45994_c1 | 3300050491 | Bacteria | 2639 |
| 421 | nmdc:mga0k408_45398_c1 | 3300050493 | Bacteria | 2535 |
| 422 | nmdc:mga06z11_20_c1 | 3300050494 | Bacteria | 75712 |
| 423 | nmdc:mga04h51_108_c1 | 3300050495 | Bacteria | 24818 |
| 424 | nmdc:mga07m45_37166_c1 | 3300050496 | Bacteria | 2715 |
| 425 | nmdc:mga07m45_39006_c1 | 3300050496 | Bacteria | 2653 |
| 426 | nmdc:mga07m45_58847_c1 | 3300050496 | Bacteria | 2174 |
| 427 | nmdc:mga07m45_80608_c1 | 3300050496 | Bacteria | 1858 |
| 428 | nmdc:mga08y16_390695_c1 | 3300050511 | Bacteria | 1425 |
| 429 | Ga0500643_000172 | 3300053087 | Bacteria | 63436 |
| 430 | Ga0500643_000195 | 3300053087 | Bacteria | 57960 |
| 431 | Ga0500643_011200 | 3300053087 | Bacteria | 3286 |
| 432 | Ga0500651_0001347 | 3300053093 | Bacteria | 12292 |
| 433 | Ga0500556_0000025 | 3300053104 | Bacteria | 167307 |
| 434 | Ga0500557_043441 | 3300053105 | Bacteria | 1418 |
| 435 | Ga0500562_013826 | 3300053108 | Bacteria | 2064 |
| 436 | Ga0500562_020333 | 3300053108 | Bacteria | 1723 |
| 437 | Ga0500592_000031 | 3300053116 | Bacteria | 47686 |
| 438 | Ga0500594_0111308 | 3300053118 | Bacteria | 852 |
| 439 | Ga0500607_000077 | 3300053121 | Bacteria | 71543 |
| 440 | Ga0500618_001872 | 3300053125 | Bacteria | 8758 |
| 441 | Ga0500618_003530 | 3300053125 | Bacteria | 5325 |
| 442 | Ga0500642_0000001 | 3300053130 | Bacteria | 1468402 |
| 443 | Ga0500655_000024 | 3300053133 | Bacteria | 43300 |
| 444 | Ga0500559_0000782 | 3300053136 | Bacteria | 20805 |
| 445 | Ga0500559_0001720 | 3300053136 | Bacteria | 12005 |
| 446 | Ga0500559_0017236 | 3300053136 | Bacteria | 3050 |
| 447 | Ga0500590_001145 | 3300053148 | Bacteria | 10463 |
| 448 | Ga0500590_001222 | 3300053148 | Bacteria | 10251 |
| 449 | Ga0500622_0106262 | 3300053156 | Bacteria | 1376 |
| 450 | Ga0500622_0224541 | 3300053156 | Bacteria | 840 |
| 451 | Ga0500624_000028 | 3300053157 | Bacteria | 106675 |
| 452 | Ga0500570_016370 | 3300053724 | Bacteria | 4154 |
| 453 | Ga0500645_003231 | 3300053730 | Bacteria | 6744 |
| 454 | Ga0501082_0590672 | 3300060353 | Bacteria | 972 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053136 | Ga0500559_0001720 | Ga0500559_0001720_11363_11992 | 209 |
| 2 | 3300048914 | Ga0496111_0164716 | Ga0496111_0164716_19_717 | 232 |
| 3 | 3300046522 | Ga0495643_0068907 | Ga0495643_0068907_279_986 | 234 |
| 4 | 3300005985 | Ga0081539_10069844 | Ga0081539_100698442 | 238 |
| 5 | iso_pu_bacteria | 2512564014 | 2512645016 | 239 |
| 6 | iso_pu_bacteria | 2582581305 | 2585260477 | 239 |
| 7 | iso_pu_bacteria | 2643221588 | 2643950760 | 239 |
| 8 | iso_pu_bacteria | 2643221662 | 2644346296 | 239 |
| 9 | iso_pu_bacteria | 2775507255 | 2778126811 | 239 |
| 10 | iso_pu_bacteria | 2808606401 | 2809064884 | 239 |
| 11 | iso_pu_bacteria | 2808606404 | 2809080950 | 239 |
| 12 | iso_pu_bacteria | 2808606405 | 2809085216 | 239 |
| 13 | iso_pu_bacteria | 2818991438 | 2819554691 | 239 |
| 14 | iso_pu_bacteria | 2880518877 | 2880521949 | 239 |
| 15 | iso_pu_bacteria | 2919709256 | 2919709869 | 239 |
| 16 | iso_pu_bacteria | 8057101203 | 8057104511 | 239 |
| 17 | iso_pu_bacteria | 2510917021 | 2511126454 | 240 |
| 18 | 3300001904 | JGI24736J21556_1000281 | JGI24736J21556_100028111 | 242 |
| 19 | 3300001904 | JGI24736J21556_1000388 | JGI24736J21556_10003882 | 242 |
| 20 | 3300001915 | JGI24741J21665_1000248 | JGI24741J21665_10002489 | 242 |
| 21 | 3300001976 | JGI24752J21851_1010228 | JGI24752J21851_10102282 | 242 |
| 22 | 3300001979 | JGI24740J21852_10004796 | JGI24740J21852_100047962 | 242 |
| 23 | 3300001990 | JGI24737J22298_10001067 | JGI24737J22298_100010678 | 242 |
| 24 | 3300002067 | JGI24735J21928_10008771 | JGI24735J21928_100087712 | 242 |
| 25 | 3300002070 | JGI24750J21931_1007358 | JGI24750J21931_10073581 | 242 |
| 26 | 3300002075 | JGI24738J21930_10004918 | JGI24738J21930_100049182 | 242 |
| 27 | 3300002076 | JGI24749J21850_1000822 | JGI24749J21850_10008222 | 242 |
| 28 | 3300002459 | JGI24751J29686_10023264 | JGI24751J29686_100232642 | 242 |
| 29 | 3300005289 | Ga0065704_10035434 | Ga0065704_100354342 | 242 |
| 30 | 3300005295 | Ga0065707_10114849 | Ga0065707_101148493 | 242 |
| 31 | 3300005295 | Ga0065707_10161612 | Ga0065707_101616122 | 242 |
| 32 | 3300005295 | Ga0065707_10272658 | Ga0065707_102726582 | 242 |
| 33 | 3300005327 | Ga0070658_10018445 | Ga0070658_100184453 | 242 |
| 34 | 3300005331 | Ga0070670_100040533 | Ga0070670_1000405334 | 242 |
| 35 | 3300005331 | Ga0070670_100134717 | Ga0070670_1001347172 | 242 |
| 36 | 3300005331 | Ga0070670_100292819 | Ga0070670_1002928192 | 242 |
| 37 | 3300005335 | Ga0070666_10000476 | Ga0070666_1000047620 | 242 |
| 38 | 3300005335 | Ga0070666_10095383 | Ga0070666_100953832 | 242 |
| 39 | 3300005337 | Ga0070682_100135773 | Ga0070682_1001357732 | 242 |
