F450249

General Info

Members Datasets Scaffolds Average Seq Length
469 277 938 92

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10218307|Ga0207671_102183073
Length 110
Sequence MRPDLAVLPPRFLRTKEAAEFLSLSARTLEKHRTYGTGPAYRKLGGRVVYAVDDLQAWAERGAVTSTSDPRGSVLPAKRHSPMPPAHAGRNARPNGIGAPRCGAFRHSDL

Samples

Sample ID Description Type Environment
1 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
52 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
70 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
71 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
74 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
75 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
76 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
77 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
78 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
79 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
90 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
97 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
104 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
105 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
108 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
109 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
110 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
111 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
120 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
121 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
122 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
123 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
124 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
149 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
154 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
155 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
156 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
157 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
160 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
161 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
162 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
163 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
164 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
165 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
168 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
169 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
170 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
171 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
172 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
173 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
174 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
175 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
176 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
177 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
178 2643221558 Rhizobium sp. Root149 Isolate Unclassified
179 2643221568 Rhizobium sp. Root564 Isolate Unclassified
180 2643221582 Rhizobium sp. Root651 Isolate Unclassified
181 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
182 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
183 2643221736 Bosea sp. Root483D1 Isolate Unclassified
184 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
185 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
186 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
187 2773857925 Microvirga vignae BR3299 Isolate Unclassified
188 2802429634 Rhizobium anhuiense S10 Isolate Nodule
189 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
190 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
191 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
192 2854911287 Brucella lupini LUP21 Isolate Unclassified
193 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
194 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
195 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
196 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
197 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
198 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
199 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
200 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
201 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
202 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
203 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
204 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
205 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
206 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
207 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
208 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
209 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
210 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
211 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
212 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
213 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
214 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
215 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
216 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
217 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
218 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
