F450293

General Info

Members Datasets Scaffolds Average Seq Length
469 266 428 144

Family's Representative Sequence

Representative Sequence 3300046515|Ga0495620_0342687|Ga0495620_0342687_22_495
Length 157
Sequence MSPLTRLEAVPVNPELQGRSYPPAPPYLVGREKVREFARAVFADSPLHHDPESARAAGYSDVVAPPTFPVVVQEHTLAQLLGDPDAGIDFARVVHGDQRFTFSRPIVAGDELTATLTVTSVKTLGGHAMVTAESVIEDADQQHVVTAISSLVVRGDE

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2643221549 Agromyces sp. Root1464 Isolate Unclassified
3 2643221572 Leifsonia sp. Root60 Isolate Unclassified
4 2643221616 Leifsonia sp. Root227 Isolate Unclassified
5 2643221619 Agromyces sp. Root81 Isolate Unclassified
6 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
7 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
8 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
9 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
10 2808606372 Agromyces sp. 23-23 Isolate Unclassified
11 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
12 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
13 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
14 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
15 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
16 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
17 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
18 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
19 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
20 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
21 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
22 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
23 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
24 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
25 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
26 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
27 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
28 2928153084 Leifsonia sp. 563 Isolate Unclassified
29 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
30 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
31 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
32 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
33 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
34 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
35 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
36 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
37 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
38 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
39 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
40 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
41 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
42 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
43 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
44 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
45 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
46 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
47 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
48 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
54 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
55 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
96 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
114 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
115 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
161 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
162 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
163 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
164 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
165 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
166 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
167 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
168 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
169 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
170 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
171 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
178 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
186 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
189 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
190 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
230 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
231 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
248 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
249 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
250 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
251 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
252 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
253 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
254 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
255 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
256 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
257 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
258 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
259 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
262 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
263 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
264 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
265 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
266 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.06
Metatranscriptomes 3.2
Isolates 8.74

