F450320

General Info

Members Datasets Scaffolds Average Seq Length
469 287 936 202

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_106321_c1|nmdc:mga08y16_106321_c1_2030_2737
Length 235
Sequence MVSMAWIARLSVAGPNGPSTPRRSGARVIAVVLQFWFEFASTYTYPAAMRVEKAAQNAGVDLEYCPFLLGPIFAEQGWKDSPFNIYPAKGRYMWRDLERLCAGLSLPFRKPTVFPRNGLLAARVATIGRNQAWGRAFVRGVFHANFADDRDIASADVISAVLEGVGQEPNAVLARAASQEIKQELRGRTEAAQSLGIFGAPSFVVDGELFWGNDRLEMALDFARNRAQRRGSARG

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
131 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
132 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
133 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
136 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
137 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
144 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
148 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
159 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
170 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
177 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
191 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
226 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
227 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
228 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
229 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
250 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
251 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
256 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
260 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
263 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
264 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
265 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
274 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
275 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
276 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
279 2508501050 Microvirga lupini Lut6 Isolate Nodule
280 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
281 2773857925 Microvirga vignae BR3299 Isolate Unclassified
282 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
283 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
284 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
285 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
286 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
287 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.87
Metatranscriptomes 0.21
Isolates 1.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.97
Nodule 0.85
Rhizoplane 7.46
Rhizosphere 81.45
Stem 0
Stem Tuber 0
Unclassified 9.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_106321_c1 3300050511 Bacteria 2921
2 JGI25406J46586_10011448 3300003203 Unclassified 3891
3 JGI25406J46586_10053802 3300003203 Bacteria 1334
4 Ga0055526_1003941 3300003771 Bacteria 9161
5 Ga0065704_10207533 3300005289 Bacteria 1121
6 Ga0070658_10050556 3300005327 Bacteria 3369
7 Ga0070658_10100096 3300005327 Bacteria 2395
8 Ga0070676_10086191 3300005328 Bacteria 1915
9 Ga0068869_100533284 3300005334 Bacteria 984
10 Ga0070680_100105312 3300005336 Bacteria 2344
11 Ga0070680_100296156 3300005336 Bacteria 1371
12 Ga0070680_100775828 3300005336 Bacteria 826
13 Ga0070660_100045463 3300005339 Bacteria 3361
14 Ga0070660_100351757 3300005339 Bacteria 1213
15 Ga0070661_100084452 3300005344 Bacteria 2346
16 Ga0070692_10413667 3300005345 Bacteria 854
17 Ga0070668_100260153 3300005347 Bacteria 1443
18 Ga0070668_100278087 3300005347 Bacteria 1397
19 Ga0070669_100515348 3300005353 Bacteria 993
20 Ga0070669_100669453 3300005353 Bacteria 874
21 Ga0070671_100126396 3300005355 Bacteria 2153
22 Ga0070671_100848439 3300005355 Bacteria 797
23 Ga0070671_100945182 3300005355 Bacteria 754
24 Ga0070674_100790375 3300005356 Bacteria 819
25 Ga0070688_101006243 3300005365 Unclassified 662
26 Ga0070659_100025402 3300005366 Bacteria 4549
27 Ga0070659_100484314 3300005366 Bacteria 1053
28 Ga0070659_100668403 3300005366 Bacteria 896
29 Ga0070709_10188899 3300005434 Bacteria 1452
30 Ga0070714_100043259 3300005435 Bacteria 3809
31 Ga0070714_100261713 3300005435 Bacteria 1602
32 Ga0070713_100986591 3300005436 Unclassified 812
33 Ga0070711_100369779 3300005439 Bacteria 1157
34 Ga0070711_100862277 3300005439 Bacteria 771
35 Ga0070694_100046443 3300005444 Unclassified 2916
36 Ga0070662_100083405 3300005457 Bacteria 2385
37 Ga0070662_100303045 3300005457 Bacteria 1299
38 Ga0070662_100367293 3300005457 Bacteria 1182
39 Ga0070681_10129991 3300005458 Bacteria 2450
40 Ga0070681_10311899 3300005458 Unclassified 1482
41 Ga0070681_10536286 3300005458 Bacteria 1084
42 Ga0068867_100479461 3300005459 Bacteria 1065
43 Ga0070685_10006320 3300005466 Bacteria 6039