219 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
220 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
221 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
222 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
223 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
224 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
225 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
226 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
227 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
228 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
229 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
230 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
231 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
232 2936381700 Rhizobium chutanense C16 Isolate Unclassified
233 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
234 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
235 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
236 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
237 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
238 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
239 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
240 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
241 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
242 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
243 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
244 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
245 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
246 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
247 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
248 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
249 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
250 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
251 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
252 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
253 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
254 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
255 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
256 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
257 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
258 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
259 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
260 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
261 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
262 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
263 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
264 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
265 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
266 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
267 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
268 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
269 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
270 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
271 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
272 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
273 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
274 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
275 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
276 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
277 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.91
Metatranscriptomes 0
Isolates 24.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.87
Nodule 21.54
Rhizoplane 2.35
Rhizosphere 57.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207671_10218307 3300025914 Bacteria 1493
2 JGI24739J22299_10048356 3300001989 Bacteria 1384
3 JGI24739J22299_10052564 3300001989 Bacteria 1310
4 JGI24737J22298_10043794 3300001990 Bacteria 1370
5 JGI25153J46596_10115911 3300003215 Bacteria 609
6 rootH1_10156210 3300003316 Bacteria 1808
7 rootH1_10245886 3300003323 Bacteria 2496
8 Ga0055542_1002360 3300003762 Bacteria 6409
9 Ga0055531_10011238 3300003794 Bacteria 4347
10 Ga0070658_10196170 3300005327 Bacteria 1702
11 Ga0070660_100024126 3300005339 Bacteria 4512
12 Ga0070660_100653808 3300005339 Bacteria 880
13 Ga0070661_101771814 3300005344 Bacteria 524
14 Ga0070659_101098568 3300005366 Bacteria 701
15 Ga0070659_101991685 3300005366 Bacteria 521
16 Ga0070667_100096022 3300005367 Bacteria 2556
17 Ga0070663_100448426 3300005455 Bacteria 1063
18 Ga0068853_100431987 3300005539 Bacteria 1236
19 Ga0068853_102274572 3300005539 Bacteria 525
20 Ga0070665_100100075 3300005548 Bacteria 2903
21 Ga0068855_100648221 3300005563 Bacteria 1134
22 Ga0068854_100157186 3300005578 Bacteria 1758
23 Ga0068856_100019133 3300005614 Bacteria 6648
24 Ga0068852_100360895 3300005616 Bacteria 1421
25 Ga0075365_10000406 3300006038 Bacteria 15820
26 Ga0075365_10038868 3300006038 Bacteria 3095
27 Ga0075365_10878053 3300006038 Bacteria 632
28 Ga0075368_10035893 3300006042 Bacteria 1936
29 Ga0075363_100006650 3300006048 Bacteria 5269
30 Ga0075364_10261215 3300006051 Bacteria 1177
31 Ga0075364_10566369 3300006051 Bacteria 776
32 Ga0075362_10124683 3300006177 Bacteria 1221
33 Ga0075362_10141727 3300006177 Bacteria 1149
34 Ga0075362_10522358 3300006177 Bacteria 608