| 40 | 3300005339 | Ga0070660_100018569 | Ga0070660_1000185692 | 242 |
| 41 | 3300005339 | Ga0070660_100072921 | Ga0070660_1000729212 | 242 |
| 42 | 3300005344 | Ga0070661_100058277 | Ga0070661_1000582773 | 242 |
| 43 | 3300005347 | Ga0070668_100000019 | Ga0070668_10000001937 | 242 |
| 44 | 3300005347 | Ga0070668_100000064 | Ga0070668_10000006430 | 242 |
| 45 | 3300005347 | Ga0070668_100019555 | Ga0070668_1000195554 | 242 |
| 46 | 3300005347 | Ga0070668_100073222 | Ga0070668_1000732222 | 242 |
| 47 | 3300005353 | Ga0070669_100000096 | Ga0070669_10000009660 | 242 |
| 48 | 3300005353 | Ga0070669_100000483 | Ga0070669_10000048326 | 242 |
| 49 | 3300005353 | Ga0070669_100035163 | Ga0070669_1000351633 | 242 |
| 50 | 3300005353 | Ga0070669_100097726 | Ga0070669_1000977262 | 242 |
| 51 | 3300005353 | Ga0070669_100110071 | Ga0070669_1001100712 | 242 |
| 52 | 3300005353 | Ga0070669_100111697 | Ga0070669_1001116972 | 242 |
| 53 | 3300005353 | Ga0070669_100122473 | Ga0070669_1001224731 | 242 |
| 54 | 3300005355 | Ga0070671_100000045 | Ga0070671_10000004552 | 242 |
| 55 | 3300005355 | Ga0070671_100000208 | Ga0070671_10000020823 | 242 |
| 56 | 3300005355 | Ga0070671_100010845 | Ga0070671_1000108452 | 242 |
| 57 | 3300005355 | Ga0070671_100339313 | Ga0070671_1003393131 | 242 |
| 58 | 3300005366 | Ga0070659_100047783 | Ga0070659_1000477832 | 242 |
| 59 | 3300005367 | Ga0070667_100000003 | Ga0070667_100000003293 | 242 |
| 60 | 3300005367 | Ga0070667_100000094 | Ga0070667_10000009453 | 242 |
| 61 | 3300005367 | Ga0070667_100000626 | Ga0070667_10000062623 | 242 |
| 62 | 3300005367 | Ga0070667_100004495 | Ga0070667_10000449513 | 242 |
| 63 | 3300005367 | Ga0070667_100154998 | Ga0070667_1001549982 | 242 |
| 64 | 3300005440 | Ga0070705_100278344 | Ga0070705_1002783441 | 242 |
| 65 | 3300005441 | Ga0070700_100247927 | Ga0070700_1002479272 | 242 |
| 66 | 3300005445 | Ga0070708_100925942 | Ga0070708_1009259421 | 242 |
| 67 | 3300005455 | Ga0070663_100001800 | Ga0070663_10000180011 | 242 |
| 68 | 3300005455 | Ga0070663_100120088 | Ga0070663_1001200883 | 242 |
| 69 | 3300005466 | Ga0070685_10187421 | Ga0070685_101874212 | 242 |
| 70 | 3300005539 | Ga0068853_100787893 | Ga0068853_1007878931 | 242 |
| 71 | 3300005548 | Ga0070665_100016763 | Ga0070665_1000167635 | 242 |
| 72 | 3300005548 | Ga0070665_100061760 | Ga0070665_1000617602 | 242 |
| 73 | 3300005548 | Ga0070665_100779809 | Ga0070665_1007798092 | 242 |
| 74 | 3300005563 | Ga0068855_100003516 | Ga0068855_1000035165 | 242 |
| 75 | 3300005563 | Ga0068855_100541765 | Ga0068855_1005417651 | 242 |
| 76 | 3300005577 | Ga0068857_100024324 | Ga0068857_1000243245 | 242 |
| 77 | 3300005577 | Ga0068857_100037860 | Ga0068857_1000378605 | 242 |
| 78 | 3300005577 | Ga0068857_100467012 | Ga0068857_1004670122 | 242 |
| 79 | 3300005578 | Ga0068854_100000822 | Ga0068854_1000008227 | 242 |
| 80 | 3300005614 | Ga0068856_100358481 | Ga0068856_1003584812 | 242 |
| 81 | 3300005616 | Ga0068852_100000232 | Ga0068852_10000023212 | 242 |
| 82 | 3300005616 | Ga0068852_100187928 | Ga0068852_1001879282 | 242 |
| 83 | 3300005616 | Ga0068852_100451877 | Ga0068852_1004518772 | 242 |
| 84 | 3300005616 | Ga0068852_100560165 | Ga0068852_1005601652 | 242 |
| 85 | 3300005617 | Ga0068859_100000162 | Ga0068859_10000016252 | 242 |
| 86 | 3300005617 | Ga0068859_100014456 | Ga0068859_1000144567 | 242 |
| 87 | 3300005617 | Ga0068859_100020051 | Ga0068859_1000200517 | 242 |
| 88 | 3300005617 | Ga0068859_100118445 | Ga0068859_1001184453 | 242 |
| 89 | 3300005617 | Ga0068859_100132544 | Ga0068859_1001325442 | 242 |
| 90 | 3300005618 | Ga0068864_100000677 | Ga0068864_1000006775 | 242 |
| 91 | 3300005618 | Ga0068864_100001835 | Ga0068864_10000183516 | 242 |
| 92 | 3300005618 | Ga0068864_100004457 | Ga0068864_1000044573 | 242 |
| 93 | 3300005618 | Ga0068864_100033443 | Ga0068864_1000334433 | 242 |
| 94 | 3300005618 | Ga0068864_100270028 | Ga0068864_1002700282 | 242 |
| 95 | 3300005719 | Ga0068861_100003029 | Ga0068861_1000030295 | 242 |
| 96 | 3300005834 | Ga0068851_10026361 | Ga0068851_100263611 | 242 |
| 97 | 3300005841 | Ga0068863_100000052 | Ga0068863_10000005273 | 242 |
| 98 | 3300005841 | Ga0068863_100000057 | Ga0068863_10000005753 | 242 |
| 99 | 3300005841 | Ga0068863_100000784 | Ga0068863_10000078439 | 242 |
| 100 | 3300005841 | Ga0068863_100028056 | Ga0068863_1000280562 | 242 |
| 101 | 3300005841 | Ga0068863_100069154 | Ga0068863_1000691542 | 242 |
| 102 | 3300005841 | Ga0068863_100173482 | Ga0068863_1001734822 | 242 |
| 103 | 3300005842 | Ga0068858_100000892 | Ga0068858_10000089219 | 242 |
| 104 | 3300005842 | Ga0068858_100002314 | Ga0068858_1000023144 | 242 |
| 105 | 3300005842 | Ga0068858_100002691 | Ga0068858_10000269114 | 242 |
| 106 | 3300005842 | Ga0068858_100015627 | Ga0068858_1000156277 | 242 |
| 107 | 3300005842 | Ga0068858_100086913 | Ga0068858_1000869132 | 242 |