44 Ga0070706_100000006 3300005467 Bacteria 262251
45 Ga0070707_100008156 3300005468 Bacteria 9717
46 Ga0070699_100272124 3300005518 Bacteria 1516
47 Ga0070699_100753048 3300005518 Bacteria 891
48 Ga0070679_100168040 3300005530 Bacteria 2166
49 Ga0070679_100270340 3300005530 Bacteria 1654
50 Ga0070684_100334866 3300005535 Bacteria 1391
51 Ga0070697_100001241 3300005536 Bacteria 19289
52 Ga0070697_100004274 3300005536 Bacteria 10949
53 Ga0070697_100184503 3300005536 Unclassified 1769
54 Ga0068853_100993755 3300005539 Bacteria 808
55 Ga0070672_100681155 3300005543 Bacteria 899
56 Ga0070686_100107540 3300005544 Bacteria 1894
57 Ga0070686_100314775 3300005544 Bacteria 1165
58 Ga0070695_100147965 3300005545 Unclassified 1636
59 Ga0070696_100057260 3300005546 Unclassified 2720
60 Ga0070696_100313022 3300005546 Unclassified 1206
61 Ga0070696_100400472 3300005546 Unclassified 1074
62 Ga0070704_100301749 3300005549 Unclassified 1335
63 Ga0070704_101036567 3300005549 Unclassified 743
64 Ga0068855_100333578 3300005563 Bacteria 1674
65 Ga0068855_100633710 3300005563 Bacteria 1150
66 Ga0070664_100015056 3300005564 Bacteria 6315
67 Ga0070664_100630898 3300005564 Bacteria 995
68 Ga0068852_100137069 3300005616 Bacteria 2260
69 Ga0068859_100189938 3300005617 Bacteria 2138
70 Ga0068864_100339715 3300005618 Bacteria 1415
71 Ga0068861_100298940 3300005719 Bacteria 1393
72 Ga0068861_100417078 3300005719 Bacteria 1195
73 Ga0068861_100864417 3300005719 Unclassified 854
74 Ga0068851_10225574 3300005834 Bacteria 1054
75 Ga0068863_100110540 3300005841 Bacteria 2617
76 Ga0068860_100515169 3300005843 Bacteria 1196
77 Ga0068862_100315465 3300005844 Bacteria 1442
78 Ga0081455_10035734 3300005937 Bacteria 4435
79 Ga0081455_10083381 3300005937 Bacteria 2612
80 Ga0081539_10000007 3300005985 Bacteria 532790
81 Ga0081539_10109257 3300005985 Bacteria 1395
82 Ga0081539_10118207 3300005985 Unclassified 1321
83 Ga0070717_10048973 3300006028 Bacteria 3468
84 Ga0075365_10148756 3300006038 Bacteria 1629
85 Ga0075368_10007713 3300006042 Bacteria 3807
86 Ga0075363_100026684 3300006048 Bacteria 2956
87 Ga0075363_100042692 3300006048 Bacteria 2397
88 Ga0075363_100273081 3300006048 Bacteria 977
89 Ga0075364_10015139 3300006051 Bacteria 4776
90 Ga0070715_10200624 3300006163 Bacteria 1013
91 Ga0070712_100379474 3300006175 Bacteria 1163
92 Ga0070712_101065179 3300006175 Bacteria 701
93 Ga0075367_10004504 3300006178 Bacteria 6810
94 Ga0075367_10021447 3300006178 Bacteria 3610
95 Ga0075367_10029130 3300006178 Bacteria 3155
96 Ga0075366_10192681 3300006195 Unclassified 1239
97 Ga0068871_100877760 3300006358 Unclassified 830
98 Ga0075428_100091216 3300006844 Bacteria 3323
99 Ga0075430_100026574 3300006846 Bacteria 4923
100 Ga0075430_100050397 3300006846 Bacteria 3512
101 Ga0075431_100015853 3300006847 Bacteria 7642
102 Ga0075431_100023667 3300006847 Bacteria 6288
103 Ga0075433_10700549 3300006852 Unclassified 887
104 Ga0075433_10894644 3300006852 Bacteria 774
105 Ga0075434_100013740 3300006871 Bacteria 7721
106 Ga0075434_100220702 3300006871 Bacteria 1915
107 Ga0075434_101129845 3300006871 Unclassified 796
108 Ga0075429_100416982 3300006880 Bacteria 1176
109 Ga0075429_100645505 3300006880 Bacteria 927
110 Ga0068865_100640049 3300006881 Bacteria 903
111 Ga0097620_100189953 3300006931 Bacteria 2138
112 Ga0105240_10210188 3300009093 Bacteria 2275
113 Ga0105240_10227796 3300009093 Bacteria 2168
114 Ga0105240_11255154 3300009093 Bacteria 783
115 Ga0111539_10020371 3300009094 Bacteria 8168
116 Ga0111539_10133920 3300009094 Unclassified 2902
117 Ga0111539_11043931 3300009094 Bacteria 950
118 Ga0111539_11594332 3300009094 Unclassified 757
119 Ga0114129_10019040 3300009147 Bacteria 9778
120 Ga0114129_10058960 3300009147 Bacteria 5368
121 Ga0114129_10826221 3300009147 Unclassified 1180
122 Ga0114129_10881624 3300009147 Bacteria 1135
123 Ga0105242_10052781 3300009176 Bacteria 3319
124 Ga0105248_10061628 3300009177 Bacteria 4212
125 Ga0105237_10112680 3300009545 Bacteria 2712
126 Ga0105238_10206811 3300009551 Bacteria 1939
127 Ga0105249_10743309 3300009553 Bacteria 1043
128 Ga0105249_11491997 3300009553 Bacteria 748
129 Ga0105239_10322932 3300010375 Bacteria 1741
130 Ga0157373_10000482 3300013100 Bacteria 31638
131 Ga0157373_10000483 3300013100 Bacteria 31535
132 Ga0157373_10073306 3300013100 Bacteria 2416
133 Ga0157370_10126815 3300013104 Bacteria 2382
134 Ga0157369_10475925 3300013105 Bacteria 1292
135 Ga0157369_10530903 3300013105 Bacteria 1217
136 Ga0157374_10014264 3300013296 Bacteria 6950
137 Ga0163162_10041993 3300013306 Bacteria 4576
138 Ga0157375_11719841 3300013308 Bacteria 743
139 Ga0163163_10006588 3300014325 Bacteria 10169
140 Ga0157380_10128983 3300014326 Bacteria 2154