35 Ga0075367_10005984 3300006178 Bacteria 6109
36 Ga0075369_10029135 3300006186 Bacteria 2317
37 Ga0075369_10109140 3300006186 Bacteria 1246
38 Ga0075369_10148605 3300006186 Bacteria 1070
39 Ga0075370_10077251 3300006353 Bacteria 1910
40 Ga0099826_10000025 3300006948 Bacteria 146840
41 Ga0099826_10000056 3300006948 Bacteria 70004
42 Ga0105240_10665094 3300009093 Bacteria 1140
43 Ga0105240_11495907 3300009093 Bacteria 708
44 Ga0105245_11306699 3300009098 Bacteria 774
45 Ga0105241_10132397 3300009174 Bacteria 2021
46 Ga0105237_10149094 3300009545 Bacteria 2335
47 Ga0105237_10153738 3300009545 Bacteria 2297
48 Ga0105237_10186678 3300009545 Bacteria 2073
49 Ga0105237_11657073 3300009545 Bacteria 647
50 Ga0105238_10104323 3300009551 Bacteria 2816
51 Ga0105239_10025473 3300010375 Bacteria 6512
52 Ga0105239_10254485 3300010375 Bacteria 1973
53 Ga0105239_10321836 3300010375 Bacteria 1744
54 Ga0105239_11353127 3300010375 Bacteria 822
55 Ga0157371_10000346 3300013102 Bacteria 59564
56 Ga0157370_10174149 3300013104 Bacteria 2000
57 Ga0157370_12007264 3300013104 Bacteria 519
58 Ga0157369_10098962 3300013105 Bacteria 3109
59 Ga0157369_11098367 3300013105 Bacteria 813
60 Ga0157369_12109005 3300013105 Bacteria 572
61 Ga0171462_1052 3300013250 Bacteria 31452
62 Ga0157374_10094257 3300013296 Bacteria 2860
63 Ga0157374_12012723 3300013296 Bacteria 604
64 Ga0163162_12846593 3300013306 Bacteria 557
65 Ga0163163_10437548 3300014325 Bacteria 1367
66 Ga0182008_10009071 3300014497 Bacteria 5386
67 Ga0157379_10727090 3300014968 Bacteria 933
68 Ga0157376_12059955 3300014969 Bacteria 609
69 Ga0157376_12334850 3300014969 Bacteria 574
70 Ga0182006_1015307 3300015261 Bacteria 3289
71 Ga0183365_10002 3300015684 Bacteria 545891
72 Ga0163161_11306785 3300017792 Bacteria 631
73 Ga0209147_100709 3300025229 Bacteria 16985
74 Ga0209148_1000126 3300025254 Bacteria 181590
75 Ga0209233_1013012 3300025261 Bacteria 2391
76 Ga0209455_1000280 3300025272 Bacteria 55431
77 Ga0209758_1003275 3300025297 Bacteria 15014
78 Ga0209257_1000490 3300025304 Bacteria 71185
79 Ga0207647_10133278 3300025904 Bacteria 1459
80 Ga0207705_10124979 3300025909 Bacteria 1911
81 Ga0207654_10464732 3300025911 Bacteria 889
82 Ga0207695_10307189 3300025913 Bacteria 1476
83 Ga0207695_11681766 3300025913 Bacteria 515
84 Ga0207671_10395074 3300025914 Bacteria 1099
85 Ga0207671_10422428 3300025914 Bacteria 1061
86 Ga0207657_11165809 3300025919 Bacteria 587
87 Ga0207694_10055093 3300025924 Bacteria 3087
88 Ga0207694_10117320 3300025924 Bacteria 2122
89 Ga0207690_10913262 3300025932 Bacteria 728
90 Ga0207667_10594773 3300025949 Bacteria 1116
91 Ga0207667_11941128 3300025949 Bacteria 550
92 Ga0207658_11265593 3300025986 Bacteria 674
93 Ga0207639_10440568 3300026041 Bacteria 1181
94 Ga0207639_10891841 3300026041 Bacteria 831
95 Ga0207678_10914904 3300026067 Bacteria 776
96 Ga0207702_10122768 3300026078 Bacteria 2327
97 Ga0207702_11005676 3300026078 Bacteria 827
98 Ga0207648_11653372 3300026089 Bacteria 602
99 Ga0207698_10254799 3300026142 Bacteria 1608
100 Ga0209281_1002833 3300027111 Bacteria 6356
101 Ga0209282_1000084 3300027666 Bacteria 70012
102 Ga0209282_1000144 3300027666 Bacteria 41703
103 Ga0209282_1000192 3300027666 Bacteria 32712
104 Ga0209282_1000299 3300027666 Bacteria 24490
105 Ga0209813_10011111 3300027866 Bacteria 2346
106 Ga0268266_10086379 3300028379 Bacteria 2743
107 Ga0268266_10627072 3300028379 Bacteria 1034
108 Ga0265337_1119991 3300028556 Bacteria 713
109 Ga0265326_10029936 3300028558 Bacteria 1550
110 Ga0265319_1007557 3300028563 Bacteria 4868
111 Ga0265334_10062325 3300028573 Bacteria 1403
112 Ga0265318_10020795 3300028577 Bacteria 2643
113 Ga0265323_10002302 3300028653 Bacteria 8843
114 Ga0265336_10000186 3300028666 Bacteria 43307
115 Ga0307515_10587239 3300028794 Bacteria 724
116 Ga0265338_10000151 3300028800 Bacteria 126283
117 Ga0265328_10339932 3300031239 Bacteria 584
118 Ga0307513_10004785 3300031456 Bacteria 17977
119 Ga0307513_10690877 3300031456 Bacteria 726
120 Ga0307408_100011359 3300031548 Bacteria 5883
121 Ga0307405_11808145 3300031731 Bacteria 543
122 Ga0307412_10003783 3300031911 Bacteria 8408
123 Ga0315914_1000129 3300031967 Bacteria 70013
124 Ga0315914_1001581 3300031967 Bacteria 34302
125 Ga0315914_1001714 3300031967 Bacteria 33301
126 Ga0307416_101768418 3300032002 Bacteria 722
127 Ga0307416_103388733 3300032002 Bacteria 533
128 Ga0315913_1000034 3300033430 Bacteria 70013
129 Ga0315913_1000553 3300033430 Bacteria 34532
130 Ga0315913_1000622 3300033430 Bacteria 33301
131 Ga0315915_1000066 3300033464 Bacteria 70010
132 Ga0395899_0000059 3300037312 Bacteria 213004
133 Ga0395899_0000107 3300037312 Bacteria 144087
134 Ga0395900_0000017 3300037418 Bacteria 369602
135 Ga0395900_0000101 3300037418 Bacteria 153550
136 Ga0395900_0090680 3300037418 Bacteria 3142
137 Ga0395898_0000030 3300037466 Bacteria 369577
138 Ga0395898_0000043 3300037466 Bacteria 301783
139 Ga0395905_0000056 3300037471 Bacteria 209230
140 Ga0395905_0000101 3300037471 Bacteria 144115
141 Ga0395905_0042700 3300037471 Bacteria 4254
142 Ga0395905_1039708 3300037471 Bacteria 722
143 Ga0395905_1226131 3300037471 Bacteria 654
144 Ga0395901_0000015 3300038443 Bacteria 373388
145 Ga0395901_0000068 3300038443 Bacteria 144095