| 108 | 3300005842 | Ga0068858_100293267 | Ga0068858_1002932672 | 242 |
| 109 | 3300005843 | Ga0068860_100000007 | Ga0068860_100000007344 | 242 |
| 110 | 3300005843 | Ga0068860_100000045 | Ga0068860_10000004562 | 242 |
| 111 | 3300005843 | Ga0068860_100004945 | Ga0068860_10000494514 | 242 |
| 112 | 3300005843 | Ga0068860_100009927 | Ga0068860_1000099279 | 242 |
| 113 | 3300005843 | Ga0068860_100047625 | Ga0068860_1000476252 | 242 |
| 114 | 3300005843 | Ga0068860_100228823 | Ga0068860_1002288232 | 242 |
| 115 | 3300005843 | Ga0068860_100911790 | Ga0068860_1009117902 | 242 |
| 116 | 3300005844 | Ga0068862_100000385 | Ga0068862_10000038536 | 242 |
| 117 | 3300005844 | Ga0068862_100001387 | Ga0068862_10000138716 | 242 |
| 118 | 3300005844 | Ga0068862_100024968 | Ga0068862_1000249682 | 242 |
| 119 | 3300005844 | Ga0068862_100078882 | Ga0068862_1000788823 | 242 |
| 120 | 3300005937 | Ga0081455_10000187 | Ga0081455_1000018744 | 242 |
| 121 | 3300006042 | Ga0075368_10000241 | Ga0075368_1000024111 | 242 |
| 122 | 3300006178 | Ga0075367_10000134 | Ga0075367_1000013419 | 242 |
| 123 | 3300006353 | Ga0075370_10020641 | Ga0075370_100206413 | 242 |
| 124 | 3300006353 | Ga0075370_10030318 | Ga0075370_100303182 | 242 |
| 125 | 3300006353 | Ga0075370_10049565 | Ga0075370_100495652 | 242 |
| 126 | 3300006353 | Ga0075370_10101315 | Ga0075370_101013152 | 242 |
| 127 | 3300006931 | Ga0097620_100000162 | Ga0097620_10000016252 | 242 |
| 128 | 3300006931 | Ga0097620_100014456 | Ga0097620_1000144567 | 242 |
| 129 | 3300006931 | Ga0097620_100020051 | Ga0097620_1000200517 | 242 |
| 130 | 3300006931 | Ga0097620_100118444 | Ga0097620_1001184443 | 242 |
| 131 | 3300006931 | Ga0097620_100132551 | Ga0097620_1001325512 | 242 |
| 132 | 3300009011 | Ga0105251_10012077 | Ga0105251_100120772 | 242 |
| 133 | 3300009093 | Ga0105240_10019610 | Ga0105240_100196104 | 242 |
| 134 | 3300009094 | Ga0111539_10354085 | Ga0111539_103540852 | 242 |
| 135 | 3300009101 | Ga0105247_10001548 | Ga0105247_100015484 | 242 |
| 136 | 3300009147 | Ga0114129_10738228 | Ga0114129_107382282 | 242 |
| 137 | 3300009148 | Ga0105243_10061762 | Ga0105243_100617622 | 242 |
| 138 | 3300009177 | Ga0105248_10029928 | Ga0105248_100299282 | 242 |
| 139 | 3300009177 | Ga0105248_10159422 | Ga0105248_101594222 | 242 |
| 140 | 3300009545 | Ga0105237_10025568 | Ga0105237_100255683 | 242 |
| 141 | 3300009545 | Ga0105237_10046314 | Ga0105237_100463144 | 242 |
| 142 | 3300009551 | Ga0105238_10585537 | Ga0105238_105855372 | 242 |
| 143 | 3300009553 | Ga0105249_10016302 | Ga0105249_100163027 | 242 |
| 144 | 3300009553 | Ga0105249_10246328 | Ga0105249_102463282 | 242 |
| 145 | 3300009553 | Ga0105249_10762832 | Ga0105249_107628321 | 242 |
| 146 | 3300009978 | Ga0105148_100217 | Ga0105148_1002171 | 242 |
| 147 | 3300009982 | Ga0105147_102038 | Ga0105147_1020382 | 242 |
| 148 | 3300010375 | Ga0105239_10082845 | Ga0105239_100828452 | 242 |
| 149 | 3300013104 | Ga0157370_10043502 | Ga0157370_100435022 | 242 |
| 150 | 3300013306 | Ga0163162_10000823 | Ga0163162_1000082322 | 242 |
| 151 | 3300014325 | Ga0163163_10829050 | Ga0163163_108290501 | 242 |
| 152 | 3300014326 | Ga0157380_10070278 | Ga0157380_100702782 | 242 |
| 153 | 3300014968 | Ga0157379_10011118 | Ga0157379_100111182 | 242 |
| 154 | 3300017792 | Ga0163161_10018115 | Ga0163161_100181152 | 242 |
| 155 | 3300021388 | Ga0213875_10000105 | Ga0213875_1000010577 | 242 |
| 156 | 3300025229 | Ga0209147_100921 | Ga0209147_10092115 | 242 |
| 157 | 3300025298 | Ga0209050_1000262 | Ga0209050_100026274 | 242 |
| 158 | 3300025315 | Ga0207697_10001562 | Ga0207697_100015624 | 242 |
| 159 | 3300025321 | Ga0207656_10011306 | Ga0207656_100113062 | 242 |
| 160 | 3300025903 | Ga0207680_10000156 | Ga0207680_100001569 | 242 |
| 161 | 3300025903 | Ga0207680_10019218 | Ga0207680_100192182 | 242 |
| 162 | 3300025903 | Ga0207680_10037075 | Ga0207680_100370752 | 242 |
| 163 | 3300025904 | Ga0207647_10002267 | Ga0207647_100022675 | 242 |
| 164 | 3300025904 | Ga0207647_10003339 | Ga0207647_100033393 | 242 |
| 165 | 3300025909 | Ga0207705_10000199 | Ga0207705_1000019915 | 242 |
| 166 | 3300025909 | Ga0207705_10000991 | Ga0207705_1000099119 | 242 |
| 167 | 3300025909 | Ga0207705_10088132 | Ga0207705_100881322 | 242 |
| 168 | 3300025911 | Ga0207654_10019730 | Ga0207654_100197302 | 242 |
| 169 | 3300025913 | Ga0207695_10056638 | Ga0207695_100566383 | 242 |
| 170 | 3300025914 | Ga0207671_10016178 | Ga0207671_100161783 | 242 |
| 171 | 3300025914 | Ga0207671_10027757 | Ga0207671_100277573 | 242 |
| 172 | 3300025919 | Ga0207657_10012357 | Ga0207657_100123575 | 242 |
| 173 | 3300025919 | Ga0207657_10066767 | Ga0207657_100667672 | 242 |
| 174 | 3300025919 | Ga0207657_10412486 | Ga0207657_104124862 | 242 |
| 175 | 3300025920 | Ga0207649_10460549 | Ga0207649_104605491 | 242 |