141 Ga0157380_10171261 3300014326 Bacteria 1897
142 Ga0157380_10661267 3300014326 Bacteria 1044
143 Ga0157379_10011014 3300014968 Bacteria 7884
144 Ga0206353_11808605 3300020082 Bacteria 1122
145 Ga0213873_10040939 3300021358 Unclassified 1193
146 Ga0213872_10006920 3300021361 Bacteria 5643
147 Ga0213876_10259433 3300021384 Bacteria 923
148 Ga0213871_10025824 3300021441 Bacteria 1498
149 Ga0209256_1001934 3300025299 Bacteria 18875
150 Ga0207682_10272564 3300025893 Bacteria 790
151 Ga0207688_10064210 3300025901 Bacteria 2072
152 Ga0207699_10554639 3300025906 Bacteria 834
153 Ga0207645_10037334 3300025907 Bacteria 3117
154 Ga0207643_10333561 3300025908 Unclassified 949
155 Ga0207684_10000004 3300025910 Bacteria 755956
156 Ga0207707_10435032 3300025912 Unclassified 1123
157 Ga0207693_10021241 3300025915 Bacteria 5160
158 Ga0207660_10097802 3300025917 Bacteria 2188
159 Ga0207660_10230124 3300025917 Bacteria 1457
160 Ga0207660_10670375 3300025917 Bacteria 846
161 Ga0207657_10019161 3300025919 Bacteria 6507
162 Ga0207657_10072257 3300025919 Bacteria 2919
163 Ga0207649_10128898 3300025920 Bacteria 1716
164 Ga0207652_10006588 3300025921 Bacteria 9363
165 Ga0207652_10310217 3300025921 Bacteria 1424
166 Ga0207646_10163855 3300025922 Bacteria 2007
167 Ga0207681_10026767 3300025923 Bacteria 3723
168 Ga0207664_10029862 3300025929 Bacteria 4157
169 Ga0207664_10262401 3300025929 Bacteria 1511
170 Ga0207690_10004834 3300025932 Bacteria 7950
171 Ga0207690_10063207 3300025932 Bacteria 2523
172 Ga0207690_10244675 3300025932 Bacteria 1383
173 Ga0207706_10020030 3300025933 Bacteria 6011
174 Ga0207706_10069607 3300025933 Unclassified 3095
175 Ga0207686_10012469 3300025934 Bacteria 4674
176 Ga0207670_10294197 3300025936 Unclassified 1269
177 Ga0207669_10239655 3300025937 Bacteria 1344
178 Ga0207704_10155968 3300025938 Bacteria 1618
179 Ga0207665_10020086 3300025939 Bacteria 4387
180 Ga0207691_10546877 3300025940 Bacteria 982
181 Ga0207689_10378079 3300025942 Bacteria 1179
182 Ga0207679_10100783 3300025945 Bacteria 2258
183 Ga0207679_10593987 3300025945 Bacteria 997
184 Ga0207667_10123163 3300025949 Bacteria 2671
185 Ga0207639_10101876 3300026041 Bacteria 2323
186 Ga0207639_10468317 3300026041 Bacteria 1147
187 Ga0207678_10314423 3300026067 Bacteria 1347
188 Ga0207641_10095707 3300026088 Bacteria 2607
189 Ga0207641_10667414 3300026088 Bacteria 1022
190 Ga0207648_10735470 3300026089 Bacteria 916
191 Ga0207676_10321443 3300026095 Bacteria 1421
192 Ga0207675_100101206 3300026118 Bacteria 2715
193 Ga0207675_100322853 3300026118 Unclassified 1508
194 Ga0207675_100416250 3300026118 Bacteria 1327
195 Ga0207675_100462457 3300026118 Bacteria 1259
196 Ga0207675_100784328 3300026118 Bacteria 965
197 Ga0207683_10092751 3300026121 Bacteria 2691
198 Ga0207698_10580096 3300026142 Bacteria 1103
199 Ga0209813_10003986 3300027866 Bacteria 3500
200 Ga0207428_10066685 3300027907 Bacteria 2835
201 Ga0268265_10526505 3300028380 Bacteria 1118
202 Ga0265337_1003947 3300028556 Bacteria 6281
203 Ga0265330_10011835 3300031235 Bacteria 4087
204 Ga0265332_10000237 3300031238 Bacteria 43903
205 Ga0265328_10001362 3300031239 Bacteria 11281
206 Ga0265328_10002139 3300031239 Bacteria 8921
207 Ga0265320_10033016 3300031240 Unclassified 2645
208 Ga0265325_10024533 3300031241 Bacteria 3280
209 Ga0265329_10011438 3300031242 Bacteria 3224
210 Ga0265340_10142875 3300031247 Bacteria 1094
211 Ga0265331_10000336 3300031250 Bacteria 50300
212 Ga0265316_10000347 3300031344 Bacteria 51995
213 Ga0307509_10099849 3300031507 Bacteria 2943
214 Ga0307408_100049937 3300031548 Bacteria 3006
215 Ga0307408_101319157 3300031548 Bacteria 677
216 Ga0265313_10029727 3300031595 Bacteria 2822
217 Ga0316575_10025864 3300031665 Bacteria 2278
218 Ga0316579_10275199 3300031691 Bacteria 814
219 Ga0265314_10005405 3300031711 Bacteria 11543
220 Ga0265314_10008363 3300031711 Bacteria 8870
221 Ga0265314_10256349 3300031711 Bacteria 1001
222 Ga0265342_10000149 3300031712 Bacteria 79177
223 Ga0265342_10130846 3300031712 Bacteria 1406
224 Ga0316576_10017473 3300031727 Bacteria 4874
225 Ga0316576_10024103 3300031727 Bacteria 4246
226 Ga0316578_10103750 3300031728 Bacteria 1705
227 Ga0307405_10232514 3300031731 Bacteria 1360
228 Ga0316577_10320008 3300031733 Bacteria 879
229 Ga0307413_10121170 3300031824 Bacteria 1772
230 Ga0307410_10005636 3300031852 Bacteria 6656
231 Ga0307410_10252648 3300031852 Bacteria 1371
232 Ga0307406_10149523 3300031901 Bacteria 1664
233 Ga0307406_10839181 3300031901 Bacteria 778
234 Ga0307407_10029767 3300031903 Bacteria 2938
235 Ga0307407_10212458 3300031903 Bacteria 1303
236 Ga0307409_100072018 3300031995 Bacteria 2750
237 Ga0307409_100226364 3300031995 Unclassified 1692