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 13.43
Nodule 0
Rhizoplane 5.12
Rhizosphere 70.36
Stem 0
Stem Tuber 0.21
Unclassified 10.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1007050 3300002737 Bacteria 1815
2 JGI25164J39214_1000796 3300002772 Bacteria 11303
3 JGI25165J46597_1000014 3300003214 Bacteria 390383
4 JGI25165J46597_1000125 3300003214 Bacteria 131155
5 rootH1_10097191 3300003323 Bacteria 3955
6 Ga0006562J51391_1056202 3300003578 Bacteria 2700
7 Ga0055539_1000006 3300003752 Bacteria 580055
8 Ga0055539_1017996 3300003752 Bacteria 851
9 Ga0055533_1000002 3300003756 Bacteria 1196393
10 Ga0055532_1005594 3300003758 Bacteria 1752
11 Ga0055525_1000223 3300003759 Bacteria 61497
12 Ga0055527_1000003 3300003760 Bacteria 705001
13 Ga0055542_1000005 3300003762 Bacteria 550280
14 Ga0055529_1000006 3300003763 Bacteria 416978
15 Ga0070658_10076796 3300005327 Bacteria 2739
16 Ga0070658_10276412 3300005327 Bacteria 1429
17 Ga0070658_11159049 3300005327 Bacteria 672
18 Ga0070670_100563834 3300005331 Bacteria 1017
19 Ga0068869_100144163 3300005334 Bacteria 1842
20 Ga0070666_10057313 3300005335 Bacteria 2632
21 Ga0070682_100530901 3300005337 Bacteria 917
22 Ga0068868_100039905 3300005338 Bacteria 3650
23 Ga0070660_100175360 3300005339 Bacteria 1733
24 Ga0070660_100237275 3300005339 Bacteria 1484
25 Ga0070668_100998172 3300005347 Bacteria 752
26 Ga0070671_100512239 3300005355 Bacteria 1033
27 Ga0070659_100000482 3300005366 Bacteria 29316
28 Ga0070659_100148188 3300005366 Bacteria 1913
29 Ga0070667_100937509 3300005367 Bacteria 806
30 Ga0070710_10419993 3300005437 Bacteria 900
31 Ga0070663_100111257 3300005455 Bacteria 2058
32 Ga0070663_100457315 3300005455 Bacteria 1053
33 Ga0070685_10075302 3300005466 Bacteria 2010
34 Ga0068853_100022255 3300005539 Bacteria 5292
35 Ga0070672_100040803 3300005543 Bacteria 3564
36 Ga0068855_100000569 3300005563 Bacteria 45301
37 Ga0068855_100175322 3300005563 Bacteria 2426
38 Ga0068855_100792928 3300005563 Bacteria 1007
39 Ga0068855_101040448 3300005563 Bacteria 858
40 Ga0068855_101727114 3300005563 Bacteria 637
41 Ga0068855_102086155 3300005563 Bacteria 571
42 Ga0068857_100000239 3300005577 Bacteria 36717
43 Ga0068857_101402469 3300005577 Bacteria 680
44 Ga0068854_100291515 3300005578 Bacteria 1317
45 Ga0068856_100103334 3300005614 Bacteria 2843
46 Ga0068856_100576050 3300005614 Bacteria 1147
47 Ga0068856_101213438 3300005614 Bacteria 770
48 Ga0068852_100022750 3300005616 Bacteria 5032
49 Ga0068852_100143901 3300005616 Bacteria 2209
50 Ga0068859_100297249 3300005617 Bacteria 1708
51 Ga0068864_100093156 3300005618 Bacteria 2661
52 Ga0068851_10000027 3300005834 Bacteria 118586
53 Ga0068851_10180785 3300005834 Bacteria 1168
54 Ga0068863_101551749 3300005841 Bacteria 671
55 Ga0075365_10138551 3300006038 Bacteria 1688
56 Ga0075364_10006791 3300006051 Bacteria 6748
57 Ga0075364_10202387 3300006051 Bacteria 1346
58 Ga0075364_10338747 3300006051 Bacteria 1025
59 Ga0097620_100297234 3300006931 Bacteria 1708
60 Ga0105240_10486162 3300009093 Bacteria 1375
61 Ga0105240_10982374 3300009093 Bacteria 904
62 Ga0105245_10054442 3300009098 Bacteria 3593
63 Ga0105247_10145871 3300009101 Bacteria 1555
64 Ga0105247_10255834 3300009101 Bacteria 1199
65 Ga0105241_10050671 3300009174 Bacteria 3165
66 Ga0105241_11479202 3300009174 Bacteria 653
67 Ga0105248_10000492 3300009177 Bacteria 44904
68 Ga0105248_10019436 3300009177 Bacteria 7517
69 Ga0105237_10000442 3300009545 Bacteria 59060
70 Ga0105237_10119858 3300009545 Bacteria 2625
71 Ga0105238_10015350 3300009551 Bacteria 7756
72 Ga0105238_10163828 3300009551 Bacteria 2199
73 Ga0105238_10554192 3300009551 Bacteria 1154
74 Ga0105239_10056750 3300010375 Bacteria 4296
75 Ga0105239_11147535 3300010375 Bacteria 895
76 Ga0105239_11336717 3300010375 Bacteria 827
77 Ga0105239_11830989 3300010375 Bacteria 703
78 Ga0157370_10014835 3300013104 Bacteria 7950
79 Ga0157370_10195745 3300013104 Bacteria 1876
80 Ga0157369_10018468 3300013105 Bacteria 7818
81 Ga0157374_10168275 3300013296 Bacteria 2137
82 Ga0157374_12082689 3300013296 Bacteria 594
83 Ga0163162_10485000 3300013306 Bacteria 1367
84 Ga0157372_10146947 3300013307 Bacteria 2718
85 Ga0157372_10449198 3300013307 Bacteria 1502
86 Ga0157372_11604436 3300013307 Bacteria 749
87 Ga0157375_10134328 3300013308 Bacteria 2596
88 Ga0157375_10172106 3300013308 Bacteria 2313
89 Ga0157375_10454271 3300013308 Bacteria 1447
90 Ga0157375_10667693 3300013308 Bacteria 1195
91 Ga0163163_10084876 3300014325 Bacteria 3174
92 Ga0163163_10363656 3300014325 Bacteria 1503
93 Ga0197907_10362185 3300020069 Bacteria 883
94 Ga0197907_11190262 3300020069 Bacteria 752
95 Ga0206356_10216627 3300020070 Bacteria 1454
96 Ga0206349_1191997 3300020075 Bacteria 1184
97 Ga0206355_1320943 3300020076 Bacteria 1228
98 Ga0206351_10302037 3300020077 Bacteria 671
99 Ga0206351_10924243 3300020077 Bacteria 738
100 Ga0206352_10530069 3300020078 Bacteria 633
101 Ga0206350_10199319 3300020080 Bacteria 737
102 Ga0206350_10703538 3300020080 Bacteria 1141
103 Ga0206354_10810658 3300020081 Bacteria 1292
104 Ga0206353_10061093 3300020082 Bacteria 17359
105 Ga0154015_1358594 3300020610 Bacteria 716
106 Ga0224712_10044691 3300022467 Bacteria 1691
107 Ga0209566_100032 3300025225 Bacteria 338313
108 Ga0209674_100001 3300025226 Bacteria 4013750
109 Ga0209672_100003 3300025228 Bacteria 1560476
110 Ga0209147_101047 3300025229 Bacteria 11727
111 Ga0209563_100001 3300025230 Bacteria 4013775
112 Ga0209563_100326 3300025230 Bacteria 18720
113 Ga0207427_100039 3300025231 Bacteria 291576
114 Ga0209437_100599 3300025233 Bacteria 22547
115 Ga0209258_106285 3300025242 Bacteria 1881
116 Ga0209677_100001 3300025253 Bacteria 4013787
117 Ga0209677_100406 3300025253 Bacteria 25755
118 Ga0209148_1000004 3300025254 Bacteria 1844481
119 Ga0209148_1002028 3300025254 Bacteria 7905
120 Ga0209129_1019770 3300025258 Bacteria 1266
121 Ga0209233_1000014 3300025261 Bacteria 996641
122 Ga0209233_1040493 3300025261 Bacteria 1013
123 Ga0209455_1000091 3300025272 Bacteria 223115
124 Ga0207656_10000001 3300025321 Bacteria 1323684
125 Ga0207656_10062423 3300025321 Bacteria 1638
126 Ga0207692_10347307 3300025898 Bacteria 914
127 Ga0207710_10093041 3300025900 Bacteria 1414
128 Ga0207710_10229055 3300025900 Bacteria 924
129 Ga0207647_10042047 3300025904 Bacteria 2869
130 Ga0207705_10000001 3300025909 Bacteria 2061880
131 Ga0207705_10044334 3300025909 Bacteria 3196
132 Ga0207705_10136403 3300025909 Bacteria 1830
133 Ga0207705_10149823 3300025909 Bacteria 1748
134 Ga0207705_10173072 3300025909 Bacteria 1626
135 Ga0207654_10000001 3300025911 Bacteria 1816198
136 Ga0207695_10003163 3300025913 Bacteria 23477
137 Ga0207695_10006597 3300025913 Bacteria 15004
138 Ga0207695_10451631 3300025913 Bacteria 1168
139 Ga0207695_10851566 3300025913 Bacteria 792
140 Ga0207671_10000001 3300025914 Bacteria 1318881
141 Ga0207671_10127805 3300025914 Bacteria 1949
142 Ga0207657_10036357 3300025919 Bacteria 4408
143 Ga0207657_10063821 3300025919 Bacteria 3147
144 Ga0207649_10089603 3300025920 Bacteria 2011
145 Ga0207694_10000420 3300025924 Bacteria 39573
146 Ga0207650_11313990 3300025925 Bacteria 615
147 Ga0207687_10027545 3300025927 Bacteria 3814
148 Ga0207644_11266000 3300025931 Bacteria 620
149 Ga0207690_10000300 3300025932 Bacteria 34612
150 Ga0207690_10067347 3300025932 Bacteria 2456
151 Ga0207709_10914968 3300025935 Bacteria 713
152 Ga0207691_10092793 3300025940 Bacteria 2704
153 Ga0207711_10001676 3300025941 Bacteria 20398
154 Ga0207711_10043495 3300025941 Bacteria 3831
155 Ga0207689_10786711 3300025942 Bacteria 803
156 Ga0207667_10003290 3300025949 Bacteria 19941
157 Ga0207667_10005356 3300025949 Bacteria 15639
158 Ga0207667_10005569 3300025949 Bacteria 15370
159 Ga0207667_10629105 3300025949 Bacteria 1080
160 Ga0207667_10718389 3300025949 Bacteria 1000
161 Ga0207640_11478187 3300025981 Bacteria 610
162 Ga0207658_10787939 3300025986 Bacteria 862
163 Ga0207703_10000224 3300026035 Bacteria 65306
164 Ga0207639_10017834 3300026041 Bacteria 5035
165 Ga0207639_10032822 3300026041 Bacteria 3825
166 Ga0207678_10233727 3300026067 Bacteria 1574
167 Ga0207678_10480393 3300026067 Bacteria 1082
168 Ga0207702_10087545 3300026078 Bacteria 2719
169 Ga0207702_10492423 3300026078 Bacteria 1194
170 Ga0207641_11312571 3300026088 Bacteria 724
171 Ga0207676_10888316 3300026095 Bacteria 873
172 Ga0207674_10001276 3300026116 Bacteria 32897
173 Ga0207674_10113726 3300026116 Bacteria 2679
174 Ga0207698_10000473 3300026142 Bacteria 23344
175 Ga0207698_10000591 3300026142 Bacteria 21157
176 Ga0207698_10195879 3300026142 Bacteria 1805
177 Ga0268265_10312438 3300028380 Bacteria 1420
178 Ga0307515_10065382 3300028794 Bacteria 5063
179 Ga0307515_10281435 3300028794 Bacteria 1370
180 Ga0307515_10295960 3300028794 Bacteria 1309
181 Ga0307513_10188059 3300031456 Bacteria 1920
182 Ga0307513_11002181 3300031456 Bacteria 545
183 Ga0307514_10004141 3300031649 Bacteria 13440
184 Ga0307413_10425534 3300031824 Bacteria 1047
185 Ga0307518_10259890 3300031838 Bacteria 1095
186 Ga0307410_10102484 3300031852 Bacteria 2054
187 Ga0307406_10023710 3300031901 Bacteria 3655
188 Ga0307412_10170273 3300031911 Bacteria 1628
189 Ga0307412_10747714 3300031911 Bacteria 844
190 Ga0307412_11175402 3300031911 Bacteria 686
191 Ga0307416_100435418 3300032002 Bacteria 1360
192 Ga0307415_100309089 3300032126 Bacteria 1313
193 Ga0395899_0003980 3300037312 Bacteria 11640
194 Ga0395900_0161151 3300037418 Bacteria 2288
195 Ga0395901_0420429 3300038443 Bacteria 1371
196 Ga0395901_1480176 3300038443 Bacteria 635
197 Ga0439465_0275485 3300041413 Bacteria 626
198 Ga0451791_1588114 3300041451 Bacteria 817
199 Ga0451793_0124887 3300041452 Bacteria 722
200 Ga0451793_0277597 3300041452 Bacteria 1220
201 Ga0451793_0523654 3300041452 Bacteria 1601
202 Ga0451793_0943848 3300041452 Bacteria 860
203 Ga0451793_1643693 3300041452 Bacteria 1016
204 Ga0451797_1137175 3300041453 Bacteria 740
205 Ga0451795_0926964 3300041456 Bacteria 609
206 Ga0451795_1302916 3300041456 Bacteria 1034
207 Ga0451800_0541600 3300041459 Bacteria 666
208 Ga0451802_1809820 3300041460 Bacteria 782
209 Ga0451806_712886 3300041462 Bacteria 688
210 Ga0451841_0346760 3300041498 Bacteria 1005
211 Ga0451847_0425482 3300041503 Bacteria 634