| 176 | 3300025921 | Ga0207652_10001433 | Ga0207652_1000143319 | 242 |
| 177 | 3300025923 | Ga0207681_10000030 | Ga0207681_10000030141 | 242 |
| 178 | 3300025923 | Ga0207681_10001967 | Ga0207681_1000196710 | 242 |
| 179 | 3300025923 | Ga0207681_10007546 | Ga0207681_1000754610 | 242 |
| 180 | 3300025923 | Ga0207681_10048748 | Ga0207681_100487483 | 242 |
| 181 | 3300025923 | Ga0207681_10077844 | Ga0207681_100778442 | 242 |
| 182 | 3300025923 | Ga0207681_10203010 | Ga0207681_102030102 | 242 |
| 183 | 3300025925 | Ga0207650_10004846 | Ga0207650_100048467 | 242 |
| 184 | 3300025925 | Ga0207650_10045369 | Ga0207650_100453693 | 242 |
| 185 | 3300025925 | Ga0207650_10483419 | Ga0207650_104834191 | 242 |
| 186 | 3300025931 | Ga0207644_10000017 | Ga0207644_10000017143 | 242 |
| 187 | 3300025931 | Ga0207644_10000048 | Ga0207644_1000004821 | 242 |
| 188 | 3300025931 | Ga0207644_10004676 | Ga0207644_100046763 | 242 |
| 189 | 3300025932 | Ga0207690_10168154 | Ga0207690_101681542 | 242 |
| 190 | 3300025933 | Ga0207706_10028297 | Ga0207706_100282972 | 242 |
| 191 | 3300025935 | Ga0207709_10052702 | Ga0207709_100527021 | 242 |
| 192 | 3300025941 | Ga0207711_10021763 | Ga0207711_100217633 | 242 |
| 193 | 3300025941 | Ga0207711_10146847 | Ga0207711_101468472 | 242 |
| 194 | 3300025941 | Ga0207711_10810677 | Ga0207711_108106771 | 242 |
| 195 | 3300025949 | Ga0207667_10002574 | Ga0207667_1000257422 | 242 |
| 196 | 3300025949 | Ga0207667_10007492 | Ga0207667_100074924 | 242 |
| 197 | 3300025949 | Ga0207667_10053873 | Ga0207667_100538734 | 242 |
| 198 | 3300025949 | Ga0207667_10058501 | Ga0207667_100585012 | 242 |
| 199 | 3300025961 | Ga0207712_10087039 | Ga0207712_100870392 | 242 |
| 200 | 3300025961 | Ga0207712_10148375 | Ga0207712_101483752 | 242 |
| 201 | 3300025972 | Ga0207668_10000030 | Ga0207668_1000003088 | 242 |
| 202 | 3300025972 | Ga0207668_10000059 | Ga0207668_1000005940 | 242 |
| 203 | 3300025972 | Ga0207668_10000620 | Ga0207668_100006207 | 242 |
| 204 | 3300025972 | Ga0207668_10271128 | Ga0207668_102711282 | 242 |
| 205 | 3300025981 | Ga0207640_10000687 | Ga0207640_1000068710 | 242 |
| 206 | 3300025986 | Ga0207658_10000002 | Ga0207658_100000021194 | 242 |
| 207 | 3300025986 | Ga0207658_10000072 | Ga0207658_1000007265 | 242 |
| 208 | 3300025986 | Ga0207658_10002739 | Ga0207658_1000273913 | 242 |
| 209 | 3300025986 | Ga0207658_10041579 | Ga0207658_100415792 | 242 |
| 210 | 3300025986 | Ga0207658_10285590 | Ga0207658_102855902 | 242 |
| 211 | 3300026035 | Ga0207703_10000358 | Ga0207703_1000035830 | 242 |
| 212 | 3300026035 | Ga0207703_10001073 | Ga0207703_100010732 | 242 |
| 213 | 3300026035 | Ga0207703_10003384 | Ga0207703_100033847 | 242 |
| 214 | 3300026035 | Ga0207703_10014527 | Ga0207703_100145275 | 242 |
| 215 | 3300026035 | Ga0207703_10016411 | Ga0207703_100164112 | 242 |
| 216 | 3300026035 | Ga0207703_10017723 | Ga0207703_100177235 | 242 |
| 217 | 3300026041 | Ga0207639_10000898 | Ga0207639_100008983 | 242 |
| 218 | 3300026041 | Ga0207639_10001983 | Ga0207639_1000198311 | 242 |
| 219 | 3300026041 | Ga0207639_10870117 | Ga0207639_108701172 | 242 |
| 220 | 3300026067 | Ga0207678_10000239 | Ga0207678_1000023936 | 242 |
| 221 | 3300026067 | Ga0207678_10003769 | Ga0207678_1000376910 | 242 |
| 222 | 3300026078 | Ga0207702_10001635 | Ga0207702_100016356 | 242 |
| 223 | 3300026088 | Ga0207641_10000042 | Ga0207641_1000004273 | 242 |
| 224 | 3300026088 | Ga0207641_10000096 | Ga0207641_1000009652 | 242 |
| 225 | 3300026088 | Ga0207641_10000720 | Ga0207641_100007206 | 242 |
| 226 | 3300026088 | Ga0207641_10001779 | Ga0207641_100017792 | 242 |
| 227 | 3300026088 | Ga0207641_10014895 | Ga0207641_100148953 | 242 |
| 228 | 3300026095 | Ga0207676_10001237 | Ga0207676_1000123717 | 242 |
| 229 | 3300026095 | Ga0207676_10003709 | Ga0207676_100037097 | 242 |
| 230 | 3300026095 | Ga0207676_10038805 | Ga0207676_100388052 | 242 |
| 231 | 3300026095 | Ga0207676_10452109 | Ga0207676_104521091 | 242 |
| 232 | 3300026116 | Ga0207674_10005394 | Ga0207674_1000539411 | 242 |
| 233 | 3300026116 | Ga0207674_10016029 | Ga0207674_100160296 | 242 |
| 234 | 3300026116 | Ga0207674_10033327 | Ga0207674_100333275 | 242 |
| 235 | 3300026116 | Ga0207674_10638166 | Ga0207674_106381661 | 242 |
| 236 | 3300026118 | Ga0207675_100000221 | Ga0207675_10000022152 | 242 |
| 237 | 3300026142 | Ga0207698_10000005 | Ga0207698_1000000529 | 242 |
| 238 | 3300026142 | Ga0207698_10037969 | Ga0207698_100379693 | 242 |
| 239 | 3300026142 | Ga0207698_10439482 | Ga0207698_104394822 | 242 |
| 240 | 3300027866 | Ga0209813_10000017 | Ga0209813_1000001723 | 242 |
| 241 | 3300028379 | Ga0268266_10032911 | Ga0268266_100329112 | 242 |
| 242 | 3300028379 | Ga0268266_10062240 | Ga0268266_100622402 | 242 |
| 243 | 3300028379 | Ga0268266_10261839 | Ga0268266_102618392 | 242 |