238 Ga0307409_100305383 3300031995 Bacteria 1482
239 Ga0307414_10165242 3300032004 Bacteria 1763
240 Ga0307415_100386313 3300032126 Bacteria 1190
241 Ga0316583_10008460 3300032133 Bacteria 3712
242 Ga0373926_0208172 3300035083 Bacteria 753
243 Ga0373934_0004747 3300035086 Bacteria 5025
244 Ga0373940_0075438 3300035088 Bacteria 989
245 Ga0373923_0002625 3300035111 Bacteria 5578
246 Ga0373936_0058877 3300035113 Bacteria 1565
247 Ga0373939_0002165 3300035114 Bacteria 4662
248 Ga0373939_0054281 3300035114 Bacteria 1254
249 Ga0373954_0045387 3300035118 Bacteria 2053
250 Ga0373956_0004325 3300035119 Bacteria 5700
251 Ga0373957_0049911 3300035120 Unclassified 1598
252 Ga0373955_0039657 3300035172 Bacteria 2515
253 Ga0373955_0082027 3300035172 Unclassified 1824
254 Ga0373942_0005018 3300035207 Bacteria 3069
255 Ga0316574_0064232 3300035398 Bacteria 2309
256 Ga0316574_0101511 3300035398 Bacteria 1841
257 Ga0373935_0003845 3300035692 Bacteria 8759
258 Ga0373935_0567448 3300035692 Unclassified 828
259 Ga0373927_0051127 3300035695 Bacteria 2672
260 Ga0373927_0269207 3300035695 Unclassified 1120
261 Ga0373933_0019633 3300035724 Bacteria 3821
262 Ga0373947_0019069 3300035725 Bacteria 3953
263 Ga0373937_0008717 3300036401 Bacteria 8810
264 Ga0373937_0308760 3300036401 Bacteria 1496
265 Ga0316582_0077668 3300036647 Bacteria 2161
266 Ga0316582_0080301 3300036647 Bacteria 2128
267 Ga0316582_0181656 3300036647 Bacteria 1432
268 Ga0316584_0107308 3300036712 Bacteria 2089
269 Ga0316584_0260602 3300036712 Bacteria 1264
270 Ga0373925_0184001 3300037068 Bacteria 1655
271 Ga0373925_0678519 3300037068 Bacteria 849
272 Ga0395900_0356590 3300037418 Bacteria 1435
273 Ga0395898_1043948 3300037466 Bacteria 752
274 Ga0395905_0104433 3300037471 Bacteria 2660
275 Ga0436364_0366204 3300037853 Bacteria 1233
276 Ga0436364_0431105 3300037853 Bacteria 2958
277 Ga0436364_0439380 3300037853 Bacteria 1201
278 Ga0395901_0649145 3300038443 Bacteria 1059
279 Ga0400483_272745 3300039062 Bacteria 1299
280 Ga0436365_0852636 3300039437 Bacteria 1029
281 Ga0436365_0935228 3300039437 Bacteria 1456
282 Ga0436360_0128123 3300039438 Bacteria 1813
283 Ga0436360_0903755 3300039438 Bacteria 1664
284 Ga0436360_0995608 3300039438 Unclassified 1333
285 Ga0436360_1290488 3300039438 Unclassified 914
286 Ga0436361_0488260 3300039447 Bacteria 10686
287 Ga0436361_0637856 3300039447 Bacteria 5666
288 Ga0436361_0743973 3300039447 Unclassified 1079
289 Ga0436361_0963379 3300039447 Unclassified 723
290 Ga0436361_1032864 3300039447 Bacteria 789
291 Ga0436363_0250371 3300039450 Bacteria 912
292 Ga0436363_0723062 3300039450 Bacteria 1306
293 Ga0436363_1063798 3300039450 Bacteria 2335
294 Ga0436362_0023154 3300039453 Bacteria 1885
295 Ga0436362_0495845 3300039453 Bacteria 799
296 Ga0439453_0027232 3300041408 Bacteria 1063
297 Ga0439450_020231 3300042008 Bacteria 1419
298 Ga0466963_0008107 3300044694 Bacteria 6289
299 Ga0466957_0000648 3300044842 Bacteria 17676
300 Ga0451576_0257821 3300045051 Bacteria 1822
301 Ga0451576_0488760 3300045051 Bacteria 1293
302 Ga0466958_0002593 3300045836 Bacteria 9125
303 Ga0495603_0278811 3300046455 Bacteria 961
304 Ga0495638_0300561 3300046460 Unclassified 865
305 Ga0495580_0187252 3300046472 Bacteria 1428
306 Ga0495639_0201256 3300046475 Bacteria 975
307 Ga0495594_0235239 3300046499 Bacteria 1044
308 Ga0495618_0212705 3300046514 Bacteria 1222
309 Ga0495586_0041073 3300046535 Bacteria 2491
310 Ga0495668_0212428 3300046616 Bacteria 1059
311 Ga0495625_0328674 3300046660 Bacteria 972
312 Ga0495588_0250711 3300046674 Bacteria 933
313 Ga0495658_0194789 3300046683 Bacteria 1261
314 Ga0495581_0394899 3300047315 Bacteria 807
315 Ga0495604_0398801 3300047317 Bacteria 906
316 Ga0495686_0000059 3300047472 Bacteria 239388
317 Ga0495686_0037250 3300047472 Bacteria 3117
318 Ga0496100_0274009 3300048903 Bacteria 1256
319 Ga0496102_0012148 3300048905 Bacteria 7443
320 Ga0496102_0167865 3300048905 Bacteria 2066
321 Ga0496103_0035727 3300048906 Bacteria 3042
322 Ga0496104_0002543 3300048907 Bacteria 15710
323 Ga0496104_0008240 3300048907 Bacteria 9256
324 Ga0496104_0191889 3300048907 Bacteria 1954
325 Ga0496105_0001620 3300048908 Bacteria 15992
326 Ga0496105_0067028 3300048908 Bacteria 2963
327 Ga0496105_0084288 3300048908 Bacteria 2625
328 Ga0496105_0175374 3300048908 Bacteria 1756
329 Ga0496105_0178266 3300048908 Bacteria 1740
330 Ga0496106_0029560 3300048909 Bacteria 4084
331 Ga0496106_0563658 3300048909 Bacteria 914
332 Ga0496107_0004579 3300048910 Bacteria 9374
333 Ga0496108_0000823 3300048911 Bacteria 24121
334 Ga0496108_0001302 3300048911 Bacteria 19619
335 Ga0496109_0011065 3300048912 Bacteria 7735
336 Ga0496109_0019164 3300048912 Bacteria 6027
337 Ga0496109_0027614 3300048912 Bacteria 5069