146 Ga0395901_1111846 3300038443 Bacteria 760
147 Ga0237819_21571 3300038705 Bacteria 656
148 Ga0451843_0058967 3300041509 Bacteria 753
149 Ga0451843_0937195 3300041509 Bacteria 653
150 Ga0466971_0642114 3300044719 Bacteria 531
151 Ga0451576_0143124 3300045051 Bacteria 2493
152 Ga0495638_0000720 3300046460 Bacteria 35702
153 Ga0495643_0000007 3300046522 Bacteria 383435
154 Ga0495643_0029242 3300046522 Bacteria 3084
155 Ga0495648_0000691 3300046524 Bacteria 36002
156 Ga0495648_0001199 3300046524 Bacteria 25964
157 Ga0495597_0147050 3300046542 Bacteria 969
158 Ga0495633_0004664 3300046558 Bacteria 8626
159 Ga0495633_0192600 3300046558 Bacteria 937
160 Ga0495611_0017715 3300046648 Bacteria 3050
161 Ga0495625_0002308 3300046660 Bacteria 20866
162 Ga0495625_0013390 3300046660 Bacteria 6592
163 Ga0495670_0001510 3300046691 Bacteria 11351
164 Ga0495670_0006110 3300046691 Bacteria 5909
165 Ga0495671_0000071 3300046692 Bacteria 97337
166 Ga0495589_0356765 3300046794 Bacteria 673
167 Ga0495687_000136 3300047443 Bacteria 113298
168 Ga0496103_0969505 3300048906 Bacteria 531
169 Ga0496104_0000035 3300048907 Bacteria 181792
170 Ga0496104_0249669 3300048907 Bacteria 1687
171 Ga0496105_0000029 3300048908 Bacteria 139338
172 Ga0496105_1016294 3300048908 Bacteria 619
173 Ga0496108_0017597 3300048911 Bacteria 5847
174 Ga0496111_0197505 3300048914 Bacteria 1496
175 Ga0496112_0400943 3300048915 Bacteria 1311
176 Ga0496113_1034729 3300048916 Bacteria 646
177 Ga0496114_1291781 3300048917 Bacteria 616
178 Ga0496116_0063235 3300048919 Bacteria 2385
179 Ga0496118_0128035 3300048921 Bacteria 1637
180 Ga0496119_0048683 3300048922 Bacteria 2627
181 Ga0496120_0034616 3300048923 Bacteria 3024
182 Ga0496120_0358910 3300048923 Bacteria 653
183 Ga0496120_0386495 3300048923 Bacteria 621
184 Ga0496124_0605384 3300048927 Bacteria 712
185 Ga0495678_000310 3300049459 Bacteria 52412
186 Ga0495678_156044 3300049459 Bacteria 733
187 Ga0501031_0005741 3300049568 Bacteria 8087
188 Ga0501031_0156820 3300049568 Bacteria 1488
189 Ga0501031_0196946 3300049568 Bacteria 1315
190 Ga0501031_0205390 3300049568 Bacteria 1285
191 Ga0501032_0000653 3300049569 Bacteria 28159
192 Ga0501032_0000928 3300049569 Bacteria 23702
193 Ga0501032_0063496 3300049569 Bacteria 2473
194 Ga0501032_0106186 3300049569 Bacteria 1860
195 Ga0501032_0326905 3300049569 Bacteria 989
196 Ga0501032_0359557 3300049569 Bacteria 937
197 Ga0501032_0571908 3300049569 Bacteria 720
198 Ga0501032_0889135 3300049569 Bacteria 561
199 Ga0501032_0904298 3300049569 Bacteria 556
200 Ga0501032_0962942 3300049569 Bacteria 536
201 Ga0501033_0000284 3300049570 Bacteria 48783
202 Ga0501033_0033256 3300049570 Bacteria 3872
203 Ga0501033_0064627 3300049570 Bacteria 2692
204 Ga0501033_0101535 3300049570 Bacteria 2098
205 Ga0501033_0113187 3300049570 Bacteria 1973
206 Ga0501033_0149137 3300049570 Bacteria 1688
207 Ga0501033_0237683 3300049570 Bacteria 1293
208 Ga0501033_0487957 3300049570 Bacteria 853
209 Ga0501033_0523614 3300049570 Bacteria 819
210 Ga0501033_1020829 3300049570 Bacteria 552
211 Ga0501034_0000094 3300049571 Bacteria 163124
212 Ga0501034_0000775 3300049571 Bacteria 47800
213 Ga0501034_0005338 3300049571 Bacteria 14077
214 Ga0501034_0036836 3300049571 Bacteria 4953
215 Ga0501034_0081334 3300049571 Bacteria 3242
216 Ga0501034_0106993 3300049571 Bacteria 2789
217 Ga0501034_0242759 3300049571 Bacteria 1747
218 Ga0501034_0250018 3300049571 Bacteria 1717
219 Ga0501034_0334425 3300049571 Bacteria 1446
220 Ga0501034_0566373 3300049571 Bacteria 1044
221 Ga0501034_0902329 3300049571 Bacteria 771
222 Ga0501034_1338770 3300049571 Bacteria 592
223 Ga0501034_1516412 3300049571 Bacteria 544
224 Ga0501036_0001342 3300049572 Bacteria 18915
225 Ga0501036_0630860 3300049572 Bacteria 888
226 Ga0501036_1106459 3300049572 Bacteria 647
227 Ga0501037_0000057 3300049573 Bacteria 107920
228 Ga0501037_0186681 3300049573 Bacteria 1469
229 Ga0501037_0357238 3300049573 Bacteria 1007
230 Ga0501037_0367806 3300049573 Bacteria 990
231 Ga0501037_0863786 3300049573 Bacteria 595
232 Ga0501037_1050438 3300049573 Bacteria 529
233 Ga0501038_0000218 3300049574 Bacteria 49144
234 Ga0501038_0000674 3300049574 Bacteria 30414
235 Ga0501038_0105419 3300049574 Bacteria 2342
236 Ga0501038_0567300 3300049574 Bacteria 862
237 Ga0501038_0605500 3300049574 Bacteria 828
238 Ga0501038_0971019 3300049574 Bacteria 625
239 Ga0501038_1254139 3300049574 Bacteria 537
240 Ga0501039_0000010 3300049575 Bacteria 247832
241 Ga0501039_0126598 3300049575 Bacteria 2004
242 Ga0501039_0159527 3300049575 Bacteria 1773
243 Ga0501039_0217450 3300049575 Bacteria 1502
244 Ga0501039_0360970 3300049575 Bacteria 1141
245 Ga0501039_0420913 3300049575 Bacteria 1049
246 Ga0501039_1107446 3300049575 Bacteria 614
247 Ga0501039_1425026 3300049575 Bacteria 533
248 Ga0501041_0207645 3300049577 Bacteria 1228
249 Ga0501042_0473349 3300049578 Bacteria 909
250 Ga0501042_0746944 3300049578 Bacteria 712
251 Ga0501042_0992463 3300049578 Bacteria 612
252 Ga0501043_0000040 3300049579 Bacteria 117024
253 Ga0501043_0170905 3300049579 Bacteria 1696
254 Ga0501043_0398336 3300049579 Bacteria 1040
255 Ga0501043_0449483 3300049579 Bacteria 968
256 Ga0501043_0463816 3300049579 Bacteria 950