| 244 | 3300028380 | Ga0268265_10000074 | Ga0268265_1000007434 | 242 |
| 245 | 3300028380 | Ga0268265_10000469 | Ga0268265_1000046923 | 242 |
| 246 | 3300028380 | Ga0268265_10019467 | Ga0268265_100194675 | 242 |
| 247 | 3300028381 | Ga0268264_10000101 | Ga0268264_1000010164 | 242 |
| 248 | 3300028381 | Ga0268264_10000134 | Ga0268264_1000013471 | 242 |
| 249 | 3300028381 | Ga0268264_10000215 | Ga0268264_1000021578 | 242 |
| 250 | 3300028381 | Ga0268264_10018366 | Ga0268264_100183662 | 242 |
| 251 | 3300028381 | Ga0268264_10122258 | Ga0268264_101222582 | 242 |
| 252 | 3300031251 | Ga0265327_10127092 | Ga0265327_101270922 | 242 |
| 253 | 3300031548 | Ga0307408_100049577 | Ga0307408_1000495772 | 242 |
| 254 | 3300031548 | Ga0307408_100065755 | Ga0307408_1000657553 | 242 |
| 255 | 3300031548 | Ga0307408_100270885 | Ga0307408_1002708852 | 242 |
| 256 | 3300031731 | Ga0307405_10077980 | Ga0307405_100779802 | 242 |
| 257 | 3300031824 | Ga0307413_10024961 | Ga0307413_100249612 | 242 |
| 258 | 3300031852 | Ga0307410_10035501 | Ga0307410_100355014 | 242 |
| 259 | 3300031852 | Ga0307410_10092571 | Ga0307410_100925713 | 242 |
| 260 | 3300031852 | Ga0307410_10542689 | Ga0307410_105426891 | 242 |
| 261 | 3300031901 | Ga0307406_10213847 | Ga0307406_102138472 | 242 |
| 262 | 3300031903 | Ga0307407_10005829 | Ga0307407_100058295 | 242 |
| 263 | 3300031903 | Ga0307407_10019773 | Ga0307407_100197733 | 242 |
| 264 | 3300031903 | Ga0307407_10563674 | Ga0307407_105636741 | 242 |
| 265 | 3300031911 | Ga0307412_10000495 | Ga0307412_1000049515 | 242 |
| 266 | 3300031911 | Ga0307412_10016178 | Ga0307412_100161784 | 242 |
| 267 | 3300031911 | Ga0307412_10031934 | Ga0307412_100319343 | 242 |
| 268 | 3300031911 | Ga0307412_10032812 | Ga0307412_100328123 | 242 |
| 269 | 3300031911 | Ga0307412_10087525 | Ga0307412_100875252 | 242 |
| 270 | 3300031995 | Ga0307409_100050473 | Ga0307409_1000504734 | 242 |
| 271 | 3300031995 | Ga0307409_100328443 | Ga0307409_1003284432 | 242 |
| 272 | 3300032002 | Ga0307416_100047698 | Ga0307416_1000476983 | 242 |
| 273 | 3300032002 | Ga0307416_100317116 | Ga0307416_1003171162 | 242 |
| 274 | 3300032002 | Ga0307416_100389872 | Ga0307416_1003898722 | 242 |
| 275 | 3300032004 | Ga0307414_10000684 | Ga0307414_100006846 | 242 |
| 276 | 3300032004 | Ga0307414_10624079 | Ga0307414_106240791 | 242 |
| 277 | 3300032004 | Ga0307414_10897256 | Ga0307414_108972561 | 242 |
| 278 | 3300032005 | Ga0307411_10017837 | Ga0307411_100178372 | 242 |
| 279 | 3300032005 | Ga0307411_10414183 | Ga0307411_104141832 | 242 |
| 280 | 3300032005 | Ga0307411_10644774 | Ga0307411_106447741 | 242 |
| 281 | 3300032126 | Ga0307415_100083875 | Ga0307415_1000838752 | 242 |
| 282 | 3300032126 | Ga0307415_100245238 | Ga0307415_1002452382 | 242 |
| 283 | 3300033180 | Ga0307510_10262554 | Ga0307510_102625542 | 242 |
| 284 | 3300035695 | Ga0373927_0037237 | Ga0373927_0037237_36_767 | 242 |
| 285 | 3300035725 | Ga0373947_0209472 | Ga0373947_0209472_90_821 | 242 |
| 286 | 3300037068 | Ga0373925_0700626 | Ga0373925_0700626_53_784 | 242 |
| 287 | 3300038443 | Ga0395901_0079668 | Ga0395901_0079668_1823_2641 | 242 |
| 288 | 3300041512 | Ga0451853_1393857 | Ga0451853_1393857_214_945 | 242 |
| 289 | 3300042015 | Ga0439462_0000217 | Ga0439462_0000217_6281_7012 | 242 |
| 290 | 3300042116 | Ga0450912_002471 | Ga0450912_002471_434_1165 | 242 |
| 291 | 3300044712 | Ga0453684_0176316 | Ga0453684_0176316_140_871 | 242 |
| 292 | 3300045051 | Ga0451576_0077646 | Ga0451576_0077646_2437_3180 | 242 |
| 293 | 3300045051 | Ga0451576_0758258 | Ga0451576_0758258_238_969 | 242 |
| 294 | 3300046453 | Ga0495627_000372 | Ga0495627_000372_13835_14566 | 242 |
| 295 | 3300046453 | Ga0495627_000570 | Ga0495627_000570_23249_23980 | 242 |
| 296 | 3300046453 | Ga0495627_001851 | Ga0495627_001851_9259_9990 | 242 |
| 297 | 3300046471 | Ga0495650_0003903 | Ga0495650_0003903_1441_2172 | 242 |
| 298 | 3300046500 | Ga0495596_0000008 | Ga0495596_0000008_21838_22578 | 242 |
| 299 | 3300046500 | Ga0495596_0003454 | Ga0495596_0003454_4291_5022 | 242 |
| 300 | 3300046501 | Ga0495607_0004625 | Ga0495607_0004625_5770_6510 | 242 |
| 301 | 3300046506 | Ga0495583_0000072 | Ga0495583_0000072_130597_131328 | 242 |
| 302 | 3300046507 | Ga0495606_0003149 | Ga0495606_0003149_8848_9588 | 242 |
| 303 | 3300046512 | Ga0495610_0000033 | Ga0495610_0000033_137604_138335 | 242 |
| 304 | 3300046512 | Ga0495610_0000081 | Ga0495610_0000081_12403_13143 | 242 |
| 305 | 3300046512 | Ga0495610_0000268 | Ga0495610_0000268_38290_39021 | 242 |
| 306 | 3300046512 | Ga0495610_0003356 | Ga0495610_0003356_5527_6258 | 242 |
| 307 | 3300046513 | Ga0495616_0001098 | Ga0495616_0001098_16748_17479 | 242 |
| 308 | 3300046515 | Ga0495620_0003612 | Ga0495620_0003612_5059_5790 | 242 |