338 Ga0496110_0000113 3300048913 Bacteria 44443
339 Ga0496110_0029301 3300048913 Bacteria 4736
340 Ga0496110_0479078 3300048913 Bacteria 1134
341 Ga0496111_0005499 3300048914 Bacteria 8132
342 Ga0496111_0051486 3300048914 Bacteria 2973
343 Ga0496111_0244158 3300048914 Bacteria 1333
344 Ga0496112_0017979 3300048915 Bacteria 6652
345 Ga0496112_0159231 3300048915 Bacteria 2224
346 Ga0496112_0163619 3300048915 Bacteria 2191
347 Ga0496112_0276373 3300048915 Bacteria 1627
348 Ga0496113_0004452 3300048916 Bacteria 8619
349 Ga0496114_0085084 3300048917 Bacteria 2678
350 Ga0496114_0407076 3300048917 Bacteria 1205
351 Ga0496115_0006135 3300048918 Bacteria 8787
352 Ga0496115_0383613 3300048918 Bacteria 1142
353 Ga0496117_0138702 3300048920 Bacteria 1460
354 Ga0496118_0117568 3300048921 Bacteria 1744
355 Ga0496119_0000788 3300048922 Bacteria 42355
356 Ga0496122_0012574 3300048925 Bacteria 8404
357 Ga0496123_0045613 3300048926 Bacteria 2984
358 Ga0496126_0193589 3300048929 Bacteria 1721
359 Ga0496126_0237657 3300048929 Bacteria 1524
360 Ga0501032_0001916 3300049569 Bacteria 16395
361 Ga0501034_0304762 3300049571 Bacteria 1529
362 Ga0501037_0008028 3300049573 Bacteria 7733
363 Ga0501038_0075725 3300049574 Bacteria 2844
364 Ga0501039_0206877 3300049575 Bacteria 1543
365 Ga0501039_0664882 3300049575 Bacteria 815
366 Ga0501040_0051895 3300049576 Bacteria 2806
367 Ga0501041_0013666 3300049577 Bacteria 4816
368 Ga0501043_0005771 3300049579 Bacteria 9969
369 Ga0501046_0066147 3300049580 Bacteria 2818
370 Ga0501047_0004027 3300049581 Bacteria 13817
371 Ga0501047_0011140 3300049581 Bacteria 8510
372 Ga0501047_0104423 3300049581 Unclassified 2713
373 Ga0501047_0263943 3300049581 Bacteria 1569
374 Ga0501048_0011502 3300049582 Bacteria 6600
375 Ga0501048_0304866 3300049582 Bacteria 1133
376 Ga0501067_0000034 3300049583 Bacteria 84068
377 Ga0501067_0060321 3300049583 Bacteria 2100
378 Ga0501067_0390398 3300049583 Bacteria 776
379 Ga0501068_0000104 3300049584 Bacteria 36213
380 Ga0501068_0021543 3300049584 Bacteria 3764
381 Ga0501070_0193114 3300049586 Bacteria 1673
382 Ga0501070_0971422 3300049586 Unclassified 660
383 Ga0501071_0098441 3300049587 Bacteria 2154
384 Ga0501072_0120177 3300049588 Bacteria 2093
385 Ga0501072_0272020 3300049588 Bacteria 1348
386 Ga0501073_0000013 3300049589 Bacteria 160591
387 Ga0501073_0003369 3300049589 Bacteria 12012
388 Ga0501073_0126666 3300049589 Bacteria 1770
389 Ga0501073_0140132 3300049589 Bacteria 1676
390 Ga0501074_0101569 3300049590 Bacteria 2059
391 Ga0501075_0012324 3300049591 Bacteria 6074
392 Ga0501075_0112676 3300049591 Bacteria 2068
393 Ga0501077_0000032 3300049593 Bacteria 69728
394 Ga0501077_0231577 3300049593 Bacteria 1174
395 Ga0501077_0251705 3300049593 Bacteria 1123
396 Ga0501252_011710 3300049682 Bacteria 1052
397 Ga0501079_0011542 3300049741 Bacteria 6744
398 Ga0501079_0065835 3300049741 Bacteria 2796
399 Ga0501079_0076999 3300049741 Bacteria 2580
400 Ga0501080_0001395 3300049742 Bacteria 20223
401 Ga0501080_0005578 3300049742 Bacteria 11244
402 Ga0501080_0131304 3300049742 Bacteria 2319
403 Ga0501080_0214829 3300049742 Bacteria 1762
404 Ga0501081_0027121 3300049743 Bacteria 3866
405 Ga0501081_0082338 3300049743 Bacteria 2254
406 Ga0501083_0016670 3300049744 Bacteria 5135
407 Ga0501083_0045226 3300049744 Bacteria 2979
408 Ga0501083_0089015 3300049744 Bacteria 2040
409 Ga0501269_012991 3300049766 Bacteria 1019
410 Ga0501044_0010570 3300049823 Bacteria 10011
411 Ga0501044_0033342 3300049823 Bacteria 5413
412 Ga0501044_0262101 3300049823 Bacteria 1667
413 Ga0501045_0002593 3300049824 Bacteria 12334
414 Ga0501045_0072252 3300049824 Bacteria 2540
415 nmdc:mga03n38_154857_c1 3300050490 Bacteria 1156
416 nmdc:mga03n38_37309_c1 3300050490 Bacteria 2095
417 nmdc:mga03n38_42192_c1 3300050490 Bacteria 1993
418 nmdc:mga00v17_10263_c1 3300050491 Bacteria 5107
419 nmdc:mga0yw44_24077_c1 3300050492 Bacteria 3440
420 nmdc:mga0k408_185009_c1 3300050493 Unclassified 1242
421 nmdc:mga06z11_152047_c1 3300050494 Bacteria 1317
422 nmdc:mga06z11_36972_c1 3300050494 Bacteria 2415
423 nmdc:mga06z11_3966_c1 3300050494 Bacteria 5771
424 nmdc:mga04h51_22562_c1 3300050495 Bacteria 1906
425 nmdc:mga04h51_681_c1 3300050495 Bacteria 7885
426 nmdc:mga07m45_372275_c1 3300050496 Bacteria 830
427 nmdc:mga05p37_147525_c1 3300050507 Bacteria 2879
428 nmdc:mga05p37_239745_c1 3300050507 Unclassified 2181
429 nmdc:mga05p37_257927_c1 3300050507 Bacteria 2088
430 nmdc:mga05p37_720392_c1 3300050507 Bacteria 1105
431 nmdc:mga05p37_767649_c1 3300050507 Bacteria 1060
432 nmdc:mga09592_293127_c1 3300050508 Bacteria 1410
433 nmdc:mga0qj67_123033_c1 3300050509 Bacteria 2099
434 nmdc:mga0qj67_268105_c1 3300050509 Bacteria 1385
435 nmdc:mga0qj67_91531_c1 3300050509 Bacteria 2444
436 nmdc:mga06r32_140280_c1 3300050510 Bacteria 2393
437 nmdc:mga06r32_38399_c1 3300050510 Bacteria 4537
438 nmdc:mga06r32_53322_c1 3300050510 Bacteria 3874
439 nmdc:mga08y16_251420_c1 3300050511 Bacteria 1827
440 nmdc:mga08y16_36951_c1 3300050511 Unclassified 3361
441 nmdc:mga0n895_1029787_c1 3300050512 Unclassified 803
442 nmdc:mga0n895_11936_c1 3300050512 Bacteria 7774
443 nmdc:mga0n895_83729_c1 3300050512 Bacteria 3182
444 nmdc:mga0rr50_1152049_c1 3300050513 Bacteria 659
445 nmdc:mga0a205_669184_c1 3300050515 Unclassified 889
446 Ga0500643_006305 3300053087 Bacteria 4975
447 Ga0500583_0238355 3300053092 Bacteria 900
448 Ga0500595_005577 3300053119 Bacteria 5479
449 Ga0501084_0006660 3300054114 Bacteria 9506
450 Ga0501084_0030913 3300054114 Bacteria 4477
451 Ga0501084_0109451 3300054114 Bacteria 2321
452 Ga0501084_0209228 3300054114 Bacteria 1646
453 Ga0501084_0652565 3300054114 Bacteria 888
454 Ga0501082_0002628 3300060353 Bacteria 15695
455 Ga0501082_0027252 3300060353 Bacteria 4920
456 Ga0501082_0058451 3300060353 Bacteria 3322
457 Ga0501082_0509545 3300060353 Bacteria 1052
458 Ga0530510_0001014 3300061734 Bacteria 18625
459 Ga0530510_0068043 3300061734 Bacteria 2584
460 2508727060 2508501050 Bacteria 9633614
461 2509074901 2508501114 Bacteria 7082538
462 2774869635 2773857925 Bacteria 6472445
463 2829747575 2829745981 Bacteria 5406054
464 2835318021 2835312727 Bacteria 7413381
465 2861692272 2861691609 Bacteria 5628931
466 2882458405 2882456835 Bacteria 6863978
467 2884301759 2884298095 Bacteria 3823049
468 2894241293 2894232714 Bacteria 8834183
469 nmdc:mga08y16_106321_c1
470 JGI25406J46586_10011448
471 JGI25406J46586_10053802
472 Ga0055526_1003941
473 Ga0065704_10207533
474 Ga0070658_10050556
475 Ga0070658_10100096
476 Ga0070676_10086191
477 Ga0068869_100533284
478 Ga0070680_100105312
479 Ga0070680_100296156
480 Ga0070680_100775828
481 Ga0070660_100045463
482 Ga0070660_100351757
483 Ga0070661_100084452
484 Ga0070692_10413667
485 Ga0070668_100260153
486 Ga0070668_100278087
487 Ga0070669_100515348
488 Ga0070669_100669453
489 Ga0070671_100126396
490 Ga0070671_100848439
491 Ga0070671_100945182
492 Ga0070674_100790375
493 Ga0070688_101006243
494 Ga0070659_100025402
495 Ga0070659_100484314
496 Ga0070659_100668403
497 Ga0070709_10188899
498 Ga0070714_100043259
499 Ga0070714_100261713
500 Ga0070713_100986591
501 Ga0070711_100369779
502 Ga0070711_100862277
503 Ga0070694_100046443
504 Ga0070662_100083405
505 Ga0070662_100303045
506 Ga0070662_100367293
507 Ga0070681_10129991
508 Ga0070681_10311899
509 Ga0070681_10536286
510 Ga0068867_100479461
511 Ga0070685_10006320
512 Ga0070706_100000006
513 Ga0070707_100008156
514 Ga0070699_100272124
515 Ga0070699_100753048
516 Ga0070679_100168040
517 Ga0070679_100270340
518 Ga0070684_100334866
519 Ga0070697_100001241
520 Ga0070697_100004274
521 Ga0070697_100184503
522 Ga0068853_100993755
523 Ga0070672_100681155
524 Ga0070686_100107540
525 Ga0070686_100314775
526 Ga0070695_100147965
527 Ga0070696_100057260
528 Ga0070696_100313022
529 Ga0070696_100400472
530 Ga0070704_100301749
531 Ga0070704_101036567
532 Ga0068855_100333578
533 Ga0068855_100633710
534 Ga0070664_100015056
535 Ga0070664_100630898
536 Ga0068852_100137069
537 Ga0068859_100189938
538 Ga0068864_100339715
539 Ga0068861_100298940
540 Ga0068861_100417078
541 Ga0068861_100864417
542 Ga0068851_10225574
543 Ga0068863_100110540
544 Ga0068860_100515169
545 Ga0068862_100315465
546 Ga0081455_10035734
547 Ga0081455_10083381
548 Ga0081539_10000007
549 Ga0081539_10109257
550 Ga0081539_10118207
551 Ga0070717_10048973
552 Ga0075365_10148756
553 Ga0075368_10007713
554 Ga0075363_100026684
555 Ga0075363_100042692
556 Ga0075363_100273081
557 Ga0075364_10015139
558 Ga0070715_10200624
559 Ga0070712_100379474
560 Ga0070712_101065179
561 Ga0075367_10004504
562 Ga0075367_10021447
563 Ga0075367_10029130
564 Ga0075366_10192681
565 Ga0068871_100877760
566 Ga0075428_100091216
567 Ga0075430_100026574
568 Ga0075430_100050397
569 Ga0075431_100015853
570 Ga0075431_100023667
571 Ga0075433_10700549
572 Ga0075433_10894644
573 Ga0075434_100013740
574 Ga0075434_100220702
575 Ga0075434_101129845
576 Ga0075429_100416982
577 Ga0075429_100645505
578 Ga0068865_100640049
579 Ga0097620_100189953
580 Ga0105240_10210188
581 Ga0105240_10227796
582 Ga0105240_11255154
583 Ga0111539_10020371
584 Ga0111539_10133920
585 Ga0111539_11043931
586 Ga0111539_11594332
587 Ga0114129_10019040
588 Ga0114129_10058960
589 Ga0114129_10826221
590 Ga0114129_10881624
591 Ga0105242_10052781
592 Ga0105248_10061628
593 Ga0105237_10112680
594 Ga0105238_10206811
595 Ga0105249_10743309
596 Ga0105249_11491997
597 Ga0105239_10322932
598 Ga0157373_10000482
599 Ga0157373_10000483
600 Ga0157373_10073306