212 Ga0451853_3926263 3300041512 Bacteria 529
213 Ga0451853_4106937 3300041512 Bacteria 1012
214 Ga0439457_096258 3300042014 Bacteria 688
215 Ga0466969_0224737 3300044656 Bacteria 853
216 Ga0466972_0077356 3300044658 Bacteria 1585
217 Ga0466972_0125388 3300044658 Bacteria 1210
218 Ga0466972_0323832 3300044658 Bacteria 720
219 Ga0466972_0439477 3300044658 Bacteria 613
220 Ga0466965_0031080 3300044683 Bacteria 2602
221 Ga0466965_0084228 3300044683 Bacteria 1610
222 Ga0466966_0049994 3300044684 Bacteria 2661
223 Ga0466966_0092573 3300044684 Bacteria 1875
224 Ga0466961_0225822 3300044693 Bacteria 1153
225 Ga0466961_0264562 3300044693 Bacteria 1054
226 Ga0466971_0416857 3300044719 Bacteria 656
227 Ga0466968_0092331 3300044735 Bacteria 1343
228 Ga0466970_0003621 3300044765 Bacteria 7533
229 Ga0466970_0041380 3300044765 Bacteria 2448
230 Ga0466970_0043989 3300044765 Bacteria 2377
231 Ga0466970_0323921 3300044765 Bacteria 871
232 Ga0466957_0181837 3300044842 Bacteria 1373
233 Ga0466960_0037679 3300044901 Bacteria 2269
234 Ga0466959_0067426 3300045049 Bacteria 2594
235 Ga0466958_0291009 3300045836 Bacteria 1048
236 Ga0466967_0658292 3300045976 Bacteria 1036
237 Ga0466967_1778431 3300045976 Bacteria 614
238 Ga0495590_0002706 3300046457 Bacteria 7324
239 Ga0495650_0000770 3300046471 Bacteria 39564
240 Ga0495580_0105585 3300046472 Bacteria 1957
241 Ga0495606_0223736 3300046507 Bacteria 1059
242 Ga0495620_0342687 3300046515 Bacteria 567
243 Ga0495632_0123742 3300046519 Bacteria 1207
244 Ga0495625_0603547 3300046660 Bacteria 659
245 Ga0495588_0046650 3300046674 Bacteria 2223
246 Ga0495581_0096987 3300047315 Bacteria 1712
247 Ga0495672_0019950 3300047320 Bacteria 4405
248 Ga0495672_0095528 3300047320 Bacteria 1623
249 Ga0495673_0204137 3300047469 Bacteria 738
250 Ga0495686_0148713 3300047472 Bacteria 1377
251 Ga0495686_0160868 3300047472 Bacteria 1312
252 Ga0496100_0043464 3300048903 Bacteria 2873
253 Ga0496101_0024597 3300048904 Bacteria 4169
254 Ga0496101_0200078 3300048904 Bacteria 1544
255 Ga0496102_0706909 3300048905 Bacteria 931
256 Ga0496104_0153249 3300048907 Bacteria 2212
257 Ga0496104_0639336 3300048907 Bacteria 973
258 Ga0496105_0091345 3300048908 Bacteria 2514
259 Ga0496113_0315396 3300048916 Bacteria 1253
260 Ga0496114_0013243 3300048917 Bacteria 6610
261 Ga0496114_0080692 3300048917 Bacteria 2747
262 Ga0496115_0043446 3300048918 Bacteria 3584
263 Ga0496115_0255670 3300048918 Bacteria 1441
264 Ga0496117_0004795 3300048920 Bacteria 14659
265 Ga0496117_0032010 3300048920 Bacteria 4005
266 Ga0496117_0036516 3300048920 Bacteria 3676
267 Ga0496117_0043162 3300048920 Bacteria 3282
268 Ga0496118_0000472 3300048921 Bacteria 66796
269 Ga0496119_0000905 3300048922 Bacteria 38593
270 Ga0496119_0061493 3300048922 Bacteria 2242
271 Ga0496119_0198978 3300048922 Bacteria 1038
272 Ga0496119_0375335 3300048922 Bacteria 683
273 Ga0496120_0002435 3300048923 Bacteria 18835
274 Ga0496120_0028113 3300048923 Bacteria 3450
275 Ga0496120_0107364 3300048923 Bacteria 1464
276 Ga0496120_0178600 3300048923 Bacteria 1044
277 Ga0496121_0000015 3300048924 Bacteria 571958
278 Ga0496121_0409194 3300048924 Bacteria 886
279 Ga0496121_0414571 3300048924 Bacteria 878
280 Ga0496122_0001688 3300048925 Bacteria 34239
281 Ga0496123_0015117 3300048926 Bacteria 6351
282 Ga0496124_0000040 3300048927 Bacteria 307061
283 Ga0496125_0229545 3300048928 Bacteria 1188
284 Ga0496126_0295474 3300048929 Bacteria 1338
285 Ga0496126_0352094 3300048929 Bacteria 1204
286 Ga0496126_0570961 3300048929 Bacteria 895
287 Ga0496126_0614933 3300048929 Bacteria 854
288 Ga0501031_0016691 3300049568 Bacteria 4770
289 Ga0501032_0006421 3300049569 Bacteria 8652
290 Ga0501032_0006536 3300049569 Bacteria 8561
291 Ga0501032_0044095 3300049569 Bacteria 3019
292 Ga0501033_0003088 3300049570 Bacteria 13839
293 Ga0501033_0007742 3300049570 Bacteria 8330
294 Ga0501033_0012546 3300049570 Bacteria 6465
295 Ga0501033_0052509 3300049570 Bacteria 3021
296 Ga0501033_0077775 3300049570 Bacteria 2435
297 Ga0501033_0095304 3300049570 Bacteria 2175
298 Ga0501033_0103380 3300049570 Bacteria 2077
299 Ga0501033_0406958 3300049570 Bacteria 948
300 Ga0501034_0008302 3300049571 Bacteria 10991
301 Ga0501034_0018348 3300049571 Bacteria 7175
302 Ga0501034_0040767 3300049571 Bacteria 4698
303 Ga0501034_0042209 3300049571 Bacteria 4617
304 Ga0501034_0056708 3300049571 Bacteria 3941
305 Ga0501034_0077430 3300049571 Bacteria 3331
306 Ga0501034_0110271 3300049571 Bacteria 2743
307 Ga0501034_0238007 3300049571 Bacteria 1767
308 Ga0501034_0285811 3300049571 Bacteria 1588
309 Ga0501034_0295120 3300049571 Bacteria 1558
310 Ga0501034_0303839 3300049571 Bacteria 1532
311 Ga0501034_1031675 3300049571 Bacteria 705
312 Ga0501036_0013201 3300049572 Bacteria 6859
313 Ga0501036_0139205 3300049572 Bacteria 2048
314 Ga0501036_0181793 3300049572 Bacteria 1770
315 Ga0501036_0202534 3300049572 Bacteria 1669
316 Ga0501036_0863656 3300049572 Bacteria 743
317 Ga0501037_0021659 3300049573 Bacteria 4752
318 Ga0501037_0051907 3300049573 Bacteria 2999
319 Ga0501037_0076941 3300049573 Bacteria 2422
320 Ga0501037_0095599 3300049573 Bacteria 2147
321 Ga0501037_0143615 3300049573 Bacteria 1707
322 Ga0501037_0309786 3300049573 Bacteria 1095
323 Ga0501037_0574185 3300049573 Bacteria 759
324 Ga0501038_0004245 3300049574 Bacteria 13323
325 Ga0501038_0015122 3300049574 Bacteria 7022
326 Ga0501038_0181984 3300049574 Bacteria 1695
327 Ga0501038_0288508 3300049574 Bacteria 1290
328 Ga0501039_0020137 3300049575 Bacteria 5115
329 Ga0501039_0086557 3300049575 Bacteria 2440
330 Ga0501039_0154499 3300049575 Bacteria 1803
331 Ga0501039_0275618 3300049575 Bacteria 1322
332 Ga0501039_1222230 3300049575 Bacteria 581
333 Ga0501040_1381756 3300049576 Bacteria 511
334 Ga0501042_0054225 3300049578 Bacteria 2859
335 Ga0501042_0083580 3300049578 Bacteria 2289
336 Ga0501043_0012047 3300049579 Bacteria 6761
337 Ga0501043_0012355 3300049579 Bacteria 6677
338 Ga0501043_0050120 3300049579 Bacteria 3282
339 Ga0501043_0241928 3300049579 Bacteria 1392
340 Ga0501043_0532645 3300049579 Bacteria 874
341 Ga0501046_0011643 3300049580 Bacteria 7519
342 Ga0501046_0040782 3300049580 Bacteria 3708
343 Ga0501046_0137064 3300049580 Bacteria 1853
344 Ga0501046_0376474 3300049580 Bacteria 1028
345 Ga0501047_0051731 3300049581 Bacteria 3969
346 Ga0501047_0151416 3300049581 Bacteria 2195
347 Ga0501047_0187916 3300049581 Bacteria 1930
348 Ga0501047_0355567 3300049581 Bacteria 1301
349 Ga0501047_0411546 3300049581 Bacteria 1184
350 Ga0501047_0721618 3300049581 Bacteria 813
351 Ga0501048_0000826 3300049582 Bacteria 22836
352 Ga0501048_0070152 3300049582 Bacteria 2475
353 Ga0501048_0227388 3300049582 Bacteria 1324
354 Ga0501048_1233783 3300049582 Bacteria 538
355 Ga0501067_0016214 3300049583 Bacteria 4118
356 Ga0501068_0056338 3300049584 Bacteria 2383
357 Ga0501068_0056343 3300049584 Bacteria 2383
358 Ga0501068_0101937 3300049584 Bacteria 1780
359 Ga0501069_0111771 3300049585 Bacteria 1556
360 Ga0501069_0511526 3300049585 Bacteria 717
361 Ga0501070_0000076 3300049586 Bacteria 83972
362 Ga0501070_0003466 3300049586 Bacteria 13683
363 Ga0501070_0031034 3300049586 Bacteria 4477
364 Ga0501070_0040299 3300049586 Bacteria 3895
365 Ga0501070_0061844 3300049586 Bacteria 3102
366 Ga0501070_0921308 3300049586 Bacteria 681
367 Ga0501070_1198556 3300049586 Bacteria 583
368 Ga0501071_0006160 3300049587 Bacteria 7775
369 Ga0501071_0163258 3300049587 Bacteria 1666
370 Ga0501072_0833598 3300049588 Bacteria 721
371 Ga0501073_0019298 3300049589 Bacteria 4923
372 Ga0501073_0141895 3300049589 Bacteria 1664
373 Ga0501073_0352937 3300049589 Bacteria 1015
374 Ga0501073_1207936 3300049589 Bacteria 519
375 Ga0501074_0086964 3300049590 Bacteria 2239
376 Ga0501079_0255172 3300049741 Bacteria 1371
377 Ga0501080_0000092 3300049742 Bacteria 60619
378 Ga0501083_0000011 3300049744 Bacteria 181041
379 Ga0501083_0037195 3300049744 Bacteria 3316
380 Ga0501083_0049995 3300049744 Bacteria 2815
381 Ga0501083_0606709 3300049744 Bacteria 712
382 Ga0501035_0013421 3300049822 Bacteria 7561
383 Ga0501035_0069684 3300049822 Bacteria 3116
384 Ga0501035_0082162 3300049822 Bacteria 2843
385 Ga0501035_0135956 3300049822 Bacteria 2140
386 Ga0501035_0374223 3300049822 Bacteria 1189
387 Ga0501035_0418370 3300049822 Bacteria 1113
388 Ga0501044_0009041 3300049823 Bacteria 10890
389 Ga0501044_0017495 3300049823 Bacteria 7692
390 Ga0501044_0017572 3300049823 Bacteria 7671
391 Ga0501044_0078822 3300049823 Bacteria 3338
392 Ga0501044_0107056 3300049823 Bacteria 2807
393 Ga0501044_0216339 3300049823 Bacteria 1868
394 Ga0501044_0686399 3300049823 Bacteria 910
395 Ga0501045_0060827 3300049824 Bacteria 2769
396 nmdc:mga00v17_2594_c1 3300050491 Bacteria 9263
397 nmdc:mga0yw44_108739_c1 3300050492 Bacteria 1774
398 nmdc:mga0yw44_199623_c1 3300050492 Bacteria 1321
399 nmdc:mga06z11_916710_c1 3300050494 Bacteria 534
400 nmdc:mga0qj67_1411456_c1 3300050509 Bacteria 537
401 Ga0500635_0000505 3300053080 Bacteria 10779
402 Ga0500635_0022215 3300053080 Bacteria 1964
403 Ga0500643_000297 3300053087 Bacteria 41873
404 Ga0500556_0000041 3300053104 Bacteria 134317
405 Ga0500562_000624 3300053108 Bacteria 8540
406 Ga0500655_005012 3300053133 Bacteria 2381
407 Ga0500559_0001662 3300053136 Bacteria 12307
408 Ga0500559_0315538 3300053136 Bacteria 733
409 Ga0500568_0000003 3300053139 Bacteria 863587
410 Ga0500573_0000011 3300053140 Bacteria 209484
411 Ga0500573_0001100 3300053140 Bacteria 12533
412 Ga0500573_0012695 3300053140 Bacteria 4735
413 Ga0500573_0019828 3300053140 Bacteria 3848
414 Ga0500573_0026506 3300053140 Bacteria 3331
415 Ga0500573_0036733 3300053140 Bacteria 2829
416 Ga0500573_0063038 3300053140 Bacteria 2121
417 Ga0500573_0098905 3300053140 Bacteria 1643
418 Ga0500573_0162312 3300053140 Bacteria 1215
419 Ga0500573_0356871 3300053140 Bacteria 708
420 Ga0500577_0024964 3300053142 Bacteria 2016
421 Ga0500577_0037570 3300053142 Bacteria 1743
422 Ga0500577_0101717 3300053142 Bacteria 1175
423 Ga0500588_0003164 3300053146 Bacteria 3446
424 Ga0500590_039823 3300053148 Bacteria 2422
425 Ga0500616_0000040 3300053153 Bacteria 367604
426 Ga0500620_000141 3300053155 Bacteria 14598
427 Ga0501084_0055677 3300054114 Bacteria 3309
428 Ga0466962_0134325 3300061719 Bacteria 1197

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049580 Ga0501046_0137064 Ga0501046_0137064_533_991 123
2 3300005337 Ga0070682_100530901 Ga0070682_1005309012 125
3 3300041460 Ga0451802_1809820 Ga0451802_1809820_186_566 126
4 3300053140 Ga0500573_0098905 Ga0500573_0098905_206_646 126
5 3300009177 Ga0105248_10019436 Ga0105248_100194366 127
6 3300013296 Ga0157374_12082689 Ga0157374_120826891 127
7 3300013307 Ga0157372_10146947 Ga0157372_101469473 127
8 3300025941 Ga0207711_10043495 Ga0207711_100434955 127
9 3300048903 Ga0496100_0043464 Ga0496100_0043464_1401_1841 127
10 3300048904 Ga0496101_0024597 Ga0496101_0024597_2031_2471 127
11 3300048907 Ga0496104_0153249 Ga0496104_0153249_255_695 127
12 3300048908 Ga0496105_0091345 Ga0496105_0091345_510_950 127
13 3300048917 Ga0496114_0013243 Ga0496114_0013243_4427_4867 127
14 3300048918 Ga0496115_0043446 Ga0496115_0043446_66_506 127
15 3300048920 Ga0496117_0043162 Ga0496117_0043162_2786_3226 127
16 3300048922 Ga0496119_0000905 Ga0496119_0000905_21900_22340 127
17 3300048923 Ga0496120_0002435 Ga0496120_0002435_5730_6170 127
18 3300049586 Ga0501070_0000076 Ga0501070_0000076_62882_63322 127
19 3300049822 Ga0501035_0135956 Ga0501035_0135956_113_553 127
20 3300005339 Ga0070660_100237275 Ga0070660_1002372753 128
21 3300005366 Ga0070659_100148188 Ga0070659_1001481881 128
22 3300009551 Ga0105238_10554192 Ga0105238_105541922 128
23 3300025919 Ga0207657_10063821 Ga0207657_100638215 128
24 3300025932 Ga0207690_10067347 Ga0207690_100673474 128
25 3300044693 Ga0466961_0225822 Ga0466961_0225822_74_514 128
26 3300049570 Ga0501033_0077775 Ga0501033_0077775_891_1337 128
27 3300049582 Ga0501048_0227388 Ga0501048_0227388_751_1197 128
28 3300049744 Ga0501083_0037195 Ga0501083_0037195_691_1137 128
29 3300053140 Ga0500573_0012695 Ga0500573_0012695_2019_2471 128
30 3300003578 Ga0006562J51391_1056202 Ga0006562J51391_10562024 129
31 3300005578 Ga0068854_100291515 Ga0068854_1002915152 129
32 3300005614 Ga0068856_101213438 Ga0068856_1012134382 129
33 3300009093 Ga0105240_10982374 Ga0105240_109823742 129
34 3300009174 Ga0105241_10050671 Ga0105241_100506714 129
35 3300009545 Ga0105237_10119858 Ga0105237_101198582 129
36 3300025911 Ga0207654_10000001 Ga0207654_10000001204 129
37 3300025913 Ga0207695_10003163 Ga0207695_100031639 129
38 3300025914 Ga0207671_10127805 Ga0207671_101278053 129
39 3300025949 Ga0207667_10718389 Ga0207667_107183891 129
40 3300026116 Ga0207674_10113726 Ga0207674_101137261 129
41 3300031649 Ga0307514_10004141 Ga0307514_1000414112 129
42 3300041459 Ga0451800_0541600 Ga0451800_0541600_253_642 129
43 3300046471 Ga0495650_0000770 Ga0495650_0000770_3896_4285 129
44 3300049572 Ga0501036_0863656 Ga0501036_0863656_315_704 129
45 3300050494 nmdc:mga06z11_916710_c1 nmdc:mga06z11_916710_c1_106_495 129
46 3300053155 Ga0500620_000141 Ga0500620_000141_3899_4288 129
47 iso_pu_bacteria 2857733635 2857736215 129
48 3300025230 Ga0209563_100326 Ga0209563_1003267 130
49 3300025258 Ga0209129_1019770 Ga0209129_10197702 130
50 3300048916 Ga0496113_0315396 Ga0496113_0315396_765_1205 130
51 3300048920 Ga0496117_0032010 Ga0496117_0032010_378_818 130
52 3300041512 Ga0451853_3926263 Ga0451853_3926263_62_508 131
53 3300003752 Ga0055539_1000006 Ga0055539_100000613 132
54 3300003756 Ga0055533_1000002 Ga0055533_100000297 132
55 3300003759 Ga0055525_1000223 Ga0055525_100022334 132
56 3300005437 Ga0070710_10419993 Ga0070710_104199932 132
57 3300025898 Ga0207692_10347307 Ga0207692_103473071 132
58 3300025225 Ga0209566_100032 Ga0209566_10003297 133
59 3300025226 Ga0209674_100001 Ga0209674_1000013468 133
60 3300025230 Ga0209563_100001 Ga0209563_1000013468 133
61 3300025253 Ga0209677_100001 Ga0209677_1000013468 133
62 3300044658 Ga0466972_0323832 Ga0466972_0323832_177_617 133
63 3300044658 Ga0466972_0439477 Ga0466972_0439477_42_482 133
64 3300044684 Ga0466966_0049994 Ga0466966_0049994_1888_2328 133
65 3300044765 Ga0466970_0043989 Ga0466970_0043989_551_991 133
66 3300044765 Ga0466970_0323921 Ga0466970_0323921_254_694 133
67 3300044842 Ga0466957_0181837 Ga0466957_0181837_612_1052 133
68 3300044901 Ga0466960_0037679 Ga0466960_0037679_525_965 133
69 3300045049 Ga0466959_0067426 Ga0466959_0067426_1668_2108 133
70 3300048923 Ga0496120_0107364 Ga0496120_0107364_1044_1448 133
71 3300048925 Ga0496122_0001688 Ga0496122_0001688_31673_32113 133
72 3300048926 Ga0496123_0015117 Ga0496123_0015117_3838_4278 133
73 3300048929 Ga0496126_0352094 Ga0496126_0352094_20_469 133
74 3300041452 Ga0451793_0523654 Ga0451793_0523654_500_940 134
75 3300041456 Ga0451795_0926964 Ga0451795_0926964_29_469 134
76 3300041462 Ga0451806_712886 Ga0451806_712886_53_493 134
77 3300049570 Ga0501033_0052509 Ga0501033_0052509_2113_2571 134
78 3300049573 Ga0501037_0309786 Ga0501037_0309786_331_789 134
79 3300049586 Ga0501070_0061844 Ga0501070_0061844_2486_2944 134
80 3300049822 Ga0501035_0418370 Ga0501035_0418370_380_838 134
81 3300049823 Ga0501044_0009041 Ga0501044_0009041_146_604 134
82 3300005331 Ga0070670_100563834 Ga0070670_1005638342 135
83 3300048923 Ga0496120_0028113 Ga0496120_0028113_2549_2989 135
84 3300048928 Ga0496125_0229545 Ga0496125_0229545_27_467 135
85 3300013306 Ga0163162_10485000 Ga0163162_104850003 136
86 3300025925 Ga0207650_11313990 Ga0207650_113139902 136
87 3300005347 Ga0070668_100998172 Ga0070668_1009981722 137
88 3300048924 Ga0496121_0409194 Ga0496121_0409194_70_510 137
89 3300053140 Ga0500573_0036733 Ga0500573_0036733_1666_2106 137
90 3300049580 Ga0501046_0040782 Ga0501046_0040782_3267_3686 138
91 3300006051 Ga0075364_10202387 Ga0075364_102023872 139
92 3300053080 Ga0500635_0000505 Ga0500635_0000505_102_542 140
93 3300003758 Ga0055532_1005594 Ga0055532_10055941 141
94 3300003760 Ga0055527_1000003 Ga0055527_1000003239 141
95 3300003762 Ga0055542_1000005 Ga0055542_1000005103 141
96 3300003763 Ga0055529_1000006 Ga0055529_1000006239 141
97 3300025228 Ga0209672_100003 Ga0209672_1000031076 141
98 3300025229 Ga0209147_101047 Ga0209147_10104710 141
99 3300025242 Ga0209258_106285 Ga0209258_1062853 141
100 3300025254 Ga0209148_1000004 Ga0209148_10000041371 141
101 3300025261 Ga0209233_1040493 Ga0209233_10404932 141
102 3300025272 Ga0209455_1000091 Ga0209455_100009142 141
103 iso_pu_bacteria 2585428094 2587864882 142
104 iso_pu_bacteria 2643221549 2643766654 142
105 iso_pu_bacteria 2643221572 2643877492 142
106 iso_pu_bacteria 2643221616 2644094741 142
107 iso_pu_bacteria 2643221619 2644113421 142
108 iso_pu_bacteria 2643221632 2644181277 142
109 iso_pu_bacteria 2643221669 2644384547 142
110 iso_pu_bacteria 2721755702 2723640592 142
111 iso_pu_bacteria 2751185788 2753302741 142
112 iso_pu_bacteria 2808606372 2808903787 142
113 iso_pu_bacteria 2995726249 2995726637 143
114 iso_pu_bacteria 8055034563 8055037229 143
115 iso_pu_bacteria 8055037949 8055039440 143
116 iso_pu_bacteria 2844841374 2844845078 144
117 iso_pu_bacteria 2844852863 2844853103 144
118 iso_pu_bacteria 2852643534 2852643604 144
119 iso_pu_bacteria 2857737099 2857740160 144
120 iso_pu_bacteria 2862993130 2862994379 144
121 iso_pu_bacteria 2870622029 2870624933 144
122 iso_pu_bacteria 2884763398 2884764094 144
123 iso_pu_bacteria 2895660088 2895662327 144
124 iso_pu_bacteria 2904430863 2904434101 144
125 iso_pu_bacteria 2904501621 2904504032 144
126 iso_pu_bacteria 2908674828 2908676997 144
127 iso_pu_bacteria 2909074476 2909076825 144
128 iso_pu_bacteria 2919039151 2919039437 144
129 iso_pu_bacteria 2919042368 2919042829 144
130 iso_pu_bacteria 2919055335 2919056906 144
131 iso_pu_bacteria 2928104781 2928106207 144
132 iso_pu_bacteria 2928153084 2928154615 144
133 iso_pu_bacteria 2928500415 2928502139 144
134 iso_pu_bacteria 2935409751 2935410087 144
135 iso_pu_bacteria 2939657138 2939659717 144
136 iso_pu_bacteria 2939660829 2939663855 144
137 iso_pu_bacteria 2966921586 2966923146 144
138 iso_pu_bacteria 2966924647 2966925550 144
139 iso_pu_bacteria 2984551494 2984554889 144
140 iso_pu_bacteria 8046352972 8046355066 144
141 iso_pu_bacteria 8056037122 8056038377 144
142 iso_pu_bacteria 8057345674 8057346080 144
143 3300010375 Ga0105239_11830989 Ga0105239_118309892 145
144 3300041503 Ga0451847_0425482 Ga0451847_0425482_110_553 145
145 3300002737 JGI25162J39368_1007050 JGI25162J39368_10070503 146
146 3300002772 JGI25164J39214_1000796 JGI25164J39214_10007963 146
147 3300003214 JGI25165J46597_1000014 JGI25165J46597_100001438 146
148 3300003214 JGI25165J46597_1000125 JGI25165J46597_100012525 146
149 3300003323 rootH1_10097191 rootH1_100971912 146
150 3300003752 Ga0055539_1017996 Ga0055539_10179961 146
151 3300005327 Ga0070658_10076796 Ga0070658_100767963 146
152 3300005327 Ga0070658_10276412 Ga0070658_102764122 146
153 3300005327 Ga0070658_11159049 Ga0070658_111590491 146
154 3300005334 Ga0068869_100144163 Ga0068869_1001441632 146
155 3300005335 Ga0070666_10057313 Ga0070666_100573131 146
156 3300005338 Ga0068868_100039905 Ga0068868_1000399052 146
157 3300005339 Ga0070660_100175360 Ga0070660_1001753603 146
158 3300005355 Ga0070671_100512239 Ga0070671_1005122391 146
159 3300005366 Ga0070659_100000482 Ga0070659_10000048224 146
160 3300005367 Ga0070667_100937509 Ga0070667_1009375092 146
161 3300005455 Ga0070663_100111257 Ga0070663_1001112573 146
162 3300005455 Ga0070663_100457315 Ga0070663_1004573152 146
163 3300005466 Ga0070685_10075302 Ga0070685_100753021 146
164 3300005539 Ga0068853_100022255 Ga0068853_1000222555 146
165 3300005543 Ga0070672_100040803 Ga0070672_1000408033 146
166 3300005563 Ga0068855_100000569 Ga0068855_10000056945 146
167 3300005563 Ga0068855_100175322 Ga0068855_1001753223 146
168 3300005563 Ga0068855_100792928 Ga0068855_1007929281 146
169 3300005563 Ga0068855_101040448 Ga0068855_1010404482 146
170 3300005563 Ga0068855_101727114 Ga0068855_1017271142 146
171 3300005563 Ga0068855_102086155 Ga0068855_1020861551 146
172 3300005577 Ga0068857_100000239 Ga0068857_10000023928 146
173 3300005577 Ga0068857_101402469 Ga0068857_1014024691 146
174 3300005614 Ga0068856_100103334 Ga0068856_1001033342 146
175 3300005614 Ga0068856_100576050 Ga0068856_1005760502 146
176 3300005616 Ga0068852_100022750 Ga0068852_1000227503 146
177 3300005616 Ga0068852_100143901 Ga0068852_1001439014 146
178 3300005617 Ga0068859_100297249 Ga0068859_1002972492 146
179 3300005618 Ga0068864_100093156 Ga0068864_1000931562 146
180 3300005834 Ga0068851_10000027 Ga0068851_10000027103 146
181 3300005834 Ga0068851_10180785 Ga0068851_101807852 146
182 3300005841 Ga0068863_101551749 Ga0068863_1015517492 146
183 3300006038 Ga0075365_10138551 Ga0075365_101385513 146
184 3300006051 Ga0075364_10006791 Ga0075364_100067913 146
185 3300006051 Ga0075364_10338747 Ga0075364_103387472 146
186 3300006931 Ga0097620_100297234 Ga0097620_1002972342 146
187 3300009093 Ga0105240_10486162 Ga0105240_104861623 146
188 3300009098 Ga0105245_10054442 Ga0105245_100544421 146
189 3300009101 Ga0105247_10145871 Ga0105247_101458712 146
190 3300009101 Ga0105247_10255834 Ga0105247_102558341 146
191 3300009174 Ga0105241_11479202 Ga0105241_114792022 146
192 3300009177 Ga0105248_10000492 Ga0105248_1000049213 146
193 3300009545 Ga0105237_10000442 Ga0105237_1000044210 146
194 3300009551 Ga0105238_10015350 Ga0105238_100153508 146
195 3300009551 Ga0105238_10163828 Ga0105238_101638282 146
196 3300010375 Ga0105239_10056750 Ga0105239_100567504 146
197 3300010375 Ga0105239_11147535 Ga0105239_111475352 146
198 3300010375 Ga0105239_11336717 Ga0105239_113367172 146
199 3300013104 Ga0157370_10014835 Ga0157370_100148356 146
200 3300013104 Ga0157370_10195745 Ga0157370_101957452 146
201 3300013105 Ga0157369_10018468 Ga0157369_100184684 146
202 3300013296 Ga0157374_10168275 Ga0157374_101682753 146
203 3300013307 Ga0157372_10449198 Ga0157372_104491983 146
204 3300013307 Ga0157372_11604436 Ga0157372_116044362 146
205 3300013308 Ga0157375_10134328 Ga0157375_101343283 146
206 3300013308 Ga0157375_10172106 Ga0157375_101721063 146
207 3300013308 Ga0157375_10454271 Ga0157375_104542713 146
208 3300013308 Ga0157375_10667693 Ga0157375_106676932 146
209 3300014325 Ga0163163_10084876 Ga0163163_100848762 146
210 3300014325 Ga0163163_10363656 Ga0163163_103636563 146
211 3300020069 Ga0197907_10362185 Ga0197907_103621852 146
212 3300020069 Ga0197907_11190262 Ga0197907_111902622 146
213 3300020070 Ga0206356_10216627 Ga0206356_102166272 146
214 3300020075 Ga0206349_1191997 Ga0206349_11919973 146
215 3300020076 Ga0206355_1320943 Ga0206355_13209432 146
216 3300020077 Ga0206351_10302037 Ga0206351_103020371 146
217 3300020077 Ga0206351_10924243 Ga0206351_109242431 146
218 3300020078 Ga0206352_10530069 Ga0206352_105300691 146
219 3300020080 Ga0206350_10199319 Ga0206350_101993191 146
220 3300020080 Ga0206350_10703538 Ga0206350_107035382 146
221 3300020081 Ga0206354_10810658 Ga0206354_108106581 146
222 3300020082 Ga0206353_10061093 Ga0206353_100610938 146
223 3300020610 Ga0154015_1358594 Ga0154015_13585941 146
224 3300022467 Ga0224712_10044691 Ga0224712_100446913 146
225 3300025231 Ga0207427_100039 Ga0207427_10003972 146
226 3300025233 Ga0209437_100599 Ga0209437_10059920 146
227 3300025253 Ga0209677_100406 Ga0209677_10040617 146
228 3300025254 Ga0209148_1002028 Ga0209148_10020283 146
229 3300025261 Ga0209233_1000014 Ga0209233_1000014446 146
230 3300025321 Ga0207656_10000001 Ga0207656_10000001907 146
231 3300025321 Ga0207656_10062423 Ga0207656_100624232 146
232 3300025900 Ga0207710_10093041 Ga0207710_100930411 146
233 3300025900 Ga0207710_10229055 Ga0207710_102290552 146
234 3300025904 Ga0207647_10042047 Ga0207647_100420473 146
235 3300025909 Ga0207705_10000001 Ga0207705_100000011366 146
236 3300025909 Ga0207705_10044334 Ga0207705_100443342 146
237 3300025909 Ga0207705_10136403 Ga0207705_101364032 146
238 3300025909 Ga0207705_10149823 Ga0207705_101498232 146
239 3300025909 Ga0207705_10173072 Ga0207705_101730722 146
240 3300025913 Ga0207695_10006597 Ga0207695_1000659714 146
241 3300025913 Ga0207695_10451631 Ga0207695_104516313 146
242 3300025913 Ga0207695_10851566 Ga0207695_108515662 146
243 3300025914 Ga0207671_10000001 Ga0207671_10000001906 146
244 3300025919 Ga0207657_10036357 Ga0207657_100363575 146
245 3300025920 Ga0207649_10089603 Ga0207649_100896033 146
246 3300025924 Ga0207694_10000420 Ga0207694_100004209 146
247 3300025927 Ga0207687_10027545 Ga0207687_100275454 146
248 3300025931 Ga0207644_11266000 Ga0207644_112660001 146
249 3300025932 Ga0207690_10000300 Ga0207690_1000030011 146
250 3300025935 Ga0207709_10914968 Ga0207709_109149681 146
251 3300025940 Ga0207691_10092793 Ga0207691_100927933 146
252 3300025941 Ga0207711_10001676 Ga0207711_1000167612 146
253 3300025942 Ga0207689_10786711 Ga0207689_107867111 146
254 3300025949 Ga0207667_10003290 Ga0207667_100032909 146
255 3300025949 Ga0207667_10005356 Ga0207667_100053563 146
256 3300025949 Ga0207667_10005569 Ga0207667_100055692 146
257 3300025949 Ga0207667_10629105 Ga0207667_106291053 146
258 3300025981 Ga0207640_11478187 Ga0207640_114781871 146
259 3300025986 Ga0207658_10787939 Ga0207658_107879392 146
260 3300026035 Ga0207703_10000224 Ga0207703_1000022452 146
261 3300026041 Ga0207639_10017834 Ga0207639_100178346 146
262 3300026041 Ga0207639_10032822 Ga0207639_100328225 146
263 3300026067 Ga0207678_10233727 Ga0207678_102337272 146
264 3300026067 Ga0207678_10480393 Ga0207678_104803932 146
265 3300026078 Ga0207702_10087545 Ga0207702_100875453 146
266 3300026078 Ga0207702_10492423 Ga0207702_104924232 146
267 3300026088 Ga0207641_11312571 Ga0207641_113125712 146
268 3300026095 Ga0207676_10888316 Ga0207676_108883162 146
269 3300026116 Ga0207674_10001276 Ga0207674_1000127627 146
270 3300026142 Ga0207698_10000473 Ga0207698_100004738 146
271 3300026142 Ga0207698_10000591 Ga0207698_1000059113 146
272 3300026142 Ga0207698_10195879 Ga0207698_101958792 146
273 3300028380 Ga0268265_10312438 Ga0268265_103124383 146
274 3300028794 Ga0307515_10065382 Ga0307515_100653829 146
275 3300028794 Ga0307515_10281435 Ga0307515_102814352 146
276 3300028794 Ga0307515_10295960 Ga0307515_102959601 146
277 3300031456 Ga0307513_10188059 Ga0307513_101880592 146
278 3300031456 Ga0307513_11002181 Ga0307513_110021811 146
279 3300031824 Ga0307413_10425534 Ga0307413_104255342 146
280 3300031838 Ga0307518_10259890 Ga0307518_102598902 146
281 3300031852 Ga0307410_10102484 Ga0307410_101024843 146
282 3300031901 Ga0307406_10023710 Ga0307406_100237104 146
283 3300031911 Ga0307412_10170273 Ga0307412_101702732 146
284 3300031911 Ga0307412_10747714 Ga0307412_107477141 146
285 3300031911 Ga0307412_11175402 Ga0307412_111754022 146
286 3300032002 Ga0307416_100435418 Ga0307416_1004354182 146
287 3300032126 Ga0307415_100309089 Ga0307415_1003090893 146
288 3300037312 Ga0395899_0003980 Ga0395899_0003980_6300_6740 146
289 3300037418 Ga0395900_0161151 Ga0395900_0161151_89_529 146
290 3300038443 Ga0395901_0420429 Ga0395901_0420429_854_1294 146
291 3300038443 Ga0395901_1480176 Ga0395901_1480176_168_614 146
292 3300041413 Ga0439465_0275485 Ga0439465_0275485_82_522 146
293 3300041451 Ga0451791_1588114 Ga0451791_1588114_231_680 146
294 3300041452 Ga0451793_0124887 Ga0451793_0124887_157_597 146
295 3300041452 Ga0451793_0277597 Ga0451793_0277597_574_1014 146
296 3300041452 Ga0451793_0943848 Ga0451793_0943848_33_473 146
297 3300041452 Ga0451793_1643693 Ga0451793_1643693_200_646 146
298 3300041453 Ga0451797_1137175 Ga0451797_1137175_98_538 146
299 3300041456 Ga0451795_1302916 Ga0451795_1302916_538_978 146
300 3300041498 Ga0451841_0346760 Ga0451841_0346760_447_887 146
301 3300041512 Ga0451853_4106937 Ga0451853_4106937_16_459 146
302 3300042014 Ga0439457_096258 Ga0439457_096258_27_467 146
303 3300044656 Ga0466969_0224737 Ga0466969_0224737_385_828 146
304 3300044658 Ga0466972_0077356 Ga0466972_0077356_493_933 146
305 3300044658 Ga0466972_0125388 Ga0466972_0125388_508_948 146
306 3300044683 Ga0466965_0031080 Ga0466965_0031080_1376_1816 146
307 3300044683 Ga0466965_0084228 Ga0466965_0084228_371_811 146
308 3300044684 Ga0466966_0092573 Ga0466966_0092573_70_510 146
309 3300044693 Ga0466961_0264562 Ga0466961_0264562_114_560 146
310 3300044719 Ga0466971_0416857 Ga0466971_0416857_121_561 146
311 3300044735 Ga0466968_0092331 Ga0466968_0092331_686_1126 146
312 3300044765 Ga0466970_0003621 Ga0466970_0003621_5708_6151 146
313 3300044765 Ga0466970_0041380 Ga0466970_0041380_729_1169 146
314 3300045836 Ga0466958_0291009 Ga0466958_0291009_510_950 146
315 3300045976 Ga0466967_0658292 Ga0466967_0658292_58_498 146
316 3300045976 Ga0466967_1778431 Ga0466967_1778431_70_510 146
317 3300046457 Ga0495590_0002706 Ga0495590_0002706_5929_6375 146
318 3300046472 Ga0495580_0105585 Ga0495580_0105585_581_1027 146
319 3300046507 Ga0495606_0223736 Ga0495606_0223736_32_472 146
320 3300046515 Ga0495620_0342687 Ga0495620_0342687_22_495 146
321 3300046519 Ga0495632_0123742 Ga0495632_0123742_533_979 146
322 3300046660 Ga0495625_0603547 Ga0495625_0603547_21_470 146
323 3300046674 Ga0495588_0046650 Ga0495588_0046650_744_1190 146
324 3300047315 Ga0495581_0096987 Ga0495581_0096987_826_1272 146
325 3300047320 Ga0495672_0019950 Ga0495672_0019950_1711_2160 146
326 3300047320 Ga0495672_0095528 Ga0495672_0095528_865_1311 146
327 3300047469 Ga0495673_0204137 Ga0495673_0204137_161_601 146
328 3300047472 Ga0495686_0148713 Ga0495686_0148713_571_1017 146
329 3300047472 Ga0495686_0160868 Ga0495686_0160868_240_689 146
330 3300048904 Ga0496101_0200078 Ga0496101_0200078_602_1045 146
331 3300048905 Ga0496102_0706909 Ga0496102_0706909_451_894 146
332 3300048907 Ga0496104_0639336 Ga0496104_0639336_80_520 146
333 3300048917 Ga0496114_0080692 Ga0496114_0080692_481_921 146
334 3300048918 Ga0496115_0255670 Ga0496115_0255670_81_521 146
335 3300048920 Ga0496117_0004795 Ga0496117_0004795_1955_2398 146
336 3300048920 Ga0496117_0036516 Ga0496117_0036516_2355_2795 146
337 3300048921 Ga0496118_0000472 Ga0496118_0000472_29237_29680 146
338 3300048922 Ga0496119_0061493 Ga0496119_0061493_1222_1665 146
339 3300048922 Ga0496119_0198978 Ga0496119_0198978_39_482 146
340 3300048922 Ga0496119_0375335 Ga0496119_0375335_42_482 146
341 3300048923 Ga0496120_0178600 Ga0496120_0178600_107_550 146
342 3300048924 Ga0496121_0000015 Ga0496121_0000015_213572_214012 146
343 3300048924 Ga0496121_0414571 Ga0496121_0414571_420_860 146
344 3300048927 Ga0496124_0000040 Ga0496124_0000040_26000_26443 146
345 3300048929 Ga0496126_0295474 Ga0496126_0295474_654_1097 146
346 3300048929 Ga0496126_0570961 Ga0496126_0570961_93_533 146
347 3300048929 Ga0496126_0614933 Ga0496126_0614933_368_808 146
348 3300049568 Ga0501031_0016691 Ga0501031_0016691_4302_4742 146
349 3300049569 Ga0501032_0006421 Ga0501032_0006421_5070_5513 146
350 3300049569 Ga0501032_0006536 Ga0501032_0006536_7242_7682 146
351 3300049569 Ga0501032_0044095 Ga0501032_0044095_355_801 146
352 3300049570 Ga0501033_0003088 Ga0501033_0003088_4854_5294 146
353 3300049570 Ga0501033_0007742 Ga0501033_0007742_899_1345 146
354 3300049570 Ga0501033_0012546 Ga0501033_0012546_5286_5726 146
355 3300049570 Ga0501033_0095304 Ga0501033_0095304_998_1444 146
356 3300049570 Ga0501033_0103380 Ga0501033_0103380_1248_1691 146
357 3300049570 Ga0501033_0406958 Ga0501033_0406958_33_473 146
358 3300049571 Ga0501034_0008302 Ga0501034_0008302_5418_5861 146
359 3300049571 Ga0501034_0018348 Ga0501034_0018348_3762_4202 146
360 3300049571 Ga0501034_0040767 Ga0501034_0040767_3953_4399 146
361 3300049571 Ga0501034_0042209 Ga0501034_0042209_174_620 146
362 3300049571 Ga0501034_0056708 Ga0501034_0056708_3148_3588 146
363 3300049571 Ga0501034_0077430 Ga0501034_0077430_2435_2881 146
364 3300049571 Ga0501034_0110271 Ga0501034_0110271_463_909 146
365 3300049571 Ga0501034_0238007 Ga0501034_0238007_1037_1477 146
366 3300049571 Ga0501034_0285811 Ga0501034_0285811_80_520 146
367 3300049571 Ga0501034_0295120 Ga0501034_0295120_101_541 146
368 3300049571 Ga0501034_0303839 Ga0501034_0303839_651_1091 146
369 3300049571 Ga0501034_1031675 Ga0501034_1031675_168_608 146
370 3300049572 Ga0501036_0013201 Ga0501036_0013201_2347_2790 146
371 3300049572 Ga0501036_0139205 Ga0501036_0139205_865_1305 146
372 3300049572 Ga0501036_0181793 Ga0501036_0181793_326_772 146
373 3300049572 Ga0501036_0202534 Ga0501036_0202534_186_632 146
374 3300049573 Ga0501037_0021659 Ga0501037_0021659_1957_2397 146
375 3300049573 Ga0501037_0051907 Ga0501037_0051907_330_776 146
376 3300049573 Ga0501037_0076941 Ga0501037_0076941_1300_1740 146
377 3300049573 Ga0501037_0095599 Ga0501037_0095599_1110_1553 146
378 3300049573 Ga0501037_0143615 Ga0501037_0143615_909_1349 146
379 3300049573 Ga0501037_0574185 Ga0501037_0574185_123_563 146
380 3300049574 Ga0501038_0004245 Ga0501038_0004245_12488_12934 146
381 3300049574 Ga0501038_0015122 Ga0501038_0015122_1438_1878 146
382 3300049574 Ga0501038_0181984 Ga0501038_0181984_740_1180 146
383 3300049574 Ga0501038_0288508 Ga0501038_0288508_219_665 146
384 3300049575 Ga0501039_0020137 Ga0501039_0020137_2850_3293 146
385 3300049575 Ga0501039_0086557 Ga0501039_0086557_1092_1532 146
386 3300049575 Ga0501039_0154499 Ga0501039_0154499_488_934 146
387 3300049575 Ga0501039_0275618 Ga0501039_0275618_642_1082 146
388 3300049575 Ga0501039_1222230 Ga0501039_1222230_98_538 146
389 3300049576 Ga0501040_1381756 Ga0501040_1381756_47_487 146
390 3300049578 Ga0501042_0054225 Ga0501042_0054225_658_1098 146
391 3300049578 Ga0501042_0083580 Ga0501042_0083580_46_489 146
392 3300049579 Ga0501043_0012047 Ga0501043_0012047_3492_3938 146
393 3300049579 Ga0501043_0012355 Ga0501043_0012355_1703_2143 146
394 3300049579 Ga0501043_0050120 Ga0501043_0050120_2758_3198 146
395 3300049579 Ga0501043_0241928 Ga0501043_0241928_815_1261 146
396 3300049579 Ga0501043_0532645 Ga0501043_0532645_121_561 146
397 3300049580 Ga0501046_0011643 Ga0501046_0011643_847_1287 146
398 3300049580 Ga0501046_0376474 Ga0501046_0376474_309_755 146
399 3300049581 Ga0501047_0051731 Ga0501047_0051731_382_822 146
400 3300049581 Ga0501047_0151416 Ga0501047_0151416_1636_2079 146
401 3300049581 Ga0501047_0187916 Ga0501047_0187916_342_788 146
402 3300049581 Ga0501047_0355567 Ga0501047_0355567_381_821 146
403 3300049581 Ga0501047_0411546 Ga0501047_0411546_576_1016 146
404 3300049581 Ga0501047_0721618 Ga0501047_0721618_169_609 146
405 3300049582 Ga0501048_0000826 Ga0501048_0000826_3676_4119 146
406 3300049582 Ga0501048_0070152 Ga0501048_0070152_881_1321 146
407 3300049582 Ga0501048_1233783 Ga0501048_1233783_75_515 146
408 3300049583 Ga0501067_0016214 Ga0501067_0016214_408_848 146
409 3300049584 Ga0501068_0056338 Ga0501068_0056338_1706_2149 146
410 3300049584 Ga0501068_0056343 Ga0501068_0056343_1223_1669 146
411 3300049584 Ga0501068_0101937 Ga0501068_0101937_186_626 146
412 3300049585 Ga0501069_0111771 Ga0501069_0111771_188_634 146
413 3300049585 Ga0501069_0511526 Ga0501069_0511526_193_642 146
414 3300049586 Ga0501070_0003466 Ga0501070_0003466_9020_9466 146
415 3300049586 Ga0501070_0031034 Ga0501070_0031034_177_620 146
416 3300049586 Ga0501070_0040299 Ga0501070_0040299_693_1139 146
417 3300049586 Ga0501070_0921308 Ga0501070_0921308_56_496 146
418 3300049586 Ga0501070_1198556 Ga0501070_1198556_23_469 146
419 3300049587 Ga0501071_0006160 Ga0501071_0006160_101_547 146
420 3300049587 Ga0501071_0163258 Ga0501071_0163258_640_1080 146
421 3300049588 Ga0501072_0833598 Ga0501072_0833598_271_711 146
422 3300049589 Ga0501073_0019298 Ga0501073_0019298_1454_1894 146
423 3300049589 Ga0501073_0141895 Ga0501073_0141895_324_764 146
424 3300049589 Ga0501073_0352937 Ga0501073_0352937_407_847 146
425 3300049589 Ga0501073_1207936 Ga0501073_1207936_41_487 146
426 3300049590 Ga0501074_0086964 Ga0501074_0086964_25_465 146
427 3300049741 Ga0501079_0255172 Ga0501079_0255172_700_1140 146
428 3300049742 Ga0501080_0000092 Ga0501080_0000092_49593_50039 146
429 3300049744 Ga0501083_0000011 Ga0501083_0000011_11416_11862 146
430 3300049744 Ga0501083_0049995 Ga0501083_0049995_55_501 146
431 3300049744 Ga0501083_0606709 Ga0501083_0606709_117_557 146
432 3300049822 Ga0501035_0013421 Ga0501035_0013421_861_1301 146
433 3300049822 Ga0501035_0069684 Ga0501035_0069684_150_590 146
434 3300049822 Ga0501035_0082162 Ga0501035_0082162_740_1180 146
435 3300049822 Ga0501035_0374223 Ga0501035_0374223_14_460 146
436 3300049823 Ga0501044_0017495 Ga0501044_0017495_5853_6293 146
437 3300049823 Ga0501044_0017572 Ga0501044_0017572_971_1411 146
438 3300049823 Ga0501044_0078822 Ga0501044_0078822_2823_3263 146
439 3300049823 Ga0501044_0107056 Ga0501044_0107056_913_1353 146
440 3300049823 Ga0501044_0216339 Ga0501044_0216339_73_519 146
441 3300049823 Ga0501044_0686399 Ga0501044_0686399_246_692 146
442 3300049824 Ga0501045_0060827 Ga0501045_0060827_1971_2414 146
443 3300050491 nmdc:mga00v17_2594_c1 nmdc:mga00v17_2594_c1_3798_4244 146
444 3300050492 nmdc:mga0yw44_108739_c1 nmdc:mga0yw44_108739_c1_958_1404 146
445 3300050492 nmdc:mga0yw44_199623_c1 nmdc:mga0yw44_199623_c1_694_1140 146
446 3300050509 nmdc:mga0qj67_1411456_c1 nmdc:mga0qj67_1411456_c1_60_503 146
447 3300053080 Ga0500635_0022215 Ga0500635_0022215_1062_1502 146
448 3300053087 Ga0500643_000297 Ga0500643_000297_9953_10393 146
449 3300053104 Ga0500556_0000041 Ga0500556_0000041_54065_54505 146
450 3300053108 Ga0500562_000624 Ga0500562_000624_5567_6013 146
451 3300053133 Ga0500655_005012 Ga0500655_005012_1767_2213 146
452 3300053136 Ga0500559_0001662 Ga0500559_0001662_5006_5446 146
453 3300053136 Ga0500559_0315538 Ga0500559_0315538_106_549 146
454 3300053139 Ga0500568_0000003 Ga0500568_0000003_436384_436824 146
455 3300053140 Ga0500573_0000011 Ga0500573_0000011_146719_147159 146
456 3300053140 Ga0500573_0001100 Ga0500573_0001100_9160_9606 146
457 3300053140 Ga0500573_0019828 Ga0500573_0019828_1894_2337 146
458 3300053140 Ga0500573_0026506 Ga0500573_0026506_2715_3158 146
459 3300053140 Ga0500573_0063038 Ga0500573_0063038_1070_1510 146
460 3300053140 Ga0500573_0162312 Ga0500573_0162312_186_629 146
461 3300053140 Ga0500573_0356871 Ga0500573_0356871_165_608 146
462 3300053142 Ga0500577_0024964 Ga0500577_0024964_1437_1877 146
463 3300053142 Ga0500577_0037570 Ga0500577_0037570_421_864 146
464 3300053142 Ga0500577_0101717 Ga0500577_0101717_76_516 146
465 3300053146 Ga0500588_0003164 Ga0500588_0003164_1376_1822 146
466 3300053148 Ga0500590_039823 Ga0500590_039823_865_1305 146
467 3300053153 Ga0500616_0000040 Ga0500616_0000040_339704_340144 146
468 3300054114 Ga0501084_0055677 Ga0501084_0055677_2529_2975 146
469 3300061719 Ga0466962_0134325 Ga0466962_0134325_94_534 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