| 309 | 3300046518 | Ga0495631_0012804 | Ga0495631_0012804_1444_2175 | 242 |
| 310 | 3300046519 | Ga0495632_0000075 | Ga0495632_0000075_52057_52788 | 242 |
| 311 | 3300046519 | Ga0495632_0000171 | Ga0495632_0000171_45257_45988 | 242 |
| 312 | 3300046519 | Ga0495632_0000309 | Ga0495632_0000309_38460_39191 | 242 |
| 313 | 3300046519 | Ga0495632_0102618 | Ga0495632_0102618_522_1262 | 242 |
| 314 | 3300046520 | Ga0495637_0000123 | Ga0495637_0000123_49250_49981 | 242 |
| 315 | 3300046520 | Ga0495637_0006355 | Ga0495637_0006355_4303_5034 | 242 |
| 316 | 3300046522 | Ga0495643_0000009 | Ga0495643_0000009_270144_270875 | 242 |
| 317 | 3300046522 | Ga0495643_0000077 | Ga0495643_0000077_106193_106933 | 242 |
| 318 | 3300046522 | Ga0495643_0002195 | Ga0495643_0002195_13317_14057 | 242 |
| 319 | 3300046524 | Ga0495648_0000021 | Ga0495648_0000021_50850_51581 | 242 |
| 320 | 3300046524 | Ga0495648_0152164 | Ga0495648_0152164_181_912 | 242 |
| 321 | 3300046525 | Ga0495663_0000003 | Ga0495663_0000003_98741_99472 | 242 |
| 322 | 3300046530 | Ga0495654_0044457 | Ga0495654_0044457_436_1167 | 242 |
| 323 | 3300046538 | Ga0495609_0002388 | Ga0495609_0002388_7468_8208 | 242 |
| 324 | 3300046542 | Ga0495597_0026417 | Ga0495597_0026417_1131_1862 | 242 |
| 325 | 3300046542 | Ga0495597_0097779 | Ga0495597_0097779_468_1199 | 242 |
| 326 | 3300046557 | Ga0495622_0041861 | Ga0495622_0041861_499_1230 | 242 |
| 327 | 3300046558 | Ga0495633_0000173 | Ga0495633_0000173_18592_19323 | 242 |
| 328 | 3300046558 | Ga0495633_0000834 | Ga0495633_0000834_17050_17781 | 242 |
| 329 | 3300046558 | Ga0495633_0005456 | Ga0495633_0005456_2920_3651 | 242 |
| 330 | 3300046558 | Ga0495633_0197982 | Ga0495633_0197982_13_744 | 242 |
| 331 | 3300046616 | Ga0495668_0006451 | Ga0495668_0006451_3935_4666 | 242 |
| 332 | 3300046616 | Ga0495668_0017868 | Ga0495668_0017868_2004_2735 | 242 |
| 333 | 3300046616 | Ga0495668_0068107 | Ga0495668_0068107_1024_1755 | 242 |
| 334 | 3300046616 | Ga0495668_0304761 | Ga0495668_0304761_97_837 | 242 |
| 335 | 3300046660 | Ga0495625_0012995 | Ga0495625_0012995_1168_1908 | 242 |
| 336 | 3300046660 | Ga0495625_0082093 | Ga0495625_0082093_102_833 | 242 |
| 337 | 3300046665 | Ga0495661_0141175 | Ga0495661_0141175_173_904 | 242 |
| 338 | 3300046692 | Ga0495671_0000013 | Ga0495671_0000013_270144_270875 | 242 |
| 339 | 3300046692 | Ga0495671_0000028 | Ga0495671_0000028_183425_184156 | 242 |
| 340 | 3300046692 | Ga0495671_0026112 | Ga0495671_0026112_2244_2975 | 242 |
| 341 | 3300046810 | Ga0495660_0179634 | Ga0495660_0179634_29_769 | 242 |
| 342 | 3300047320 | Ga0495672_0066763 | Ga0495672_0066763_619_1350 | 242 |
| 343 | 3300047469 | Ga0495673_0000058 | Ga0495673_0000058_50835_51566 | 242 |
| 344 | 3300047469 | Ga0495673_0059329 | Ga0495673_0059329_436_1167 | 242 |
| 345 | 3300047470 | Ga0495681_0000041 | Ga0495681_0000041_25917_26648 | 242 |
| 346 | 3300047470 | Ga0495681_0000059 | Ga0495681_0000059_96305_97036 | 242 |
| 347 | 3300047470 | Ga0495681_0001690 | Ga0495681_0001690_8579_9310 | 242 |
| 348 | 3300047472 | Ga0495686_0032850 | Ga0495686_0032850_1354_2085 | 242 |
| 349 | 3300047472 | Ga0495686_0045298 | Ga0495686_0045298_227_958 | 242 |
| 350 | 3300048090 | Ga0495615_0000301 | Ga0495615_0000301_1009_1779 | 242 |
| 351 | 3300048091 | Ga0495626_0002802 | Ga0495626_0002802_5094_5825 | 242 |
| 352 | 3300048903 | Ga0496100_0416374 | Ga0496100_0416374_239_985 | 242 |
| 353 | 3300048905 | Ga0496102_0000034 | Ga0496102_0000034_181621_182352 | 242 |
| 354 | 3300048906 | Ga0496103_0000026 | Ga0496103_0000026_181621_182352 | 242 |
| 355 | 3300048906 | Ga0496103_0036666 | Ga0496103_0036666_354_1091 | 242 |
| 356 | 3300048906 | Ga0496103_0150097 | Ga0496103_0150097_690_1436 | 242 |
| 357 | 3300048907 | Ga0496104_0055124 | Ga0496104_0055124_1780_2517 | 242 |
| 358 | 3300048908 | Ga0496105_0002144 | Ga0496105_0002144_11602_12339 | 242 |
| 359 | 3300048909 | Ga0496106_0005674 | Ga0496106_0005674_5937_6683 | 242 |
| 360 | 3300048910 | Ga0496107_0073171 | Ga0496107_0073171_366_1112 | 242 |
| 361 | 3300048911 | Ga0496108_0140141 | Ga0496108_0140141_389_1135 | 242 |
| 362 | 3300048912 | Ga0496109_0125714 | Ga0496109_0125714_750_1496 | 242 |
| 363 | 3300048912 | Ga0496109_0277808 | Ga0496109_0277808_325_1071 | 242 |
| 364 | 3300048913 | Ga0496110_0022610 | Ga0496110_0022610_3356_4102 | 242 |
| 365 | 3300048913 | Ga0496110_0034268 | Ga0496110_0034268_834_1565 | 242 |
| 366 | 3300048913 | Ga0496110_0059304 | Ga0496110_0059304_1520_2251 | 242 |
| 367 | 3300048914 | Ga0496111_0081339 | Ga0496111_0081339_514_1260 | 242 |
| 368 | 3300048914 | Ga0496111_0204608 | Ga0496111_0204608_13_744 | 242 |
| 369 | 3300048914 | Ga0496111_0499392 | Ga0496111_0499392_70_816 | 242 |
| 370 | 3300048915 | Ga0496112_0202578 | Ga0496112_0202578_898_1644 | 242 |
| 371 | 3300048916 | Ga0496113_0288784 | Ga0496113_0288784_192_923 | 242 |