601 Ga0157370_10126815
602 Ga0157369_10475925
603 Ga0157369_10530903
604 Ga0157374_10014264
605 Ga0163162_10041993
606 Ga0157375_11719841
607 Ga0163163_10006588
608 Ga0157380_10128983
609 Ga0157380_10171261
610 Ga0157380_10661267
611 Ga0157379_10011014
612 Ga0206353_11808605
613 Ga0213873_10040939
614 Ga0213872_10006920
615 Ga0213876_10259433
616 Ga0213871_10025824
617 Ga0209256_1001934
618 Ga0207682_10272564
619 Ga0207688_10064210
620 Ga0207699_10554639
621 Ga0207645_10037334
622 Ga0207643_10333561
623 Ga0207684_10000004
624 Ga0207707_10435032
625 Ga0207693_10021241
626 Ga0207660_10097802
627 Ga0207660_10230124
628 Ga0207660_10670375
629 Ga0207657_10019161
630 Ga0207657_10072257
631 Ga0207649_10128898
632 Ga0207652_10006588
633 Ga0207652_10310217
634 Ga0207646_10163855
635 Ga0207681_10026767
636 Ga0207664_10029862
637 Ga0207664_10262401
638 Ga0207690_10004834
639 Ga0207690_10063207
640 Ga0207690_10244675
641 Ga0207706_10020030
642 Ga0207706_10069607
643 Ga0207686_10012469
644 Ga0207670_10294197
645 Ga0207669_10239655
646 Ga0207704_10155968
647 Ga0207665_10020086
648 Ga0207691_10546877
649 Ga0207689_10378079
650 Ga0207679_10100783
651 Ga0207679_10593987
652 Ga0207667_10123163
653 Ga0207639_10101876
654 Ga0207639_10468317
655 Ga0207678_10314423
656 Ga0207641_10095707
657 Ga0207641_10667414
658 Ga0207648_10735470
659 Ga0207676_10321443
660 Ga0207675_100101206
661 Ga0207675_100322853
662 Ga0207675_100416250
663 Ga0207675_100462457
664 Ga0207675_100784328
665 Ga0207683_10092751
666 Ga0207698_10580096
667 Ga0209813_10003986
668 Ga0207428_10066685
669 Ga0268265_10526505
670 Ga0265337_1003947
671 Ga0265330_10011835
672 Ga0265332_10000237
673 Ga0265328_10001362
674 Ga0265328_10002139
675 Ga0265320_10033016
676 Ga0265325_10024533
677 Ga0265329_10011438
678 Ga0265340_10142875
679 Ga0265331_10000336
680 Ga0265316_10000347
681 Ga0307509_10099849
682 Ga0307408_100049937
683 Ga0307408_101319157
684 Ga0265313_10029727
685 Ga0316575_10025864
686 Ga0316579_10275199
687 Ga0265314_10005405
688 Ga0265314_10008363
689 Ga0265314_10256349
690 Ga0265342_10000149
691 Ga0265342_10130846
692 Ga0316576_10017473
693 Ga0316576_10024103
694 Ga0316578_10103750
695 Ga0307405_10232514
696 Ga0316577_10320008
697 Ga0307413_10121170
698 Ga0307410_10005636
699 Ga0307410_10252648
700 Ga0307406_10149523
701 Ga0307406_10839181
702 Ga0307407_10029767
703 Ga0307407_10212458
704 Ga0307409_100072018
705 Ga0307409_100226364
706 Ga0307409_100305383
707 Ga0307414_10165242
708 Ga0307415_100386313
709 Ga0316583_10008460
710 Ga0373926_0208172
711 Ga0373934_0004747
712 Ga0373940_0075438
713 Ga0373923_0002625
714 Ga0373936_0058877
715 Ga0373939_0002165
716 Ga0373939_0054281
717 Ga0373954_0045387
718 Ga0373956_0004325
719 Ga0373957_0049911
720 Ga0373955_0039657
721 Ga0373955_0082027
722 Ga0373942_0005018
723 Ga0316574_0064232
724 Ga0316574_0101511
725 Ga0373935_0003845
726 Ga0373935_0567448
727 Ga0373927_0051127
728 Ga0373927_0269207
729 Ga0373933_0019633
730 Ga0373947_0019069
731 Ga0373937_0008717
732 Ga0373937_0308760
733 Ga0316582_0077668
734 Ga0316582_0080301
735 Ga0316582_0181656
736 Ga0316584_0107308
737 Ga0316584_0260602
738 Ga0373925_0184001
739 Ga0373925_0678519
740 Ga0395900_0356590
741 Ga0395898_1043948
742 Ga0395905_0104433
743 Ga0436364_0366204
744 Ga0436364_0431105
745 Ga0436364_0439380
746 Ga0395901_0649145
747 Ga0400483_272745
748 Ga0436365_0852636
749 Ga0436365_0935228
750 Ga0436360_0128123
751 Ga0436360_0903755
752 Ga0436360_0995608
753 Ga0436360_1290488
754 Ga0436361_0488260
755 Ga0436361_0637856
756 Ga0436361_0743973
757 Ga0436361_0963379
758 Ga0436361_1032864
759 Ga0436363_0250371
760 Ga0436363_0723062
761 Ga0436363_1063798
762 Ga0436362_0023154
763 Ga0436362_0495845
764 Ga0439453_0027232
765 Ga0439450_020231
766 Ga0466963_0008107
767 Ga0466957_0000648
768 Ga0451576_0257821
769 Ga0451576_0488760
770 Ga0466958_0002593
771 Ga0495603_0278811
772 Ga0495638_0300561
773 Ga0495580_0187252
774 Ga0495639_0201256
775 Ga0495594_0235239
776 Ga0495618_0212705
777 Ga0495586_0041073
778 Ga0495668_0212428
779 Ga0495625_0328674
780 Ga0495588_0250711
781 Ga0495658_0194789
782 Ga0495581_0394899
783 Ga0495604_0398801
784 Ga0495686_0000059
785 Ga0495686_0037250
786 Ga0496100_0274009
787 Ga0496102_0012148
788 Ga0496102_0167865
789 Ga0496103_0035727
790 Ga0496104_0002543
791 Ga0496104_0008240
792 Ga0496104_0191889
793 Ga0496105_0001620
794 Ga0496105_0067028
795 Ga0496105_0084288
796 Ga0496105_0175374
797 Ga0496105_0178266
798 Ga0496106_0029560
799 Ga0496106_0563658
800 Ga0496107_0004579
801 Ga0496108_0000823
802 Ga0496108_0001302
803 Ga0496109_0011065
804 Ga0496109_0019164
805 Ga0496109_0027614
806 Ga0496110_0000113
807 Ga0496110_0029301
808 Ga0496110_0479078
809 Ga0496111_0005499
810 Ga0496111_0051486
811 Ga0496111_0244158
812 Ga0496112_0017979
813 Ga0496112_0159231
814 Ga0496112_0163619
815 Ga0496112_0276373
816 Ga0496113_0004452
817 Ga0496114_0085084
818 Ga0496114_0407076
819 Ga0496115_0006135
820 Ga0496115_0383613
821 Ga0496117_0138702
822 Ga0496118_0117568
823 Ga0496119_0000788
824 Ga0496122_0012574
825 Ga0496123_0045613
826 Ga0496126_0193589
827 Ga0496126_0237657
828 Ga0501032_0001916
829 Ga0501034_0304762
830 Ga0501037_0008028
831 Ga0501038_0075725
832 Ga0501039_0206877
833 Ga0501039_0664882
834 Ga0501040_0051895
835 Ga0501041_0013666
836 Ga0501043_0005771
837 Ga0501046_0066147
838 Ga0501047_0004027
839 Ga0501047_0011140
840 Ga0501047_0104423
841 Ga0501047_0263943
842 Ga0501048_0011502
843 Ga0501048_0304866
844 Ga0501067_0000034
845 Ga0501067_0060321
846 Ga0501067_0390398
847 Ga0501068_0000104
848 Ga0501068_0021543
849 Ga0501070_0193114
850 Ga0501070_0971422
851 Ga0501071_0098441
852 Ga0501072_0120177
853 Ga0501072_0272020
854 Ga0501073_0000013
855 Ga0501073_0003369
856 Ga0501073_0126666
857 Ga0501073_0140132
858 Ga0501074_0101569
859 Ga0501075_0012324
860 Ga0501075_0112676
861 Ga0501077_0000032
862 Ga0501077_0231577
863 Ga0501077_0251705
864 Ga0501252_011710
865 Ga0501079_0011542
866 Ga0501079_0065835
867 Ga0501079_0076999
868 Ga0501080_0001395
869 Ga0501080_0005578
870 Ga0501080_0131304
871 Ga0501080_0214829
872 Ga0501081_0027121
873 Ga0501081_0082338
874 Ga0501083_0016670
875 Ga0501083_0045226
876 Ga0501083_0089015
877 Ga0501269_012991
878 Ga0501044_0010570
879 Ga0501044_0033342
880 Ga0501044_0262101
881 Ga0501045_0002593
882 Ga0501045_0072252
883 nmdc:mga03n38_154857_c1
884 nmdc:mga03n38_37309_c1
885 nmdc:mga03n38_42192_c1
886 nmdc:mga00v17_10263_c1
887 nmdc:mga0yw44_24077_c1
888 nmdc:mga0k408_185009_c1
889 nmdc:mga06z11_152047_c1
890 nmdc:mga06z11_36972_c1
891 nmdc:mga06z11_3966_c1
892 nmdc:mga04h51_22562_c1
893 nmdc:mga04h51_681_c1
894 nmdc:mga07m45_372275_c1
895 nmdc:mga05p37_147525_c1
896 nmdc:mga05p37_239745_c1
897 nmdc:mga05p37_257927_c1
898 nmdc:mga05p37_720392_c1
899 nmdc:mga05p37_767649_c1
900 nmdc:mga09592_293127_c1
901 nmdc:mga0qj67_123033_c1
902 nmdc:mga0qj67_268105_c1
903 nmdc:mga0qj67_91531_c1
904 nmdc:mga06r32_140280_c1
905 nmdc:mga06r32_38399_c1
906 nmdc:mga06r32_53322_c1
907 nmdc:mga08y16_251420_c1
908 nmdc:mga08y16_36951_c1
909 nmdc:mga0n895_1029787_c1
910 nmdc:mga0n895_11936_c1
911 nmdc:mga0n895_83729_c1
912 nmdc:mga0rr50_1152049_c1
913 nmdc:mga0a205_669184_c1
914 Ga0500643_006305
915 Ga0500583_0238355
916 Ga0500595_005577
917 Ga0501084_0006660
918 Ga0501084_0030913
919 Ga0501084_0109451
920 Ga0501084_0209228
921 Ga0501084_0652565
922 Ga0501082_0002628
923 Ga0501082_0027252
924 Ga0501082_0058451
925 Ga0501082_0509545
926 Ga0530510_0001014
927 Ga0530510_0068043
928 2508727060
929 2509074901
930 2774869635
931 2829747575
932 2835318021
933 2861692272
934 2882458405
935 2884301759
936 2894241293

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

32

223

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fz5-assembly2.cif.gz_D crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides 0.8902 1 197
3fz5-assembly1.cif.gz_A crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides 0.8859 1 197
1r4w-assembly2.cif.gz_D crystal structure of mitochondrial class kappa glutathione transferase 0.8778 3 198
2imd-assembly1.cif.gz_A structure of semet 2-hydroxychromene-2-carboxylate isomerase (hcca isomerase) 0.8749 5 197
3rpn-assembly3.cif.gz_F crystal structure of human kappa class glutathione transferase in complex with s-hexylglutathione 0.8741 2 198
ID Description Score Start End Superfamily
af_Q18973_4_212_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9022 3 196 3.40.30.10
3fz5D00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8884 4 197 3.40.30.10
af_Q09652_5_211_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8877 4 198 3.40.30.10
af_Q18973_4_212_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8809 3 196 3.40.30.10
af_Q09652_5_211_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.871 4 198 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A4S3KAM8-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.9875 4 197 GO:0004364
GO:0004602
GO:0005777
GO:0006749
GO:0018845
GO:1901170
AF-A0A523K707-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase 0.9839 1 195 GO:0004364
GO:0004602
GO:0005777
GO:0006749
GO:0018845
GO:1901170
AF-U7FRT3-F1-model_v4 deleted 0.9837 1 196
AF-A0A5D0VFL9-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.9836 2 197 GO:0004364
GO:0004602
GO:0005777
GO:0006749
GO:0018845
GO:1901170
AF-A0A318E873-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.9825 1 195 GO:0004364
GO:0004602
GO:0005777
GO:0006749
GO:0018845
GO:1901170

Map