257 Ga0501043_0499716 3300049579 Bacteria 909
258 Ga0501043_1017016 3300049579 Bacteria 589
259 Ga0501043_1025119 3300049579 Bacteria 586
260 Ga0501043_1271172 3300049579 Bacteria 514
261 Ga0501046_0141361 3300049580 Bacteria 1821
262 Ga0501046_0330630 3300049580 Bacteria 1109
263 Ga0501046_0461418 3300049580 Bacteria 913
264 Ga0501047_0004592 3300049581 Bacteria 12985
265 Ga0501047_0005890 3300049581 Bacteria 11534
266 Ga0501047_0049633 3300049581 Bacteria 4052
267 Ga0501047_0071696 3300049581 Bacteria 3334
268 Ga0501047_0221389 3300049581 Bacteria 1749
269 Ga0501047_0226924 3300049581 Bacteria 1722
270 Ga0501047_0317662 3300049581 Bacteria 1398
271 Ga0501047_0334975 3300049581 Bacteria 1351
272 Ga0501047_0417262 3300049581 Bacteria 1174
273 Ga0501047_0438380 3300049581 Bacteria 1137
274 Ga0501047_0462379 3300049581 Bacteria 1097
275 Ga0501047_0521344 3300049581 Bacteria 1014
276 Ga0501047_0542648 3300049581 Bacteria 987
277 Ga0501047_0603193 3300049581 Bacteria 919
278 Ga0501047_0940465 3300049581 Bacteria 677
279 Ga0501047_0981796 3300049581 Bacteria 658
280 Ga0501047_0994500 3300049581 Bacteria 652
281 Ga0501047_1086380 3300049581 Bacteria 613
282 Ga0501067_0229649 3300049583 Bacteria 1033
283 Ga0501067_0716391 3300049583 Bacteria 563
284 Ga0501068_0672848 3300049584 Bacteria 676
285 Ga0501069_0120606 3300049585 Bacteria 1498
286 Ga0501069_0415999 3300049585 Bacteria 797
287 Ga0501070_0055653 3300049586 Bacteria 3279
288 Ga0501070_0078199 3300049586 Bacteria 2738
289 Ga0501070_0239555 3300049586 Bacteria 1485
290 Ga0501070_0368825 3300049586 Bacteria 1164
291 Ga0501070_0384307 3300049586 Bacteria 1137
292 Ga0501070_1413532 3300049586 Bacteria 528
293 Ga0501072_0730202 3300049588 Bacteria 778
294 Ga0501073_0409653 3300049589 Bacteria 937
295 Ga0501073_1155696 3300049589 Bacteria 532
296 Ga0501076_1577695 3300049592 Bacteria 539
297 Ga0501249_000023 3300049679 Bacteria 92139
298 Ga0501079_0559354 3300049741 Bacteria 900
299 Ga0501080_0326158 3300049742 Bacteria 1389
300 Ga0501080_0499710 3300049742 Bacteria 1087
301 Ga0501080_0913022 3300049742 Bacteria 765
302 Ga0501080_0922413 3300049742 Bacteria 760
303 Ga0501080_1091948 3300049742 Bacteria 689
304 Ga0501083_0491897 3300049744 Bacteria 798
305 Ga0501267_015668 3300049764 Bacteria 804
306 Ga0501035_0000353 3300049822 Bacteria 52827
307 Ga0501035_0001360 3300049822 Bacteria 25163
308 Ga0501035_0001989 3300049822 Bacteria 20429
309 Ga0501035_0004392 3300049822 Bacteria 13382
310 Ga0501035_0080570 3300049822 Bacteria 2874
311 Ga0501035_0261976 3300049822 Bacteria 1465
312 Ga0501035_0262271 3300049822 Bacteria 1464
313 Ga0501035_0510505 3300049822 Bacteria 989
314 Ga0501035_0779181 3300049822 Bacteria 765
315 Ga0501035_0905748 3300049822 Bacteria 698
316 Ga0501035_1404285 3300049822 Bacteria 535
317 Ga0501044_0010980 3300049823 Bacteria 9832
318 Ga0501044_0014782 3300049823 Bacteria 8415
319 Ga0501044_0039369 3300049823 Bacteria 4932
320 Ga0501044_0041145 3300049823 Bacteria 4812
321 Ga0501044_0050109 3300049823 Bacteria 4310
322 Ga0501044_0243745 3300049823 Bacteria 1740
323 Ga0501044_0347714 3300049823 Bacteria 1403
324 Ga0501044_0525101 3300049823 Bacteria 1083
325 Ga0501044_0536426 3300049823 Bacteria 1068
326 Ga0501044_0960640 3300049823 Bacteria 727
327 Ga0501044_0963482 3300049823 Bacteria 726
328 Ga0501044_1514496 3300049823 Bacteria 536
329 Ga0501045_0220188 3300049824 Bacteria 1413
330 Ga0501204_059191 3300049850 Bacteria 606
331 nmdc:mga03683_563748_c1 3300050489 Bacteria 555
332 nmdc:mga03683_74975_c1 3300050489 Bacteria 1452
333 nmdc:mga03683_79512_c1 3300050489 Bacteria 679
334 nmdc:mga03n38_16736_c1 3300050490 Bacteria 2859
335 nmdc:mga00v17_1039291_c1 3300050491 Bacteria 515
336 nmdc:mga00v17_163819_c1 3300050491 Bacteria 1432
337 nmdc:mga00v17_88034_c1 3300050491 Bacteria 1947
338 nmdc:mga0yw44_116244_c1 3300050492 Bacteria 1719
339 nmdc:mga0yw44_1242_c1 3300050492 Bacteria 10009
340 nmdc:mga0yw44_290634_c1 3300050492 Bacteria 1094
341 nmdc:mga0yw44_347433_c1 3300050492 Bacteria 998
342 nmdc:mga0k408_596913_c1 3300050493 Bacteria 651
343 nmdc:mga06z11_10357_c1 3300050494 Bacteria 3970
344 nmdc:mga04h51_20868_c1 3300050495 Bacteria 1963
345 nmdc:mga07m45_131500_c1 3300050496 Bacteria 1448
346 nmdc:mga07m45_772036_c1 3300050496 Bacteria 551
347 nmdc:mga0sz30_164596_c1 3300050516 Bacteria 983
348 nmdc:mga0sz30_246538_c1 3300050516 Bacteria 795
349 Ga0500610_0026268 3300053079 Bacteria 2913
350 Ga0500583_0000079 3300053092 Bacteria 57526
351 Ga0500566_0183535 3300053094 Bacteria 1071
352 Ga0500616_0011945 3300053153 Bacteria 5104
353 Ga0500624_008199 3300053157 Bacteria 1458
354 Ga0500627_0027429 3300053158 Bacteria 2358
355 Ga0500636_0099996 3300053177 Bacteria 1650
356 Ga0500567_087385 3300053723 Bacteria 1329
357 2503200812 2503198000 Bacteria 6884444
358 2513593947 2513237087 Bacteria 5817514
359 2513608222 2513237090 Bacteria 7096802
360 2514037580 2513237164 Bacteria 7563725
361 2585281050 2582581308 Bacteria 7413247
362 2585553479 2585427530 Bacteria 7383882
363 2599936055 2599185301 Bacteria 6161860
364 2643813515 2643221558 Bacteria 5460675
365 2643855158 2643221568 Bacteria 5187270
366 2643917160 2643221582 Bacteria 5804683
367 2643985686 2643221595 Bacteria 6565519
368 2644132396 2643221623 Bacteria 5239945
369 2644747012 2643221736 Bacteria 6608466
370 2739348780 2738543031 Bacteria 5769731
371 2756677919 2756170246 Bacteria 7451806
372 2758642726 2758568016 Bacteria 5645291
373 2774871988 2773857925 Bacteria 6472445
374 2806053761 2802429634 Bacteria 7083200
375 2806060961 2802429635 Bacteria 7650140
376 2806066756 2802429636 Bacteria 7597525
377 2844004394 2844002411 Bacteria 7168230
378 2854913279 2854911287 Bacteria 5582813
379 2856343072 2856342000 Bacteria 7176905
380 2856360770 2856356410 Bacteria 6297484
381 2857349749 2857349434 Bacteria 7926032
382 2869257531 2869256925 Bacteria 6981691
383 2871443347 2871435913 Bacteria 6880295
384 2871457631 2871451962 Bacteria 7336357
385 2871491824 2871488783 Bacteria 6929816
386 2871498977 2871495908 Bacteria 6935695
387 2874104239 2874102143 Bacteria 6342645
388 2874171295 2874168670 Bacteria 8062617
389 2874173261 2874168670 Bacteria 8062617
390 2876374424 2876369609 Bacteria 6807521
391 2878037565 2878035449 Bacteria 6555736
392 2878739501 2878738818 Bacteria 7136951
393 2878755985 2878753008 Bacteria 6922523
394 2878763187 2878760144 Bacteria 6823465
395 2878770165 2878767105 Bacteria 6898628
396 2881153930 2881147464 Bacteria 7779814
397 2881163666 2881161766 Bacteria 7127907
398 2881856480 2881853255 Bacteria 6698367
399 2882460944 2882456835 Bacteria 6863978
400 2882638773 2882632389 Bacteria 8154593
401 2882918326 2882912400 Bacteria 6801539
402 2885311942 2885305155 Bacteria 7348390
403 2885324735 2885318864 Bacteria 6729568
404 2885330993 2885326080 Bacteria 7134805
405 2885335132 2885334103 Bacteria 7216818
406 2885341016 2885334103 Bacteria 7216818
407 2885347363 2885342637 Bacteria 7011821
408 2888339928 2888337043 Bacteria 6629336
409 2888341687 2888337043 Bacteria 6629336
410 2889011715 2889010040 Bacteria 6749192
411 2889919608 2889914905 Bacteria 5702301
412 2903506231 2903492973 Bacteria 13473544
413 2903543778 2903540706 Bacteria 7062119
414 2903769912 2903768456 Bacteria 9749579
415 2916015892 2916014648 Bacteria 6946486
416 2916019959 2916014648 Bacteria 6946486
417 2921270012 2921263974 Bacteria 6864552
418 2922152456 2922151315 Bacteria 6902399
419 2924755994 2924754689 Bacteria 6774424
420 2924777025 2924776078 Bacteria 7492003
421 2928521830 2928521798 Bacteria 4960112
422 2936386260 2936381700 Bacteria 7006523
423 2937003720 2937002841 Bacteria 6934057
424 2937843879 2937843397 Bacteria 5256375
425 2937880329 2937877337 Bacteria 7246526
426 2937997628 2937994558 Bacteria 7036190
427 2958087465 2958084443 Bacteria 7312792
428 2958093378 2958092219 Bacteria 6861151
429 2958097041 2958092219 Bacteria 6861151
430 2958100580 2958092219 Bacteria 6861151
431 2958151375 2958144490 Bacteria 6677056
432 2958168102 2958165035 Bacteria 6906348
433 2961132368 2961127735 Bacteria 7196641
434 2961166567 2961163497 Bacteria 6901077
435 2961174034 2961170736 Bacteria 7072258
436 2964629778 2964628898 Bacteria 7083044
437 2964638234 2964636051 Bacteria 7091832
438 2965021390 2965018300 Bacteria 6883036
439 2965064160 2965062239 Bacteria 7412989
440 2965115176 2965110997 Bacteria 6693150
441 2967672781 2967671571 Bacteria 7021409
442 2968005557 2968003550 Bacteria 6929263
443 2968120049 2968117919 Bacteria 6536078
444 2968174972 2968171901 Bacteria 6894245
445 2970049090 2970047711 Bacteria 7088379
446 2970506624 2970503327 Bacteria 7099517
447 2970558031 2970554993 Bacteria 6814252
448 2977825208 2977821940 Bacteria 6906439
449 2977833845 2977828996 Bacteria 7007971
450 2977869098 2977864932 Bacteria 7534097
451 2977944354 2977942078 Bacteria 7570577
452 2979800892 2979793036 Bacteria 6808957
453 2979811270 2979808191 Bacteria 7179355
454 2987636916 2987636660 Bacteria 8088555
455 2987659356 2987652177 Bacteria 6969023
456 2987662578 2987659509 Bacteria 6966464
457 2987676504 2987673487 Bacteria 6884027
458 2996350655 2996348954 Bacteria 7239054
459 2996393913 2996386984 Bacteria 6978667
460 3000142215 3000135777 Bacteria 6891109
461 3002142826 3002141150 Bacteria 5254435
462 3004191629 3004188549 Bacteria 6952365
463 3004204017 3004203850 Bacteria 7307914
464 3004277353 3004275668 Bacteria 7114440
465 637080639 637000159 Bacteria 7596297
466 8001847266 8001845381 Bacteria 5804942
467 8002288650 8002285264 Bacteria 6717907
468 8004377575 8004374579 Bacteria 6898112
469 8057532639 8057529695 Bacteria 6306553
470 Ga0207671_10218307
471 JGI24739J22299_10048356
472 JGI24739J22299_10052564
473 JGI24737J22298_10043794
474 JGI25153J46596_10115911
475 rootH1_10156210
476 rootH1_10245886
477 Ga0055542_1002360
478 Ga0055531_10011238
479 Ga0070658_10196170
480 Ga0070660_100024126
481 Ga0070660_100653808
482 Ga0070661_101771814
483 Ga0070659_101098568
484 Ga0070659_101991685
485 Ga0070667_100096022
486 Ga0070663_100448426
487 Ga0068853_100431987
488 Ga0068853_102274572
489 Ga0070665_100100075
490 Ga0068855_100648221
491 Ga0068854_100157186
492 Ga0068856_100019133
493 Ga0068852_100360895
494 Ga0075365_10000406
495 Ga0075365_10038868
496 Ga0075365_10878053
497 Ga0075368_10035893
498 Ga0075363_100006650
499 Ga0075364_10261215
500 Ga0075364_10566369
501 Ga0075362_10124683
502 Ga0075362_10141727
503 Ga0075362_10522358
504 Ga0075367_10005984
505 Ga0075369_10029135
506 Ga0075369_10109140
507 Ga0075369_10148605
508 Ga0075370_10077251
509 Ga0099826_10000025
510 Ga0099826_10000056
511 Ga0105240_10665094
512 Ga0105240_11495907
513 Ga0105245_11306699
514 Ga0105241_10132397
515 Ga0105237_10149094
516 Ga0105237_10153738
517 Ga0105237_10186678
518 Ga0105237_11657073
519 Ga0105238_10104323
520 Ga0105239_10025473
521 Ga0105239_10254485
522 Ga0105239_10321836
523 Ga0105239_11353127
524 Ga0157371_10000346
525 Ga0157370_10174149
526 Ga0157370_12007264
527 Ga0157369_10098962
528 Ga0157369_11098367
529 Ga0157369_12109005
530 Ga0171462_1052
531 Ga0157374_10094257
532 Ga0157374_12012723
533 Ga0163162_12846593
534 Ga0163163_10437548
535 Ga0182008_10009071
536 Ga0157379_10727090
537 Ga0157376_12059955
538 Ga0157376_12334850
539 Ga0182006_1015307
540 Ga0183365_10002
541 Ga0163161_11306785
542 Ga0209147_100709
543 Ga0209148_1000126
544 Ga0209233_1013012
545 Ga0209455_1000280
546 Ga0209758_1003275
547 Ga0209257_1000490
548 Ga0207647_10133278
549 Ga0207705_10124979
550 Ga0207654_10464732
551 Ga0207695_10307189
552 Ga0207695_11681766
553 Ga0207671_10395074
554 Ga0207671_10422428
555 Ga0207657_11165809
556 Ga0207694_10055093
557 Ga0207694_10117320
558 Ga0207690_10913262
559 Ga0207667_10594773
560 Ga0207667_11941128
561 Ga0207658_11265593
562 Ga0207639_10440568
563 Ga0207639_10891841
564 Ga0207678_10914904
565 Ga0207702_10122768
566 Ga0207702_11005676
567 Ga0207648_11653372
568 Ga0207698_10254799
569 Ga0209281_1002833
570 Ga0209282_1000084
571 Ga0209282_1000144
572 Ga0209282_1000192
573 Ga0209282_1000299
574 Ga0209813_10011111
575 Ga0268266_10086379
576 Ga0268266_10627072
577 Ga0265337_1119991
578 Ga0265326_10029936
579 Ga0265319_1007557
580 Ga0265334_10062325
581 Ga0265318_10020795
582 Ga0265323_10002302
583 Ga0265336_10000186
584 Ga0307515_10587239
585 Ga0265338_10000151
586 Ga0265328_10339932
587 Ga0307513_10004785
588 Ga0307513_10690877
589 Ga0307408_100011359
590 Ga0307405_11808145
591 Ga0307412_10003783
592 Ga0315914_1000129
593 Ga0315914_1001581
594 Ga0315914_1001714
595 Ga0307416_101768418
596 Ga0307416_103388733
597 Ga0315913_1000034
598 Ga0315913_1000553
599 Ga0315913_1000622
600 Ga0315915_1000066
601 Ga0395899_0000059
602 Ga0395899_0000107
603 Ga0395900_0000017
604 Ga0395900_0000101
605 Ga0395900_0090680
606 Ga0395898_0000030
607 Ga0395898_0000043
608 Ga0395905_0000056
609 Ga0395905_0000101
610 Ga0395905_0042700
611 Ga0395905_1039708
612 Ga0395905_1226131
613 Ga0395901_0000015
614 Ga0395901_0000068
615 Ga0395901_1111846
616 Ga0237819_21571
617 Ga0451843_0058967
618 Ga0451843_0937195
619 Ga0466971_0642114
620 Ga0451576_0143124
621 Ga0495638_0000720
622 Ga0495643_0000007
623 Ga0495643_0029242
624 Ga0495648_0000691
625 Ga0495648_0001199
626 Ga0495597_0147050
627 Ga0495633_0004664
628 Ga0495633_0192600
629 Ga0495611_0017715
630 Ga0495625_0002308
631 Ga0495625_0013390
632 Ga0495670_0001510
633 Ga0495670_0006110
634 Ga0495671_0000071
635 Ga0495589_0356765
636 Ga0495687_000136
637 Ga0496103_0969505
638 Ga0496104_0000035
639 Ga0496104_0249669
640 Ga0496105_0000029
641 Ga0496105_1016294
642 Ga0496108_0017597
643 Ga0496111_0197505
644 Ga0496112_0400943
645 Ga0496113_1034729
646 Ga0496114_1291781
647 Ga0496116_0063235
648 Ga0496118_0128035
649 Ga0496119_0048683
650 Ga0496120_0034616
651 Ga0496120_0358910
652 Ga0496120_0386495
653 Ga0496124_0605384
654 Ga0495678_000310
655 Ga0495678_156044
656 Ga0501031_0005741
657 Ga0501031_0156820
658 Ga0501031_0196946
659 Ga0501031_0205390
660 Ga0501032_0000653
661 Ga0501032_0000928
662 Ga0501032_0063496
663 Ga0501032_0106186
664 Ga0501032_0326905
665 Ga0501032_0359557
666 Ga0501032_0571908
667 Ga0501032_0889135
668 Ga0501032_0904298
669 Ga0501032_0962942
670 Ga0501033_0000284
671 Ga0501033_0033256
672 Ga0501033_0064627
673 Ga0501033_0101535
674 Ga0501033_0113187
675 Ga0501033_0149137
676 Ga0501033_0237683
677 Ga0501033_0487957
678 Ga0501033_0523614
679 Ga0501033_1020829
680 Ga0501034_0000094
681 Ga0501034_0000775
682 Ga0501034_0005338
683 Ga0501034_0036836
684 Ga0501034_0081334
685 Ga0501034_0106993
686 Ga0501034_0242759
687 Ga0501034_0250018
688 Ga0501034_0334425
689 Ga0501034_0566373
690 Ga0501034_0902329
691 Ga0501034_1338770
692 Ga0501034_1516412
693 Ga0501036_0001342
694 Ga0501036_0630860
695 Ga0501036_1106459
696 Ga0501037_0000057
697 Ga0501037_0186681
698 Ga0501037_0357238
699 Ga0501037_0367806
700 Ga0501037_0863786
701 Ga0501037_1050438
702 Ga0501038_0000218
703 Ga0501038_0000674
704 Ga0501038_0105419
705 Ga0501038_0567300
706 Ga0501038_0605500
707 Ga0501038_0971019
708 Ga0501038_1254139
709 Ga0501039_0000010
710 Ga0501039_0126598
711 Ga0501039_0159527
712 Ga0501039_0217450
713 Ga0501039_0360970
714 Ga0501039_0420913
715 Ga0501039_1107446
716 Ga0501039_1425026
717 Ga0501041_0207645
718 Ga0501042_0473349
719 Ga0501042_0746944
720 Ga0501042_0992463
721 Ga0501043_0000040
722 Ga0501043_0170905
723 Ga0501043_0398336
724 Ga0501043_0449483
725 Ga0501043_0463816
726 Ga0501043_0499716
727 Ga0501043_1017016
728 Ga0501043_1025119
729 Ga0501043_1271172
730 Ga0501046_0141361
731 Ga0501046_0330630
732 Ga0501046_0461418
733 Ga0501047_0004592
734 Ga0501047_0005890
735 Ga0501047_0049633
736 Ga0501047_0071696
737 Ga0501047_0221389
738 Ga0501047_0226924
739 Ga0501047_0317662
740 Ga0501047_0334975