| 372 | 3300048916 | Ga0496113_0652246 | Ga0496113_0652246_32_778 | 242 |
| 373 | 3300048917 | Ga0496114_0179412 | Ga0496114_0179412_512_1258 | 242 |
| 374 | 3300048918 | Ga0496115_0316127 | Ga0496115_0316127_24_770 | 242 |
| 375 | 3300048919 | Ga0496116_0000062 | Ga0496116_0000062_210693_211424 | 242 |
| 376 | 3300048919 | Ga0496116_0010032 | Ga0496116_0010032_3200_3931 | 242 |
| 377 | 3300048920 | Ga0496117_0000072 | Ga0496117_0000072_206161_206892 | 242 |
| 378 | 3300048920 | Ga0496117_0014507 | Ga0496117_0014507_3791_4522 | 242 |
| 379 | 3300048920 | Ga0496117_0015022 | Ga0496117_0015022_1671_2402 | 242 |
| 380 | 3300048920 | Ga0496117_0024307 | Ga0496117_0024307_174_911 | 242 |
| 381 | 3300048921 | Ga0496118_0000030 | Ga0496118_0000030_31475_32206 | 242 |
| 382 | 3300048921 | Ga0496118_0022739 | Ga0496118_0022739_1104_1835 | 242 |
| 383 | 3300048921 | Ga0496118_0027419 | Ga0496118_0027419_695_1432 | 242 |
| 384 | 3300048921 | Ga0496118_0076954 | Ga0496118_0076954_1020_1775 | 242 |
| 385 | 3300048922 | Ga0496119_0026304 | Ga0496119_0026304_2785_3516 | 242 |
| 386 | 3300048922 | Ga0496119_0049832 | Ga0496119_0049832_705_1436 | 242 |
| 387 | 3300048924 | Ga0496121_0000065 | Ga0496121_0000065_31171_31926 | 242 |
| 388 | 3300048924 | Ga0496121_0000087 | Ga0496121_0000087_7227_7988 | 242 |
| 389 | 3300048924 | Ga0496121_0000196 | Ga0496121_0000196_117243_117980 | 242 |
| 390 | 3300048924 | Ga0496121_0015255 | Ga0496121_0015255_1602_2333 | 242 |
| 391 | 3300048925 | Ga0496122_0004355 | Ga0496122_0004355_10605_11336 | 242 |
| 392 | 3300048925 | Ga0496122_0010052 | Ga0496122_0010052_3907_4677 | 242 |
| 393 | 3300048925 | Ga0496122_0020834 | Ga0496122_0020834_2299_3030 | 242 |
| 394 | 3300048925 | Ga0496122_0061498 | Ga0496122_0061498_357_1112 | 242 |
| 395 | 3300048926 | Ga0496123_0000545 | Ga0496123_0000545_59697_60428 | 242 |
| 396 | 3300048926 | Ga0496123_0000944 | Ga0496123_0000944_37719_38489 | 242 |
| 397 | 3300048926 | Ga0496123_0077549 | Ga0496123_0077549_1119_1850 | 242 |
| 398 | 3300048927 | Ga0496124_0000061 | Ga0496124_0000061_31475_32206 | 242 |
| 399 | 3300048927 | Ga0496124_0013522 | Ga0496124_0013522_4636_5391 | 242 |
| 400 | 3300048927 | Ga0496124_0014784 | Ga0496124_0014784_3580_4311 | 242 |
| 401 | 3300048927 | Ga0496124_0026937 | Ga0496124_0026937_3225_3956 | 242 |
| 402 | 3300048927 | Ga0496124_0080968 | Ga0496124_0080968_677_1447 | 242 |
| 403 | 3300048927 | Ga0496124_0117392 | Ga0496124_0117392_289_1020 | 242 |
| 404 | 3300048928 | Ga0496125_0041750 | Ga0496125_0041750_834_1589 | 242 |
| 405 | 3300048928 | Ga0496125_0051925 | Ga0496125_0051925_1389_2120 | 242 |
| 406 | 3300048928 | Ga0496125_0054369 | Ga0496125_0054369_1749_2480 | 242 |
| 407 | 3300048928 | Ga0496125_0058919 | Ga0496125_0058919_161_892 | 242 |
| 408 | 3300048928 | Ga0496125_0074461 | Ga0496125_0074461_933_1664 | 242 |
| 409 | 3300048929 | Ga0496126_0000801 | Ga0496126_0000801_51808_52539 | 242 |
| 410 | 3300048929 | Ga0496126_0006880 | Ga0496126_0006880_3524_4279 | 242 |
| 411 | 3300048929 | Ga0496126_0007548 | Ga0496126_0007548_7015_7761 | 242 |
| 412 | 3300048929 | Ga0496126_0087053 | Ga0496126_0087053_960_1691 | 242 |
| 413 | 3300049459 | Ga0495678_027495 | Ga0495678_027495_893_1624 | 242 |
| 414 | 3300049571 | Ga0501034_0014247 | Ga0501034_0014247_5938_6669 | 242 |
| 415 | 3300049571 | Ga0501034_0032927 | Ga0501034_0032927_3528_4337 | 242 |
| 416 | 3300049588 | Ga0501072_0249747 | Ga0501072_0249747_614_1393 | 242 |
| 417 | 3300049591 | Ga0501075_0212176 | Ga0501075_0212176_461_1240 | 242 |
| 418 | 3300049592 | Ga0501076_0185418 | Ga0501076_0185418_826_1605 | 242 |
| 419 | 3300049658 | Ga0501211_006620 | Ga0501211_006620_180_911 | 242 |
| 420 | 3300049663 | Ga0501223_000056 | Ga0501223_000056_1040_1771 | 242 |
| 421 | 3300049663 | Ga0501223_000072 | Ga0501223_000072_26025_26756 | 242 |
| 422 | 3300049664 | Ga0501224_000004 | Ga0501224_000004_92646_93377 | 242 |
| 423 | 3300049669 | Ga0501235_001470 | Ga0501235_001470_380_1111 | 242 |
| 424 | 3300049669 | Ga0501235_015594 | Ga0501235_015594_748_1479 | 242 |
| 425 | 3300049705 | Ga0501225_0000002 | Ga0501225_0000002_127211_127942 | 242 |
| 426 | 3300049705 | Ga0501225_0000060 | Ga0501225_0000060_28456_29187 | 242 |
| 427 | 3300049705 | Ga0501225_0001161 | Ga0501225_0001161_233_964 | 242 |
| 428 | 3300049705 | Ga0501225_0011492 | Ga0501225_0011492_595_1326 | 242 |
| 429 | 3300049707 | Ga0501234_000247 | Ga0501234_000247_5433_6164 | 242 |
| 430 | 3300049708 | Ga0501245_004415 | Ga0501245_004415_638_1369 | 242 |
| 431 | 3300049822 | Ga0501035_0327064 | Ga0501035_0327064_149_880 | 242 |
| 432 | 3300049824 | Ga0501045_0455482 | Ga0501045_0455482_58_891 | 242 |
| 433 | 3300049853 | Ga0501226_000018 | Ga0501226_000018_75693_76424 | 242 |