15

147

0.9

PF22622

MFE-2_hydrat-2_N

MFE-2 hydratase 2 N-terminal domain

56

155

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zy8-assembly1.cif.gz_C crystal structure of c terminal truncated hadbc (3r-hydroxyacyl-acp dehydratase) complex from mycobacterium tuberculosis 0.9577 5 141
5zy8-assembly1.cif.gz_A crystal structure of c terminal truncated hadbc (3r-hydroxyacyl-acp dehydratase) complex from mycobacterium tuberculosis 0.9465 5 140
4rlw-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis complexed with butein 0.9422 2 143
4rlj-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis 0.9397 1 144
4rlt-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis complexed with fisetin 0.9379 1 145
ID Description Score Start End Superfamily
af_P9WFK3_7_161_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9607 4 144 3.10.129.10
4rltA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9379 1 145 3.10.129.10
af_P9WFJ9_1_152_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9373 5 146 3.10.129.10
4rv2A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9267 6 140 3.10.129.10
4rltA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9257 1 145 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A4V3FB53-F1-model_v4 deleted 0.9933 1 146
AF-A0A1H4V894-F1-model_v4 UPF0336 protein SAMN04490220_2521 0.993 1 146
AF-A0A839G4M2-F1-model_v4 deleted 0.9928 1 146
AF-A0A367XUJ0-F1-model_v4 UPF0336 protein DTO57_13380 0.9918 1 146 GO:0006633
GO:0019171
AF-A0A4V3CYU4-F1-model_v4 UPF0336 protein EDF62_0147 0.9912 1 146 GO:0006633
GO:0019171

Feature Viewer

pLDDT pTM Quality
95.75 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map