741 Ga0501047_0417262
742 Ga0501047_0438380
743 Ga0501047_0462379
744 Ga0501047_0521344
745 Ga0501047_0542648
746 Ga0501047_0603193
747 Ga0501047_0940465
748 Ga0501047_0981796
749 Ga0501047_0994500
750 Ga0501047_1086380
751 Ga0501067_0229649
752 Ga0501067_0716391
753 Ga0501068_0672848
754 Ga0501069_0120606
755 Ga0501069_0415999
756 Ga0501070_0055653
757 Ga0501070_0078199
758 Ga0501070_0239555
759 Ga0501070_0368825
760 Ga0501070_0384307
761 Ga0501070_1413532
762 Ga0501072_0730202
763 Ga0501073_0409653
764 Ga0501073_1155696
765 Ga0501076_1577695
766 Ga0501249_000023
767 Ga0501079_0559354
768 Ga0501080_0326158
769 Ga0501080_0499710
770 Ga0501080_0913022
771 Ga0501080_0922413
772 Ga0501080_1091948
773 Ga0501083_0491897
774 Ga0501267_015668
775 Ga0501035_0000353
776 Ga0501035_0001360
777 Ga0501035_0001989
778 Ga0501035_0004392
779 Ga0501035_0080570
780 Ga0501035_0261976
781 Ga0501035_0262271
782 Ga0501035_0510505
783 Ga0501035_0779181
784 Ga0501035_0905748
785 Ga0501035_1404285
786 Ga0501044_0010980
787 Ga0501044_0014782
788 Ga0501044_0039369
789 Ga0501044_0041145
790 Ga0501044_0050109
791 Ga0501044_0243745
792 Ga0501044_0347714
793 Ga0501044_0525101
794 Ga0501044_0536426
795 Ga0501044_0960640
796 Ga0501044_0963482
797 Ga0501044_1514496
798 Ga0501045_0220188
799 Ga0501204_059191
800 nmdc:mga03683_563748_c1
801 nmdc:mga03683_74975_c1
802 nmdc:mga03683_79512_c1
803 nmdc:mga03n38_16736_c1
804 nmdc:mga00v17_1039291_c1
805 nmdc:mga00v17_163819_c1
806 nmdc:mga00v17_88034_c1
807 nmdc:mga0yw44_116244_c1
808 nmdc:mga0yw44_1242_c1
809 nmdc:mga0yw44_290634_c1
810 nmdc:mga0yw44_347433_c1
811 nmdc:mga0k408_596913_c1
812 nmdc:mga06z11_10357_c1
813 nmdc:mga04h51_20868_c1
814 nmdc:mga07m45_131500_c1
815 nmdc:mga07m45_772036_c1
816 nmdc:mga0sz30_164596_c1
817 nmdc:mga0sz30_246538_c1
818 Ga0500610_0026268
819 Ga0500583_0000079
820 Ga0500566_0183535
821 Ga0500616_0011945
822 Ga0500624_008199
823 Ga0500627_0027429
824 Ga0500636_0099996
825 Ga0500567_087385
826 2503200812
827 2513593947
828 2513608222
829 2514037580
830 2585281050
831 2585553479
832 2599936055
833 2643813515
834 2643855158
835 2643917160
836 2643985686
837 2644132396
838 2644747012
839 2739348780
840 2756677919
841 2758642726
842 2774871988
843 2806053761
844 2806060961
845 2806066756
846 2844004394
847 2854913279
848 2856343072
849 2856360770
850 2857349749
851 2869257531
852 2871443347
853 2871457631
854 2871491824
855 2871498977
856 2874104239
857 2874171295
858 2874173261
859 2876374424
860 2878037565
861 2878739501
862 2878755985
863 2878763187
864 2878770165
865 2881153930
866 2881163666
867 2881856480
868 2882460944
869 2882638773
870 2882918326
871 2885311942
872 2885324735
873 2885330993
874 2885335132
875 2885341016
876 2885347363
877 2888339928
878 2888341687
879 2889011715
880 2889919608
881 2903506231
882 2903543778
883 2903769912
884 2916015892
885 2916019959
886 2921270012
887 2922152456
888 2924755994
889 2924777025
890 2928521830
891 2936386260
892 2937003720
893 2937843879
894 2937880329
895 2937997628
896 2958087465
897 2958093378
898 2958097041
899 2958100580
900 2958151375
901 2958168102
902 2961132368
903 2961166567
904 2961174034
905 2964629778
906 2964638234
907 2965021390
908 2965064160
909 2965115176
910 2967672781
911 2968005557
912 2968120049
913 2968174972
914 2970049090
915 2970506624
916 2970558031
917 2977825208
918 2977833845
919 2977869098
920 2977944354
921 2979800892
922 2979811270
923 2987636916
924 2987659356
925 2987662578
926 2987676504
927 2996350655
928 2996393913
929 3000142215
930 3002142826
931 3004191629
932 3004204017
933 3004277353
934 637080639
935 8001847266
936 8002288650
937 8004377575
938 8057532639

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12728

HTH_17

Helix-turn-helix domain

12

63

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dgl-assembly1.cif.gz_C crystal structure of the rdfs excisionase 0.9556 12 61
8dgl-assembly1.cif.gz_B crystal structure of the rdfs excisionase 0.9504 12 61
5d8c-assembly1.cif.gz_A crystal structure of hinmlr, a merr family regulator lacking the sensor domain, bound to promoter dna 0.8452 11 64
5d90-assembly2.cif.gz_C crystal structure of hinmlr, a merr family regulator lacking the sensor domain, bound to promoter dna 0.8263 11 61
3gpv-assembly1.cif.gz_A crystal structure of a transcriptional regulator, merr family from bacillus thuringiensis 0.8221 11 60
ID Description Score Start End Superfamily
af_O53399_195_246_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9491 13 62 1.10.10.10
af_O53399_195_246_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8987 13 62 1.10.10.10
af_O53807_4_54_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.882 13 61 1.10.10.10
af_P9WKT7_24_74_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8479 13 62 1.10.10.10
5d8cA00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8452 11 64 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A1R1IPT8-F1-model_v4 DNA-binding protein 0.98 12 62 GO:0003677
AF-A0A420AX03-F1-model_v4 deleted 0.9739 7 61
AF-A0A7W6T9F2-F1-model_v4 DNA-binding protein 0.972 8 62
AF-A0A081R9G6-F1-model_v4 Excisionase family DNA binding domain-containing protein 0.9653 8 61
AF-A0A1Q3VBB9-F1-model_v4 DNA-binding protein 0.9601 9 61 GO:0003677

Map