| 434 | 3300050491 | nmdc:mga00v17_45994_c1 | nmdc:mga00v17_45994_c1_799_1530 | 242 |
| 435 | 3300050493 | nmdc:mga0k408_45398_c1 | nmdc:mga0k408_45398_c1_115_846 | 242 |
| 436 | 3300050494 | nmdc:mga06z11_20_c1 | nmdc:mga06z11_20_c1_53263_53994 | 242 |
| 437 | 3300050495 | nmdc:mga04h51_108_c1 | nmdc:mga04h51_108_c1_21710_22441 | 242 |
| 438 | 3300050496 | nmdc:mga07m45_37166_c1 | nmdc:mga07m45_37166_c1_929_1660 | 242 |
| 439 | 3300050496 | nmdc:mga07m45_39006_c1 | nmdc:mga07m45_39006_c1_453_1199 | 242 |
| 440 | 3300050496 | nmdc:mga07m45_58847_c1 | nmdc:mga07m45_58847_c1_634_1365 | 242 |
| 441 | 3300050496 | nmdc:mga07m45_80608_c1 | nmdc:mga07m45_80608_c1_531_1262 | 242 |
| 442 | 3300050511 | nmdc:mga08y16_390695_c1 | nmdc:mga08y16_390695_c1_411_1142 | 242 |
| 443 | 3300053087 | Ga0500643_000172 | Ga0500643_000172_34423_35154 | 242 |
| 444 | 3300053087 | Ga0500643_000195 | Ga0500643_000195_53278_54006 | 242 |
| 445 | 3300053087 | Ga0500643_011200 | Ga0500643_011200_2215_2946 | 242 |
| 446 | 3300053093 | Ga0500651_0001347 | Ga0500651_0001347_7113_7844 | 242 |
| 447 | 3300053104 | Ga0500556_0000025 | Ga0500556_0000025_6957_7688 | 242 |
| 448 | 3300053105 | Ga0500557_043441 | Ga0500557_043441_22_753 | 242 |
| 449 | 3300053108 | Ga0500562_013826 | Ga0500562_013826_1046_1777 | 242 |
| 450 | 3300053108 | Ga0500562_020333 | Ga0500562_020333_850_1581 | 242 |
| 451 | 3300053116 | Ga0500592_000031 | Ga0500592_000031_5403_6131 | 242 |
| 452 | 3300053118 | Ga0500594_0111308 | Ga0500594_0111308_28_759 | 242 |
| 453 | 3300053121 | Ga0500607_000077 | Ga0500607_000077_23444_24175 | 242 |
| 454 | 3300053125 | Ga0500618_001872 | Ga0500618_001872_5167_6003 | 242 |
| 455 | 3300053125 | Ga0500618_003530 | Ga0500618_003530_709_1440 | 242 |
| 456 | 3300053130 | Ga0500642_0000001 | Ga0500642_0000001_5916_6647 | 242 |
| 457 | 3300053133 | Ga0500655_000024 | Ga0500655_000024_31922_32653 | 242 |
| 458 | 3300053136 | Ga0500559_0000782 | Ga0500559_0000782_8256_8987 | 242 |
| 459 | 3300053136 | Ga0500559_0017236 | Ga0500559_0017236_1047_1781 | 242 |
| 460 | 3300053148 | Ga0500590_001145 | Ga0500590_001145_6838_7569 | 242 |
| 461 | 3300053148 | Ga0500590_001222 | Ga0500590_001222_6275_7006 | 242 |
| 462 | 3300053156 | Ga0500622_0106262 | Ga0500622_0106262_549_1280 | 242 |
| 463 | 3300053156 | Ga0500622_0224541 | Ga0500622_0224541_36_767 | 242 |
| 464 | 3300053157 | Ga0500624_000028 | Ga0500624_000028_92358_93089 | 242 |
| 465 | 3300053724 | Ga0500570_016370 | Ga0500570_016370_890_1621 | 242 |
| 466 | 3300053730 | Ga0500645_003231 | Ga0500645_003231_4852_5583 | 242 |
| 467 | 3300060353 | Ga0501082_0590672 | Ga0501082_0590672_25_804 | 242 |
| 468 | iso_pu_bacteria | 2919138771 | 2919142104 | 242 |
| 469 | iso_pu_bacteria | 8054302542 | 8054305241 | 242 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4obx-assembly1.cif.gz_B | crystal structure of yeast coq5 in the apo form | 0.9363 | 27 | 242 |
| 4obx-assembly1.cif.gz_B | crystal structure of yeast coq5 in the apo form | 0.8598 | 27 | 242 |
| 3grz-assembly1.cif.gz_B | crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus | 0.8494 | 47 | 242 |
| 3grz-assembly1.cif.gz_A | crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus | 0.8416 | 47 | 242 |
| 1vl5-assembly4.cif.gz_D | crystal structure of a putative methyltransferase (bh2331) from bacillus halodurans c-125 at 1.95 a resolution | 0.8383 | 47 | 227 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A887_31_251_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9781 | 27 | 242 | 3.40.50.150 |
| af_Q9VYF8_68_301_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9579 | 27 | 242 | 3.40.50.150 |
| af_Q59ZE2_70_306_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9553 | 27 | 242 | 3.40.50.150 |
| af_P9WFR3_19_228_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9521 | 28 | 242 | 3.40.50.150 |
| af_P0A887_31_251_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.952 | 27 | 242 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2P8Y1N3-F1-model_v4 | deleted | 0.9806 | 2 | 242 |
|
| AF-B4JNM4-F1-model_v4 | 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (EC 2.1.1.201) (Ubiquinone biosynthesis methyltransferase COQ5) | 0.98 | 2 | 242 |
GO:0008425
GO:0031314 GO:0032259 |
| AF-A0A1W4XF56-F1-model_v4 | 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (EC 2.1.1.201) (Ubiquinone biosynthesis methyltransferase COQ5) | 0.9793 | 2 | 242 |
GO:0008425
GO:0031314 GO:0032259 |
| AF-A0A2E2SF17-F1-model_v4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) | 0.9757 | 2 | 242 |
GO:0008425
GO:0009060 GO:0009234 GO:0032259 GO:0043770 |
| AF-A0A0D6P4T0-F1-model_v4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) | 0.9737 | 1 | 242 |
GO:0008425
GO:0009060 GO:0009234 GO:0032259 GO:0043770 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar