F450231

General Info

Members Datasets Scaffolds Average Seq Length
469 256 469 368

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10018095|Ga0105238_100180957
Length 397
Sequence MPGKETEQIMSNIRVLVGTKKGAFVLTADGKRKDWKVSGPHFAGWEIYHLKGSVADPNRIYASQSSGWFGQIIQRSDDGGKTWNTPGSNAEELKGPEGMPKGESNKFVYEGKAGTHKWYDGSQHPWEFKRVWHIEPSLKDPDTAYAGVEDAALFKTTDGGKSWKELPGLRRTKGDLWQPGAGGMAVHTILLDPKNEKRIYVAISAGGAFRTDDGGKTWKPITRGLKSPYELPDPDAEVGHCVHRMALHPSRPDVLFMQKHWDVMRTDNAGDQWNEVSGDLPTDFGFPIDVHWHEPETIYVVPITSDSLHYPPEGKLRVYRSKTGGNEWEALTKGLPQKDCYVNVLRDAMAVDSLDKCGIYFGTTGGQVYCSADSGDSWNPIVRDLPPVYSVEVQTLR

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
110 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
111 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
112 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
127 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
137 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
138 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
139 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
140 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
145 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
190 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
197 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
225 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
226 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
227 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
228 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
229 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
230 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
231 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
232 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
233 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
234 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
235 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
236 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
237 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
238 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
239 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
240 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 0.21
Rhizosphere 98.08
Stem 0
Stem Tuber 0
Unclassified 1.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10156929 3300003320 Unclassified 4264
2 Ga0065712_10137581 3300005290 Bacteria 1482
3 Ga0065707_10097272 3300005295 Bacteria 3189
4 Ga0070676_10014994 3300005328 Bacteria 4267
5 Ga0070690_100002944 3300005330 Bacteria 9208
6 Ga0070690_100069004 3300005330 Bacteria 2294
7 Ga0070670_100001743 3300005331 Bacteria 17718
8 Ga0070666_10027760 3300005335 Bacteria 3709
9 Ga0070680_100037835 3300005336 Bacteria 3900
10 Ga0070689_100002853 3300005340 Bacteria 11362
11 Ga0070689_100006924 3300005340 Bacteria 7893
12 Ga0070689_100029236 3300005340 Bacteria 4169
13 Ga0070689_100109274 3300005340 Bacteria 2198
14 Ga0070689_100259455 3300005340 Bacteria 1436
15 Ga0070669_100053637 3300005353 Bacteria 2951
16 Ga0070671_100005632 3300005355 Bacteria 9969
17 Ga0070671_100007851 3300005355 Bacteria 8530
18 Ga0070671_100012342 3300005355 Bacteria 6879
19 Ga0070671_100075823 3300005355 Bacteria 2810
20 Ga0070674_100001544 3300005356 Bacteria 12317
21 Ga0070673_100000493 3300005364 Bacteria 21012
22 Ga0070673_100059339 3300005364 Bacteria 3028
23 Ga0070688_100001977 3300005365 Bacteria 10317
24 Ga0070688_100036789 3300005365 Bacteria 2979
25 Ga0070688_100104231 3300005365 Bacteria 1875
26 Ga0070667_100122717 3300005367 Bacteria 2261
27 Ga0070709_10002332 3300005434 Bacteria 10288
28 Ga0070714_100003430 3300005435 Bacteria 11808
29 Ga0070713_100009047 3300005436 Bacteria 7103
30 Ga0070713_100039520 3300005436 Bacteria 3830
31 Ga0070700_100094093 3300005441 Bacteria 1962
32 Ga0070708_100056684 3300005445 Bacteria 3486
33 Ga0070708_100081809 3300005445 Bacteria 2924
34 Ga0070678_100000262 3300005456 Bacteria 24331
35 Ga0070678_100072832 3300005456 Bacteria 2577
36 Ga0070662_100231638 3300005457 Bacteria 1478
37 Ga0070681_10003139 3300005458 Bacteria 15350
38 Ga0070681_10018087 3300005458 Bacteria 7045
39 Ga0070681_10057164 3300005458 Bacteria 3881
40 Ga0068867_100040855 3300005459 Bacteria 3388
41 Ga0070685_10008263 3300005466 Bacteria 5341
42 Ga0070706_100000846 3300005467 Bacteria 33705
43 Ga0070707_100000200 3300005468 Bacteria 60010
44 Ga0070707_100155005 3300005468 Bacteria 2231
45 Ga0070698_100017691 3300005471 Bacteria 7508
46 Ga0070698_100029339 3300005471 Bacteria 5710
47 Ga0070698_100041249 3300005471 Bacteria 4739
48 Ga0070698_100066852 3300005471 Bacteria 3616
49 Ga0070699_100017322 3300005518 Bacteria 6187
50 Ga0070699_100041654 3300005518 Bacteria 3975
51 Ga0070679_100014771 3300005530 Bacteria 7503
52 Ga0070697_100001769 3300005536 Bacteria 16484
53 Ga0070697_100035973 3300005536 Bacteria 3997
54 Ga0070672_100000158 3300005543 Bacteria 37514
55 Ga0070672_100026412 3300005543 Bacteria 4320
56 Ga0070686_100032226 3300005544 Bacteria 3211
57 Ga0070695_100154532 3300005545 Bacteria 1604
58 Ga0070665_100005728 3300005548 Bacteria 12755
59 Ga0070665_100012697 3300005548 Bacteria 8482
60 Ga0070704_100051359 3300005549 Bacteria 2903
61 Ga0068855_100006984 3300005563 Bacteria 13707
62 Ga0068855_100024466 3300005563 Bacteria 7224
63 Ga0068855_100140512 3300005563 Unclassified 2753
64 Ga0068856_100000232 3300005614 Bacteria 60382
65 Ga0068856_100009414 3300005614 Bacteria 9485
66 Ga0068856_100323953 3300005614 Bacteria 1558
67 Ga0068859_100013866 3300005617 Bacteria 8082
68 Ga0068858_100079118 3300005842 Bacteria 3055
69 Ga0068858_100135799 3300005842 Bacteria 2308
70 Ga0081539_10008324 3300005985 Bacteria 9069
71 Ga0070717_10064618 3300006028 Bacteria 3040
72 Ga0070717_10080143 3300006028 Bacteria 2739
73 Ga0070716_100003170 3300006173 Bacteria 7703
74 Ga0097621_100053315 3300006237 Bacteria 3297
75 Ga0097621_100126625 3300006237 Bacteria 2170
76 Ga0097621_100221130 3300006237 Bacteria 1650
77 Ga0068871_100033180 3300006358 Bacteria 4085
78 Ga0075428_100002950 3300006844 Bacteria 18546
79 Ga0075428_100011203 3300006844 Bacteria 9978
80 Ga0075428_100477835 3300006844 Bacteria 1334
81 Ga0075430_100026366 3300006846 Bacteria 4946
82 Ga0075430_100036343 3300006846 Bacteria 4177
83 Ga0075431_100053137 3300006847 Bacteria 4177
84 Ga0075431_100098589 3300006847 Bacteria 3017
85 Ga0075431_100136820 3300006847 Bacteria 2526
86 Ga0075433_10044410 3300006852 Bacteria 3861
87 Ga0075433_10110688 3300006852 Bacteria 2437
88 Ga0075434_100026555 3300006871 Bacteria 5674
89 Ga0075429_100003072 3300006880 Bacteria 14154
90 Ga0075436_100073539 3300006914 Bacteria 2366
91 Ga0075436_100215216 3300006914 Bacteria 1363
92 Ga0097620_100013866 3300006931 Bacteria 8082
93 Ga0075435_100019034 3300007076 Bacteria 5233
94 Ga0105240_10139047 3300009093 Bacteria 2905
95 Ga0111539_10127619 3300009094 Bacteria 2979
96 Ga0111539_10205709 3300009094 Bacteria 2294
97 Ga0114129_10004564 3300009147 Bacteria 19543
98 Ga0114129_10019462 3300009147 Bacteria 9666
99 Ga0114129_10027580 3300009147 Bacteria 8041
100 Ga0114129_10337446 3300009147 Bacteria 2000
101 Ga0105242_10023670 3300009176 Bacteria 4842
102 Ga0105248_10090442 3300009177 Bacteria 3447
103 Ga0105237_10000748 3300009545 Bacteria 44641
104 Ga0105238_10016176 3300009551 Bacteria 7549
105 Ga0105238_10018095 3300009551 Bacteria 7165
106 Ga0105238_10034378 3300009551 Bacteria 5157
107 Ga0105238_10050018 3300009551 Bacteria 4208
108 Ga0157374_10000179 3300013296 Bacteria 58866
109 Ga0157374_10003649 3300013296 Bacteria 12952
110 Ga0157374_10147843 3300013296 Bacteria 2283
111 Ga0157378_10042623 3300013297 Bacteria 4029
112 Ga0163162_10228585 3300013306 Bacteria 1991
113 Ga0157372_10012449 3300013307 Bacteria 9068
114 Ga0157375_10000044 3300013308 Bacteria 155953
115 Ga0157375_10007861 3300013308 Bacteria 9333
116 Ga0157375_10065274 3300013308 Bacteria 3628
117 Ga0163163_10062769 3300014325 Bacteria 3682
118 Ga0163163_10100001 3300014325 Bacteria 2922
119 Ga0163163_10222907 3300014325 Bacteria 1934
120 Ga0157376_10000422 3300014969 Bacteria 27522
121 Ga0157376_10126144 3300014969 Bacteria 2277
122 Ga0213872_10018028 3300021361 Bacteria 3257
123 Ga0213872_10114039 3300021361 Bacteria 1198
124 Ga0213876_10004304 3300021384 Bacteria 7979
125 Ga0207697_10003835 3300025315 Bacteria 7341
126 Ga0207688_10043128 3300025901 Bacteria 2512
127 Ga0207680_10015413 3300025903 Bacteria 3988
128 Ga0207645_10018062 3300025907 Bacteria 4649
129 Ga0207645_10019415 3300025907 Bacteria 4455
130 Ga0207684_10000363 3300025910 Bacteria 61249
131 Ga0207684_10042187 3300025910 Bacteria 3867
132 Ga0207684_10262891 3300025910 Bacteria 1489
133 Ga0207707_10161954 3300025912 Bacteria 1956
134 Ga0207707_10165544 3300025912 Bacteria 1932
135 Ga0207695_10025964 3300025913 Bacteria 6546
136 Ga0207695_10046527 3300025913 Bacteria 4599
137 Ga0207671_10000669 3300025914 Bacteria 44649
138 Ga0207663_10003010 3300025916 Bacteria 8152
139 Ga0207652_10019051 3300025921 Bacteria 5637
140 Ga0207646_10000032 3300025922 Bacteria 216397
141 Ga0207646_10055213 3300025922 Bacteria 3551
142 Ga0207646_10119461 3300025922 Bacteria 2368
143 Ga0207646_10355534 3300025922 Bacteria 1323
144 Ga0207681_10115811 3300025923 Bacteria 1957
145 Ga0207694_10003917 3300025924 Bacteria 11752
146 Ga0207650_10003332 3300025925 Bacteria 11053
147 Ga0207650_10058066 3300025925 Bacteria 2880
148 Ga0207650_10079826 3300025925 Bacteria 2479
149 Ga0207650_10228645 3300025925 Bacteria 1499
150 Ga0207659_10003858 3300025926 Bacteria 9038
151 Ga0207700_10030233 3300025928 Bacteria 3833
152 Ga0207700_10044066 3300025928 Bacteria 3282
153 Ga0207664_10002608 3300025929 Bacteria 11933
154 Ga0207686_10041464 3300025934 Bacteria 2807
155 Ga0207670_10000021 3300025936 Bacteria 155646
156 Ga0207670_10002728 3300025936 Bacteria 9293
157 Ga0207670_10003818 3300025936 Bacteria 8018
158 Ga0207670_10029627 3300025936 Bacteria 3488
159 Ga0207670_10087266 3300025936 Bacteria 2198
160 Ga0207669_10011817 3300025937 Bacteria 4266
161 Ga0207665_10004069 3300025939 Bacteria 9766
162 Ga0207665_10014685 3300025939 Bacteria 5153
163 Ga0207665_10089366 3300025939 Bacteria 2133
164 Ga0207691_10000059 3300025940 Bacteria 86972
165 Ga0207691_10022592 3300025940 Bacteria 5931
166 Ga0207667_10008825 3300025949 Bacteria 11933
167 Ga0207667_10118162 3300025949 Bacteria 2732
168 Ga0207651_10000965 3300025960 Bacteria 12708
169 Ga0207651_10104849 3300025960 Bacteria 2107
170 Ga0207651_10177146 3300025960 Bacteria 1687
171 Ga0207668_10322945 3300025972 Bacteria 1281
172 Ga0207658_10108904 3300025986 Bacteria 2186
173 Ga0207658_10173309 3300025986 Bacteria 1779
174 Ga0207703_10012804 3300026035 Bacteria 6539
175 Ga0207708_10072826 3300026075 Bacteria 2633
176 Ga0207702_10000263 3300026078 Bacteria 60391
177 Ga0207702_10015268 3300026078 Bacteria 6367
178 Ga0207641_10150179 3300026088 Bacteria 2110
179 Ga0207676_10302170 3300026095 Bacteria 1462
180 Ga0207674_10094777 3300026116 Bacteria 2971
181 Ga0207675_100000631 3300026118 Bacteria 34527
182 Ga0207683_10000270 3300026121 Bacteria 46366
183 Ga0207698_10299290 3300026142 Bacteria 1497
184 Ga0207428_10048308 3300027907 Bacteria 3414
185 Ga0207428_10184683 3300027907 Bacteria 1574
186 Ga0268266_10038125 3300028379 Bacteria 4092
187 Ga0268266_10316181 3300028379 Bacteria 1460
188 Ga0268265_10187344 3300028380 Bacteria 1784
189 Ga0265337_1000823 3300028556 Bacteria 16299
190 Ga0265337_1003808 3300028556 Bacteria 6414
191 Ga0265337_1014944 3300028556 Bacteria 2559
192 Ga0265337_1024727 3300028556 Bacteria 1833
193 Ga0265326_10005548 3300028558 Bacteria 3976
194 Ga0265319_1020576 3300028563 Bacteria 2441
195 Ga0265334_10007725 3300028573 Bacteria 4607
196 Ga0265338_10000038 3300028800 Bacteria 237195
197 Ga0265338_10000528 3300028800 Bacteria 67191
198 Ga0265338_10001068 3300028800 Bacteria 45548
199 Ga0265338_10001625 3300028800 Bacteria 35983
200 Ga0265338_10002046 3300028800 Bacteria 31179
201 Ga0265338_10002535 3300028800 Bacteria 27079
202 Ga0265338_10004555 3300028800 Bacteria 18659
203 Ga0265338_10004951 3300028800 Bacteria 17652
204 Ga0265338_10006496 3300028800 Bacteria 14868
205 Ga0265338_10011076 3300028800 Bacteria 10460
206 Ga0265338_10017012 3300028800 Bacteria 7864
207 Ga0265338_10025363 3300028800 Bacteria 6019
208 Ga0265338_10027933 3300028800 Bacteria 5646
209 Ga0265338_10030554 3300028800 Bacteria 5304
210 Ga0265338_10041793 3300028800 Bacteria 4282
211 Ga0265338_10071295 3300028800 Bacteria 2974
212 Ga0265338_10085662 3300028800 Bacteria 2625
213 Ga0265338_10088828 3300028800 Bacteria 2563
214 Ga0265338_10090151 3300028800 Bacteria 2538
215 Ga0265338_10151108 3300028800 Bacteria 1804
216 Ga0265338_10172128 3300028800 Bacteria 1659
217 Ga0265338_10203882 3300028800 Bacteria 1489
218 Ga0265324_10000268 3300029957 Bacteria 38429
219 Ga0265324_10014011 3300029957 Bacteria 2977
220 Ga0265324_10019003 3300029957 Bacteria 2477
221 Ga0265324_10026686 3300029957 Bacteria 2044
222 Ga0265330_10000153 3300031235 Bacteria 55577
223 Ga0265330_10053073 3300031235 Bacteria 1775
224 Ga0265328_10027389 3300031239 Bacteria 2136
225 Ga0265320_10000676 3300031240 Bacteria 25946
226 Ga0265320_10012855 3300031240 Bacteria 4843
227 Ga0265320_10101139 3300031240 Bacteria 1327
228 Ga0265329_10000748 3300031242 Bacteria 16524
229 Ga0265340_10001564 3300031247 Bacteria 13151
230 Ga0265339_10081483 3300031249 Bacteria 1710
231 Ga0265327_10000215 3300031251 Bacteria 119243
232 Ga0265327_10006819 3300031251 Bacteria 9002
233 Ga0265316_10076677 3300031344 Bacteria 2568
234 Ga0307408_100146548 3300031548 Bacteria 1859
235 Ga0307408_100189252 3300031548 Bacteria 1657
236 Ga0265313_10011290 3300031595 Bacteria 5563
237 Ga0265313_10081599 3300031595 Bacteria 1468
238 Ga0265314_10000466 3300031711 Bacteria 53895
239 Ga0265314_10019772 3300031711 Bacteria 5207
240 Ga0265314_10051654 3300031711 Bacteria 2862
241 Ga0265342_10018779 3300031712 Bacteria 4469
242 Ga0316576_10035276 3300031727 Bacteria 3570
243 Ga0307405_10080032 3300031731 Bacteria 2132
244 Ga0307405_10200819 3300031731 Bacteria 1448
245 Ga0316577_10032636 3300031733 Bacteria 2909
246 Ga0307410_10013245 3300031852 Bacteria 4803
247 Ga0307409_100029323 3300031995 Bacteria 3936
248 Ga0307409_100286209 3300031995 Bacteria 1526
249 Ga0307416_100338559 3300032002 Bacteria 1516
250 Ga0307414_10059014 3300032004 Bacteria 2707
251 Ga0307414_10070509 3300032004 Bacteria 2517
252 Ga0307414_10073130 3300032004 Bacteria 2479
253 Ga0307414_10088883 3300032004 Bacteria 2288
254 Ga0307414_10112496 3300032004 Bacteria 2076
255 Ga0307411_10183559 3300032005 Bacteria 1590
256 Ga0307415_100018397 3300032126 Bacteria 4219
257 Ga0373930_0014211 3300034816 Bacteria 1478
258 Ga0373950_0001966 3300034818 Bacteria 2779
259 Ga0373926_0013267 3300035083 Bacteria 2793
260 Ga0373929_0000998 3300035085 Bacteria 5484
261 Ga0373944_0005058 3300035089 Bacteria 3459
262 Ga0373949_0003077 3300035090 Bacteria 4076
263 Ga0373951_0013169 3300035091 Bacteria 1859
264 Ga0373932_0000006 3300035112 Bacteria 208547
265 Ga0373945_0013206 3300035116 Bacteria 2753
266 Ga0373953_0022180 3300035117 Bacteria 2392
267 Ga0373954_0007675 3300035118 Bacteria 4724
268 Ga0373943_0027007 3300035170 Bacteria 2694
269 Ga0373931_0000009 3300035691 Bacteria 349854
270 Ga0373935_0017087 3300035692 Bacteria 4395
271 Ga0373935_0096860 3300035692 Bacteria 1940
272 Ga0373927_0000779 3300035695 Bacteria 24308
273 Ga0373927_0023279 3300035695 Bacteria 4057
274 Ga0373947_0006717 3300035725 Bacteria 6674
275 Ga0373947_0007395 3300035725 Bacteria 6359
276 Ga0373947_0018075 3300035725 Bacteria 4057
277 Ga0373937_0053020 3300036401 Bacteria 3720
278 Ga0373937_0179842 3300036401 Bacteria 1986
279 Ga0373937_0434791 3300036401 Bacteria 1246
280 Ga0373925_0000235 3300037068 Bacteria 58451
281 Ga0373925_0002783 3300037068 Bacteria 13812
282 Ga0373925_0008470 3300037068 Bacteria 7495
283 Ga0373925_0044354 3300037068 Bacteria 3302
284 Ga0395899_0000009 3300037312 Bacteria 538632
285 Ga0395898_0000170 3300037466 Bacteria 168466
286 Ga0395905_0190792 3300037471 Bacteria 1922
287 Ga0436364_0970769 3300037853 Bacteria 4061
288 Ga0436364_1418190 3300037853 Bacteria 2869
289 Ga0395901_0156019 3300038443 Bacteria 2398
290 Ga0436365_1092468 3300039437 Bacteria 11894
291 Ga0436365_1275285 3300039437 Bacteria 1407
292 Ga0436365_1843842 3300039437 Bacteria 15210
293 Ga0436360_0031428 3300039438 Bacteria 13001
294 Ga0436360_0040768 3300039438 Unclassified 3411
295 Ga0436360_1211500 3300039438 Bacteria 1800
296 Ga0436360_1375459 3300039438 Bacteria 1794
297 Ga0436361_0148993 3300039447 Unclassified 1602
298 Ga0436361_0342665 3300039447 Bacteria 2816
299 Ga0436361_0908487 3300039447 Unclassified 1591
300 Ga0436361_1009635 3300039447 Bacteria 1647
301 Ga0436361_1053813 3300039447 Bacteria 14448
302 Ga0439437_003764 3300042000 Bacteria 1639
303 Ga0451577_0002005 3300042876 Bacteria 25323
304 Ga0451577_0008063 3300042876 Bacteria 10275
305 Ga0451577_0092149 3300042876 Bacteria 2706
306 Ga0451577_0109967 3300042876 Bacteria 2465
307 Ga0451577_0163225 3300042876 Bacteria 2007
308 Ga0453683_0052130 3300044673 Bacteria 2562
309 Ga0453683_0171643 3300044673 Bacteria 1374
310 Ga0453684_0004567 3300044712 Bacteria 28938
311 Ga0453684_0011981 3300044712 Bacteria 14423
312 Ga0453684_0012039 3300044712 Bacteria 14376
313 Ga0453684_0053752 3300044712 Bacteria 5254
314 Ga0453684_0082064 3300044712 Bacteria 4018
315 Ga0453684_0397427 3300044712 Bacteria 1544
316 Ga0466957_0017077 3300044842 Bacteria 4247
317 Ga0451576_0008888 3300045051 Bacteria 11724
318 Ga0451576_0062672 3300045051 Bacteria 3876
319 Ga0451576_0143398 3300045051 Bacteria 2491
320 Ga0451576_0331011 3300045051 Bacteria 1594
321 Ga0495592_0000006 3300046454 Bacteria 192981
322 Ga0495592_0123307 3300046454 Bacteria 1821
323 Ga0495629_0053815 3300046459 Bacteria 2815
324 Ga0495651_0006432 3300046462 Bacteria 8987
325 Ga0495639_0056649 3300046475 Bacteria 1790
326 Ga0495639_0065676 3300046475 Bacteria 1669
327 Ga0495662_0003146 3300046476 Bacteria 8326
328 Ga0495664_0003002 3300046477 Bacteria 9124
329 Ga0495664_0017720 3300046477 Bacteria 4072
330 Ga0495594_0002090 3300046499 Bacteria 10396
331 Ga0495618_0060093 3300046514 Bacteria 2409
332 Ga0495628_0000138 3300046516 Bacteria 62238
333 Ga0495628_0011626 3300046516 Bacteria 7441
334 Ga0495628_0076523 3300046516 Bacteria 2604
335 Ga0495630_0000019 3300046517 Bacteria 182603
336 Ga0495630_0031673 3300046517 Bacteria 3938
337 Ga0495630_0040776 3300046517 Bacteria 3469
338 Ga0495630_0042819 3300046517 Bacteria 3381
339 Ga0495630_0178028 3300046517 Bacteria 1621
340 Ga0495666_0013823 3300046526 Bacteria 4025
341 Ga0495666_0030681 3300046526 Bacteria 2636
342 Ga0495666_0053589 3300046526 Bacteria 1935
343 Ga0495652_0111393 3300046529 Bacteria 2201
344 Ga0495665_0097884 3300046531 Bacteria 1540
345 Ga0495640_0004852 3300046533 Bacteria 10700
346 Ga0495640_0052486 3300046533 Bacteria 2800
347 Ga0495640_0089905 3300046533 Bacteria 2027
348 Ga0495586_0000035 3300046535 Bacteria 86593
349 Ga0495586_0008029 3300046535 Bacteria 5630
350 Ga0495645_0001260 3300046543 Bacteria 17245
351 Ga0495645_0009625 3300046543 Bacteria 6756
352 Ga0495622_0019079 3300046557 Bacteria 3194
353 Ga0495667_0190898 3300046559 Bacteria 1313
354 Ga0495634_0023036 3300046642 Bacteria 4383
355 Ga0495634_0120332 3300046642 Bacteria 1681
356 Ga0495635_0004319 3300046663 Bacteria 9840
357 Ga0495599_0002418 3300046678 Bacteria 10870
358 Ga0495599_0105630 3300046678 Bacteria 1754
359 Ga0495646_0042216 3300046680 Bacteria 2799
360 Ga0495647_0096273 3300046681 Bacteria 1220
361 Ga0495658_0006097 3300046683 Bacteria 5920
362 Ga0495613_0132281 3300046689 Bacteria 1786
363 Ga0495624_0044394 3300046690 Bacteria 2833
364 Ga0495624_0090465 3300046690 Bacteria 1888
365 Ga0495581_0072582 3300047315 Bacteria 1991
366 Ga0495674_0000719 3300047319 Bacteria 31300
367 Ga0495674_0001167 3300047319 Bacteria 25336
368 Ga0495674_0215904 3300047319 Bacteria 1587
369 Ga0495676_0115651 3300047321 Bacteria 1961
370 Ga0495676_0251956 3300047321 Bacteria 1204
371 Ga0495680_0009820 3300047322 Bacteria 8582
372 Ga0495680_0018790 3300047322 Bacteria 5858
373 Ga0495675_0058592 3300047444 Bacteria 2442
374 Ga0495675_0088383 3300047444 Bacteria 1946
375 Ga0495675_0101079 3300047444 Bacteria 1805
376 Ga0495602_0084939 3300048088 Bacteria 2647
377 Ga0495614_0021917 3300048089 Bacteria 2758
378 Ga0496107_0048627 3300048910 Bacteria 3056
379 Ga0501302_000564 3300049525 Bacteria 1980
380 Ga0501031_0000631 3300049568 Bacteria 20805
381 Ga0501031_0002585 3300049568 Bacteria 11541
382 Ga0501031_0013686 3300049568 Bacteria 5286
383 Ga0501032_0002706 3300049569 Bacteria 13828
384 Ga0501032_0027950 3300049569 Bacteria 3876
385 Ga0501033_0003368 3300049570 Bacteria 13186
386 Ga0501034_0005449 3300049571 Bacteria 13898
387 Ga0501034_0290640 3300049571 Bacteria 1573
388 Ga0501036_0218524 3300049572 Unclassified 1600
389 Ga0501037_0028480 3300049573 Bacteria 4126
390 Ga0501038_0005671 3300049574 Bacteria 11580
391 Ga0501038_0088860 3300049574 Bacteria 2593
392 Ga0501039_0000579 3300049575 Bacteria 26468
393 Ga0501039_0012191 3300049575 Bacteria 6553
394 Ga0501039_0060864 3300049575 Bacteria 2923
395 Ga0501039_0082026 3300049575 Bacteria 2510
396 Ga0501040_0050615 3300049576 Bacteria 2842
397 Ga0501040_0079367 3300049576 Unclassified 2272
398 Ga0501040_0103893 3300049576 Bacteria 1984
399 Ga0501041_0004876 3300049577 Bacteria 7795
400 Ga0501041_0006786 3300049577 Bacteria 6710
401 Ga0501041_0081400 3300049577 Bacteria 1994
402 Ga0501042_0013309 3300049578 Bacteria 5596
403 Ga0501042_0051433 3300049578 Bacteria 2938
404 Ga0501043_0000457 3300049579 Bacteria 36418
405 Ga0501043_0001534 3300049579 Bacteria 20158
406 Ga0501043_0036500 3300049579 Bacteria 3867
407 Ga0501046_0001876 3300049580 Bacteria 20005
408 Ga0501046_0015390 3300049580 Bacteria 6429
409 Ga0501046_0050115 3300049580 Bacteria 3299
410 Ga0501046_0211836 3300049580 Bacteria 1438
411 Ga0501047_0001057 3300049581 Bacteria 27460
412 Ga0501048_0018613 3300049582 Bacteria 5106
413 Ga0501048_0114150 3300049582 Bacteria 1908
414 Ga0501070_0000675 3300049586 Bacteria 31473
415 Ga0501071_0039999 3300049587 Bacteria 3356
416 Ga0501072_0023816 3300049588 Bacteria 4757
417 Ga0501075_0001811 3300049591 Bacteria 14079
418 Ga0501076_0223167 3300049592 Unclassified 1540
419 Ga0501077_0058599 3300049593 Bacteria 2445
420 Ga0501077_0089783 3300049593 Bacteria 1947
421 Ga0501198_001741 3300049649 Bacteria 2870
422 Ga0501202_000219 3300049652 Bacteria 7484
423 Ga0501206_000236 3300049653 Bacteria 6504
424 Ga0501207_001381 3300049654 Bacteria 3022
425 Ga0501235_000741 3300049669 Bacteria 6659
426 Ga0501240_001287 3300049673 Bacteria 2401
427 Ga0501247_000747 3300049677 Bacteria 2799
428 Ga0501251_000054 3300049681 Bacteria 8543
429 Ga0501257_002561 3300049686 Bacteria 3830
430 Ga0501260_000007 3300049689 Bacteria 14014
431 Ga0501261_000142 3300049690 Bacteria 10454
432 Ga0501219_000233 3300049703 Bacteria 10596
433 Ga0501225_0000580 3300049705 Bacteria 11434
434 Ga0501234_000680 3300049707 Bacteria 5253
435 Ga0501245_000494 3300049708 Bacteria 4784
436 Ga0501271_000261 3300049768 Bacteria 4470
437 Ga0501272_000482 3300049769 Bacteria 3526
438 Ga0501035_0000002 3300049822 Bacteria 585447
439 Ga0501035_0004846 3300049822 Bacteria 12760
440 Ga0501035_0027702 3300049822 Bacteria 5179
441 Ga0501035_0040425 3300049822 Bacteria 4214
442 Ga0501035_0085545 3300049822 Bacteria 2779
443 Ga0501035_0215673 3300049822 Bacteria 1641
444 Ga0501044_0000442 3300049823 Bacteria 50741
445 Ga0501044_0007071 3300049823 Bacteria 12351
446 Ga0501045_0047323 3300049824 Bacteria 3133
447 Ga0501226_000396 3300049853 Bacteria 6297
448 nmdc:mga05p37_174928_c1 3300050507 Bacteria 2616
449 nmdc:mga05p37_202870_c1 3300050507 Bacteria 1769
450 nmdc:mga05p37_24287_c1 3300050507 Bacteria 7365
451 nmdc:mga05p37_321924_c1 3300050507 Bacteria 1830
452 nmdc:mga05p37_677_c1 3300050507 Bacteria 37713
453 nmdc:mga05p37_83288_c1 3300050507 Bacteria 3940
454 nmdc:mga09592_2699_c1 3300050508 Bacteria 14350
455 nmdc:mga0qj67_45433_c1 3300050509 Bacteria 3466
456 nmdc:mga0qj67_9089_c1 3300050509 Bacteria 7376
457 nmdc:mga06r32_14191_c1 3300050510 Bacteria 7227
458 nmdc:mga06r32_5924_c1 3300050510 Bacteria 11003
459 nmdc:mga06r32_9119_c1 3300050510 Bacteria 8944
460 nmdc:mga08y16_126451_c1 3300050511 Bacteria 2659
461 nmdc:mga08y16_134648_c1 3300050511 Bacteria 2568
462 nmdc:mga0n895_183585_c1 3300050512 Bacteria 2123
463 nmdc:mga0rr50_120076_c1 3300050513 Bacteria 2091
464 nmdc:mga08x19_204015_c1 3300050514 Bacteria 1356
465 nmdc:mga0a205_18153_c1 3300050515 Bacteria 6608
466 nmdc:mga0a205_209975_c1 3300050515 Bacteria 1835
467 Ga0495619_0058624 3300053085 Bacteria 2556
468 Ga0500616_0007795 3300053153 Bacteria 6752
469 Ga0530510_0034073 3300061734 Bacteria 3668

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047321 Ga0495676_0251956 Ga0495676_0251956_133_1182 279
2 3300046681 Ga0495647_0096273 Ga0495647_0096273_123_1163 284
3 3300049708 Ga0501245_000494 Ga0501245_000494_3674_4738 287
4 3300037471 Ga0395905_0190792 Ga0395905_0190792_20_1069 289
5 3300038443 Ga0395901_0156019 Ga0395901_0156019_21_1070 289
6 3300039438 Ga0436360_1375459 Ga0436360_1375459_41_1108 292
7 3300049593 Ga0501077_0089783 Ga0501077_0089783_827_1915 294
8 3300028800 Ga0265338_10004951 Ga0265338_100049513 299
9 3300046529 Ga0495652_0111393 Ga0495652_0111393_1040_2134 302
10 3300013307 Ga0157372_10012449 Ga0157372_1001244910 307
11 3300039437 Ga0436365_1843842 Ga0436365_1843842_10711_11811 307
12 3300046454 Ga0495592_0123307 Ga0495592_0123307_519_1634 307
13 3300046477 Ga0495664_0003002 Ga0495664_0003002_164_1279 307
14 3300046516 Ga0495628_0011626 Ga0495628_0011626_35_1150 307
15 3300046516 Ga0495628_0076523 Ga0495628_0076523_1061_2176 307
16 3300046543 Ga0495645_0001260 Ga0495645_0001260_270_1385 307
17 3300046642 Ga0495634_0120332 Ga0495634_0120332_130_1245 307
18 3300046680 Ga0495646_0042216 Ga0495646_0042216_1554_2669 307
19 3300047315 Ga0495581_0072582 Ga0495581_0072582_131_1246 307
20 3300048088 Ga0495602_0084939 Ga0495602_0084939_395_1510 307
21 3300005290 Ga0065712_10137581 Ga0065712_101375811 308
22 3300005331 Ga0070670_100001743 Ga0070670_1000017434 308
23 3300005335 Ga0070666_10027760 Ga0070666_100277602 308
24 3300005340 Ga0070689_100006924 Ga0070689_1000069246 308
25 3300005355 Ga0070671_100012342 Ga0070671_1000123425 308
26 3300005364 Ga0070673_100059339 Ga0070673_1000593393 308
27 3300005365 Ga0070688_100001977 Ga0070688_1000019772 308
28 3300005456 Ga0070678_100072832 Ga0070678_1000728323 308
29 3300005466 Ga0070685_10008263 Ga0070685_100082633 308
30 3300005544 Ga0070686_100032226 Ga0070686_1000322264 308
31 3300005549 Ga0070704_100051359 Ga0070704_1000513591 308
32 3300005842 Ga0068858_100135799 Ga0068858_1001357993 308
33 3300006358 Ga0068871_100033180 Ga0068871_1000331801 308
34 3300006871 Ga0075434_100026555 Ga0075434_1000265556 308
35 3300007076 Ga0075435_100019034 Ga0075435_1000190343 308
36 3300009147 Ga0114129_10004564 Ga0114129_100045648 308
37 3300013296 Ga0157374_10003649 Ga0157374_1000364912 308
38 3300013306 Ga0163162_10228585 Ga0163162_102285852 308
39 3300014325 Ga0163163_10222907 Ga0163163_102229072 308
40 3300021361 Ga0213872_10114039 Ga0213872_101140391 308
41 3300025910 Ga0207684_10042187 Ga0207684_100421873 308
42 3300025925 Ga0207650_10003332 Ga0207650_1000333211 308
43 3300025936 Ga0207670_10002728 Ga0207670_100027288 308
44 3300025949 Ga0207667_10118162 Ga0207667_101181622 308
45 3300025960 Ga0207651_10104849 Ga0207651_101048492 308
46 3300026088 Ga0207641_10150179 Ga0207641_101501792 308
47 3300026118 Ga0207675_100000631 Ga0207675_10000063121 308
48 3300028800 Ga0265338_10030554 Ga0265338_100305545 308
49 3300031995 Ga0307409_100286209 Ga0307409_1002862092 308
50 3300032004 Ga0307414_10070509 Ga0307414_100705092 308
51 3300032005 Ga0307411_10183559 Ga0307411_101835592 308
52 3300036401 Ga0373937_0053020 Ga0373937_0053020_158_1321 308
53 3300036401 Ga0373937_0179842 Ga0373937_0179842_73_1188 308
54 3300039438 Ga0436360_0031428 Ga0436360_0031428_11500_12615 308
55 3300039438 Ga0436360_1211500 Ga0436360_1211500_201_1313 308
56 3300039447 Ga0436361_0148993 Ga0436361_0148993_319_1431 308
57 3300039447 Ga0436361_0908487 Ga0436361_0908487_95_1210 308
58 3300042876 Ga0451577_0002005 Ga0451577_0002005_21972_23087 308
59 3300044673 Ga0453683_0171643 Ga0453683_0171643_59_1174 308
60 3300044712 Ga0453684_0004567 Ga0453684_0004567_3614_4729 308
61 3300044712 Ga0453684_0011981 Ga0453684_0011981_2233_3348 308
62 3300044712 Ga0453684_0012039 Ga0453684_0012039_7363_8517 308
63 3300050507 nmdc:mga05p37_677_c1 nmdc:mga05p37_677_c1_23461_24576 308
64 3300050513 nmdc:mga0rr50_120076_c1 nmdc:mga0rr50_120076_c1_458_1573 308
65 3300005353 Ga0070669_100053637 Ga0070669_1000536373 309
66 3300005355 Ga0070671_100005632 Ga0070671_1000056325 309
67 3300005355 Ga0070671_100007851 Ga0070671_1000078513 309
68 3300005367 Ga0070667_100122717 Ga0070667_1001227173 309
69 3300005434 Ga0070709_10002332 Ga0070709_100023326 309
70 3300005436 Ga0070713_100039520 Ga0070713_1000395203 309
71 3300005543 Ga0070672_100026412 Ga0070672_1000264123 309
72 3300005548 Ga0070665_100012697 Ga0070665_1000126973 309
73 3300005842 Ga0068858_100079118 Ga0068858_1000791183 309
74 3300006173 Ga0070716_100003170 Ga0070716_1000031704 309
75 3300006914 Ga0075436_100073539 Ga0075436_1000735392 309
76 3300009094 Ga0111539_10127619 Ga0111539_101276193 309
77 3300009545 Ga0105237_10000748 Ga0105237_1000074835 309
78 3300009551 Ga0105238_10034378 Ga0105238_100343787 309
79 3300013296 Ga0157374_10147843 Ga0157374_101478433 309
80 3300013308 Ga0157375_10065274 Ga0157375_100652743 309
81 3300014969 Ga0157376_10126144 Ga0157376_101261443 309
82 3300021361 Ga0213872_10018028 Ga0213872_100180281 309
83 3300025315 Ga0207697_10003835 Ga0207697_100038354 309
84 3300025901 Ga0207688_10043128 Ga0207688_100431282 309
85 3300025907 Ga0207645_10019415 Ga0207645_100194153 309
86 3300025910 Ga0207684_10262891 Ga0207684_102628911 309
87 3300025914 Ga0207671_10000669 Ga0207671_1000066935 309
88 3300025923 Ga0207681_10115811 Ga0207681_101158112 309
89 3300025925 Ga0207650_10228645 Ga0207650_102286452 309
90 3300025928 Ga0207700_10030233 Ga0207700_100302333 309
91 3300025939 Ga0207665_10014685 Ga0207665_100146853 309
92 3300025940 Ga0207691_10022592 Ga0207691_100225922 309
93 3300025960 Ga0207651_10177146 Ga0207651_101771462 309
94 3300025972 Ga0207668_10322945 Ga0207668_103229452 309
95 3300025986 Ga0207658_10173309 Ga0207658_101733092 309
96 3300027907 Ga0207428_10184683 Ga0207428_101846832 309
97 3300028379 Ga0268266_10038125 Ga0268266_100381254 309
98 3300031995 Ga0307409_100029323 Ga0307409_1000293235 309
99 3300032004 Ga0307414_10059014 Ga0307414_100590142 309
100 3300037853 Ga0436364_0970769 Ga0436364_0970769_859_1974 309
101 3300039438 Ga0436360_0040768 Ga0436360_0040768_1374_2489 309
102 3300039447 Ga0436361_0342665 Ga0436361_0342665_1653_2768 309
103 3300039447 Ga0436361_1009635 Ga0436361_1009635_395_1510 309
104 3300039447 Ga0436361_1053813 Ga0436361_1053813_8709_9875 309
105 3300042876 Ga0451577_0163225 Ga0451577_0163225_780_1895 309
106 3300044712 Ga0453684_0082064 Ga0453684_0082064_1291_2406 309
107 3300045051 Ga0451576_0143398 Ga0451576_0143398_342_1457 309
108 3300046462 Ga0495651_0006432 Ga0495651_0006432_6384_7499 309
109 3300046517 Ga0495630_0000019 Ga0495630_0000019_179893_181008 309
110 3300046526 Ga0495666_0013823 Ga0495666_0013823_94_1209 309
111 3300046531 Ga0495665_0097884 Ga0495665_0097884_249_1364 309
112 3300046533 Ga0495640_0089905 Ga0495640_0089905_503_1618 309
113 3300046535 Ga0495586_0000035 Ga0495586_0000035_34141_35256 309
114 3300046683 Ga0495658_0006097 Ga0495658_0006097_3689_4804 309
115 3300047319 Ga0495674_0000719 Ga0495674_0000719_17879_18994 309
116 3300049576 Ga0501040_0050615 Ga0501040_0050615_675_1793 309
117 3300049577 Ga0501041_0081400 Ga0501041_0081400_193_1311 309
118 3300049580 Ga0501046_0211836 Ga0501046_0211836_218_1336 309
119 3300049588 Ga0501072_0023816 Ga0501072_0023816_498_1616 309
120 3300049591 Ga0501075_0001811 Ga0501075_0001811_25_1143 309
121 3300049593 Ga0501077_0058599 Ga0501077_0058599_82_1200 309
122 3300049823 Ga0501044_0007071 Ga0501044_0007071_7706_8878 309
123 3300050511 nmdc:mga08y16_126451_c1 nmdc:mga08y16_126451_c1_1163_2278 309
124 3300061734 Ga0530510_0034073 Ga0530510_0034073_532_1650 309
125 3300025936 Ga0207670_10000021 Ga0207670_1000002198 310
126 3300025939 Ga0207665_10004069 Ga0207665_100040691 310
127 3300026035 Ga0207703_10012804 Ga0207703_100128045 310
128 3300031733 Ga0316577_10032636 Ga0316577_100326362 310
129 3300042876 Ga0451577_0092149 Ga0451577_0092149_655_1770 310
130 3300044712 Ga0453684_0397427 Ga0453684_0397427_31_1146 310
131 3300046517 Ga0495630_0042819 Ga0495630_0042819_535_1707 310
132 3300050507 nmdc:mga05p37_83288_c1 nmdc:mga05p37_83288_c1_839_1957 310
133 3300005471 Ga0070698_100066852 Ga0070698_1000668521 311
134 3300006844 Ga0075428_100477835 Ga0075428_1004778352 311
135 3300036401 Ga0373937_0434791 Ga0373937_0434791_104_1219 311
136 3300049822 Ga0501035_0215673 Ga0501035_0215673_482_1627 311
137 3300005340 Ga0070689_100109274 Ga0070689_1001092743 312
138 3300005365 Ga0070688_100104231 Ga0070688_1001042312 312
139 3300005436 Ga0070713_100009047 Ga0070713_1000090474 312
140 3300005445 Ga0070708_100056684 Ga0070708_1000566845 312
141 3300005458 Ga0070681_10003139 Ga0070681_100031398 312
142 3300005471 Ga0070698_100017691 Ga0070698_1000176912 312
143 3300005471 Ga0070698_100041249 Ga0070698_1000412495 312
144 3300005518 Ga0070699_100041654 Ga0070699_1000416543 312
145 3300005536 Ga0070697_100035973 Ga0070697_1000359734 312
146 3300005563 Ga0068855_100024466 Ga0068855_1000244664 312
147 3300006028 Ga0070717_10064618 Ga0070717_100646184 312
148 3300006028 Ga0070717_10080143 Ga0070717_100801433 312
149 3300006852 Ga0075433_10110688 Ga0075433_101106883 312
150 3300006914 Ga0075436_100215216 Ga0075436_1002152162 312
151 3300013297 Ga0157378_10042623 Ga0157378_100426233 312
152 3300025912 Ga0207707_10165544 Ga0207707_101655442 312
153 3300025913 Ga0207695_10025964 Ga0207695_100259645 312
154 3300025922 Ga0207646_10055213 Ga0207646_100552132 312
155 3300025922 Ga0207646_10119461 Ga0207646_101194611 312
156 3300025922 Ga0207646_10355534 Ga0207646_103555341 312
157 3300025925 Ga0207650_10058066 Ga0207650_100580663 312
158 3300025928 Ga0207700_10044066 Ga0207700_100440665 312
159 3300025936 Ga0207670_10087266 Ga0207670_100872662 312
160 3300031239 Ga0265328_10027389 Ga0265328_100273892 312
161 3300031242 Ga0265329_10000748 Ga0265329_1000074815 312
162 3300031711 Ga0265314_10000466 Ga0265314_1000046626 312
163 3300031727 Ga0316576_10035276 Ga0316576_100352763 312
164 3300031731 Ga0307405_10200819 Ga0307405_102008192 312
165 3300031852 Ga0307410_10013245 Ga0307410_100132452 312
166 3300032002 Ga0307416_100338559 Ga0307416_1003385591 312
167 3300032004 Ga0307414_10073130 Ga0307414_100731303 312
168 3300032004 Ga0307414_10112496 Ga0307414_101124963 312
169 3300032126 Ga0307415_100018397 Ga0307415_1000183975 312
170 3300037853 Ga0436364_1418190 Ga0436364_1418190_12_1127 312
171 3300039437 Ga0436365_1275285 Ga0436365_1275285_115_1230 312
172 3300044842 Ga0466957_0017077 Ga0466957_0017077_1376_2536 312
173 3300045051 Ga0451576_0008888 Ga0451576_0008888_7548_8663 312
174 3300049571 Ga0501034_0005449 Ga0501034_0005449_8370_9488 312
175 3300050510 nmdc:mga06r32_9119_c1 nmdc:mga06r32_9119_c1_2242_3357 312
176 3300050512 nmdc:mga0n895_183585_c1 nmdc:mga0n895_183585_c1_515_1630 312
177 3300050514 nmdc:mga08x19_204015_c1 nmdc:mga08x19_204015_c1_147_1262 312
178 3300050515 nmdc:mga0a205_209975_c1 nmdc:mga0a205_209975_c1_442_1557 312
179 3300005467 Ga0070706_100000846 Ga0070706_10000084624 313
180 3300005536 Ga0070697_100001769 Ga0070697_10000176911 313
181 3300009147 Ga0114129_10019462 Ga0114129_100194622 313
182 3300025910 Ga0207684_10000363 Ga0207684_1000036315 313
183 3300050507 nmdc:mga05p37_321924_c1 nmdc:mga05p37_321924_c1_471_1658 313
184 3300006846 Ga0075430_100026366 Ga0075430_1000263661 314
185 3300006847 Ga0075431_100136820 Ga0075431_1001368203 314
186 3300035083 Ga0373926_0013267 Ga0373926_0013267_979_2166 314
187 3300035725 Ga0373947_0018075 Ga0373947_0018075_1346_2533 314
188 3300037068 Ga0373925_0008470 Ga0373925_0008470_4611_5798 314
189 3300037068 Ga0373925_0044354 Ga0373925_0044354_1221_2408 314
190 3300046475 Ga0495639_0056649 Ga0495639_0056649_495_1682 314
191 3300046475 Ga0495639_0065676 Ga0495639_0065676_464_1651 314
192 3300046663 Ga0495635_0004319 Ga0495635_0004319_1687_2874 314
193 3300046690 Ga0495624_0044394 Ga0495624_0044394_586_1773 314
194 3300047322 Ga0495680_0009820 Ga0495680_0009820_4958_6145 314
195 3300048089 Ga0495614_0021917 Ga0495614_0021917_1503_2690 314
196 3300049572 Ga0501036_0218524 Ga0501036_0218524_125_1309 314
197 3300049575 Ga0501039_0060864 Ga0501039_0060864_513_1697 314
198 3300049576 Ga0501040_0079367 Ga0501040_0079367_950_2134 314
199 3300049577 Ga0501041_0006786 Ga0501041_0006786_3343_4527 314
200 3300049578 Ga0501042_0051433 Ga0501042_0051433_1718_2902 314
201 3300049580 Ga0501046_0001876 Ga0501046_0001876_18232_19416 314
202 3300049582 Ga0501048_0018613 Ga0501048_0018613_2569_3753 314
203 3300049587 Ga0501071_0039999 Ga0501071_0039999_1639_2823 314
204 3300049592 Ga0501076_0223167 Ga0501076_0223167_164_1348 314
205 3300049822 Ga0501035_0004846 Ga0501035_0004846_3477_4661 314
206 3300049824 Ga0501045_0047323 Ga0501045_0047323_1200_2384 314
207 3300050509 nmdc:mga0qj67_45433_c1 nmdc:mga0qj67_45433_c1_1659_2849 314
208 3300053085 Ga0495619_0058624 Ga0495619_0058624_902_2089 314
209 3300005468 Ga0070707_100000200 Ga0070707_10000020010 315
210 3300005471 Ga0070698_100029339 Ga0070698_1000293394 315
211 3300005518 Ga0070699_100017322 Ga0070699_1000173227 315
212 3300025922 Ga0207646_10000032 Ga0207646_10000032215 315
213 3300035692 Ga0373935_0096860 Ga0373935_0096860_37_1224 315
214 3300042000 Ga0439437_003764 Ga0439437_003764_356_1543 315
215 3300005295 Ga0065707_10097272 Ga0065707_100972723 316
216 3300005445 Ga0070708_100081809 Ga0070708_1000818092 316
217 3300005614 Ga0068856_100000232 Ga0068856_10000023235 316
218 3300026078 Ga0207702_10000263 Ga0207702_1000026334 316
219 3300031548 Ga0307408_100189252 Ga0307408_1001892521 316
220 3300031731 Ga0307405_10080032 Ga0307405_100800321 316
221 3300035116 Ga0373945_0013206 Ga0373945_0013206_434_1594 316
222 3300035170 Ga0373943_0027007 Ga0373943_0027007_415_1575 316
223 3300035692 Ga0373935_0017087 Ga0373935_0017087_960_2120 316
224 3300035695 Ga0373927_0023279 Ga0373927_0023279_1301_2461 316
225 3300035725 Ga0373947_0006717 Ga0373947_0006717_4219_5379 316
226 3300037068 Ga0373925_0002783 Ga0373925_0002783_5197_6357 316
227 3300046459 Ga0495629_0053815 Ga0495629_0053815_1611_2798 316
228 3300046499 Ga0495594_0002090 Ga0495594_0002090_3189_4382 316
229 3300046517 Ga0495630_0040776 Ga0495630_0040776_1124_2284 316
230 3300046526 Ga0495666_0053589 Ga0495666_0053589_548_1708 316
231 3300005468 Ga0070707_100155005 Ga0070707_1001550053 317
232 3300009177 Ga0105248_10090442 Ga0105248_100904423 317
233 3300031548 Ga0307408_100146548 Ga0307408_1001465482 317
234 3300049571 Ga0501034_0290640 Ga0501034_0290640_201_1358 317
235 3300006844 Ga0075428_100011203 Ga0075428_10001120314 318
236 3300006846 Ga0075430_100036343 Ga0075430_1000363436 318
237 3300006847 Ga0075431_100053137 Ga0075431_1000531376 318
238 3300006880 Ga0075429_100003072 Ga0075429_1000030729 318
239 3300009147 Ga0114129_10337446 Ga0114129_103374462 318
240 3300050507 nmdc:mga05p37_174928_c1 nmdc:mga05p37_174928_c1_534_1724 318
241 3300050508 nmdc:mga09592_2699_c1 nmdc:mga09592_2699_c1_5967_7157 318
242 3300050509 nmdc:mga0qj67_9089_c1 nmdc:mga0qj67_9089_c1_5985_7175 318
243 3300050510 nmdc:mga06r32_14191_c1 nmdc:mga06r32_14191_c1_74_1264 318
244 3300009094 Ga0111539_10205709 Ga0111539_102057092 319
245 3300013308 Ga0157375_10000044 Ga0157375_100000449 322
246 3300021384 Ga0213876_10004304 Ga0213876_100043044 322
247 3300025960 Ga0207651_10000965 Ga0207651_1000096514 322
248 3300039437 Ga0436365_1092468 Ga0436365_1092468_1700_2863 322
249 3300005355 Ga0070671_100075823 Ga0070671_1000758231 323
250 3300014325 Ga0163163_10100001 Ga0163163_101000014 323
251 3300031235 Ga0265330_10000153 Ga0265330_1000015312 323
252 3300031595 Ga0265313_10081599 Ga0265313_100815991 323
253 3300046454 Ga0495592_0000006 Ga0495592_0000006_116927_118087 323
254 3300046476 Ga0495662_0003146 Ga0495662_0003146_5997_7157 323
255 3300046477 Ga0495664_0017720 Ga0495664_0017720_1264_2424 323
256 3300046516 Ga0495628_0000138 Ga0495628_0000138_48989_50149 323
257 3300046526 Ga0495666_0030681 Ga0495666_0030681_1424_2584 323
258 3300046533 Ga0495640_0004852 Ga0495640_0004852_1559_2719 323
259 3300046535 Ga0495586_0008029 Ga0495586_0008029_1315_2475 323
260 3300046543 Ga0495645_0009625 Ga0495645_0009625_69_1229 323
261 3300046678 Ga0495599_0002418 Ga0495599_0002418_9312_10472 323
262 3300046690 Ga0495624_0090465 Ga0495624_0090465_102_1262 323
263 3300047319 Ga0495674_0001167 Ga0495674_0001167_12540_13700 323
264 3300049579 Ga0501043_0000457 Ga0501043_0000457_26575_27732 323
265 3300049703 Ga0501219_000233 Ga0501219_000233_7538_8713 323
266 3300053153 Ga0500616_0007795 Ga0500616_0007795_5501_6667 323
267 3300028800 Ga0265338_10006496 Ga0265338_1000649615 324
268 3300028800 Ga0265338_10085662 Ga0265338_100856623 324
269 3300031240 Ga0265320_10101139 Ga0265320_101011391 324
270 3300032004 Ga0307414_10088883 Ga0307414_100888833 324
271 3300046533 Ga0495640_0052486 Ga0495640_0052486_109_1347 324
272 3300046689 Ga0495613_0132281 Ga0495613_0132281_93_1331 324
273 3300047321 Ga0495676_0115651 Ga0495676_0115651_630_1868 324
274 3300049525 Ga0501302_000564 Ga0501302_000564_460_1635 324
275 3300049649 Ga0501198_001741 Ga0501198_001741_444_1619 324
276 3300049652 Ga0501202_000219 Ga0501202_000219_2339_3514 324
277 3300049653 Ga0501206_000236 Ga0501206_000236_1320_2495 324
278 3300049654 Ga0501207_001381 Ga0501207_001381_961_2136 324
279 3300049669 Ga0501235_000741 Ga0501235_000741_4083_5258 324
280 3300049673 Ga0501240_001287 Ga0501240_001287_266_1441 324
281 3300049677 Ga0501247_000747 Ga0501247_000747_16_1191 324
282 3300049681 Ga0501251_000054 Ga0501251_000054_5525_6700 324
283 3300049686 Ga0501257_002561 Ga0501257_002561_777_1952 324
284 3300049689 Ga0501260_000007 Ga0501260_000007_3217_4392 324
285 3300049690 Ga0501261_000142 Ga0501261_000142_4343_5518 324
286 3300049705 Ga0501225_0000580 Ga0501225_0000580_4369_5544 324
287 3300049707 Ga0501234_000680 Ga0501234_000680_445_1620 324
288 3300049768 Ga0501271_000261 Ga0501271_000261_2364_3539 324
289 3300049769 Ga0501272_000482 Ga0501272_000482_1041_2216 324
290 3300049853 Ga0501226_000396 Ga0501226_000396_1137_2312 324
291 3300005330 Ga0070690_100002944 Ga0070690_1000029446 325
292 3300005340 Ga0070689_100259455 Ga0070689_1002594551 325
293 3300005435 Ga0070714_100003430 Ga0070714_1000034302 325
294 3300005441 Ga0070700_100094093 Ga0070700_1000940932 325
295 3300005459 Ga0068867_100040855 Ga0068867_1000408554 325
296 3300005614 Ga0068856_100323953 Ga0068856_1003239532 325
297 3300005985 Ga0081539_10008324 Ga0081539_100083246 325
298 3300009093 Ga0105240_10139047 Ga0105240_101390473 325
299 3300025913 Ga0207695_10046527 Ga0207695_100465274 325
300 3300025916 Ga0207663_10003010 Ga0207663_100030102 325
301 3300025929 Ga0207664_10002608 Ga0207664_100026082 325
302 3300025939 Ga0207665_10089366 Ga0207665_100893662 325
303 3300026075 Ga0207708_10072826 Ga0207708_100728261 325
304 3300026078 Ga0207702_10015268 Ga0207702_100152689 325
305 3300028556 Ga0265337_1000823 Ga0265337_10008239 325
306 3300028556 Ga0265337_1014944 Ga0265337_10149444 325
307 3300028556 Ga0265337_1024727 Ga0265337_10247272 325
308 3300028563 Ga0265319_1020576 Ga0265319_10205763 325
309 3300028573 Ga0265334_10007725 Ga0265334_100077255 325
310 3300028800 Ga0265338_10001625 Ga0265338_1000162517 325
311 3300028800 Ga0265338_10002046 Ga0265338_100020466 325
312 3300028800 Ga0265338_10002535 Ga0265338_100025354 325
313 3300028800 Ga0265338_10011076 Ga0265338_100110768 325
314 3300028800 Ga0265338_10025363 Ga0265338_100253632 325
315 3300028800 Ga0265338_10027933 Ga0265338_100279335 325
316 3300028800 Ga0265338_10088828 Ga0265338_100888282 325
317 3300028800 Ga0265338_10151108 Ga0265338_101511082 325
318 3300031235 Ga0265330_10053073 Ga0265330_100530732 325
319 3300031240 Ga0265320_10000676 Ga0265320_100006768 325
320 3300031240 Ga0265320_10012855 Ga0265320_100128552 325
321 3300031247 Ga0265340_10001564 Ga0265340_100015643 325
322 3300031344 Ga0265316_10076677 Ga0265316_100766771 325
323 3300031595 Ga0265313_10011290 Ga0265313_100112906 325
324 3300031711 Ga0265314_10019772 Ga0265314_100197726 325
325 3300031711 Ga0265314_10051654 Ga0265314_100516541 325
326 3300031712 Ga0265342_10018779 Ga0265342_100187795 325
327 3300035118 Ga0373954_0007675 Ga0373954_0007675_2345_3511 325
328 3300035695 Ga0373927_0000779 Ga0373927_0000779_1844_3010 325
329 3300045051 Ga0451576_0062672 Ga0451576_0062672_273_1439 325
330 3300046514 Ga0495618_0060093 Ga0495618_0060093_603_1769 325
331 3300046517 Ga0495630_0178028 Ga0495630_0178028_75_1241 325
332 3300046559 Ga0495667_0190898 Ga0495667_0190898_132_1298 325
333 3300046642 Ga0495634_0023036 Ga0495634_0023036_2329_3498 325
334 3300047322 Ga0495680_0018790 Ga0495680_0018790_3736_4902 325
335 3300050507 nmdc:mga05p37_24287_c1 nmdc:mga05p37_24287_c1_4977_6140 325
336 3300050511 nmdc:mga08y16_134648_c1 nmdc:mga08y16_134648_c1_261_1427 325
337 3300005340 Ga0070689_100029236 Ga0070689_1000292365 326
338 3300005458 Ga0070681_10018087 Ga0070681_100180878 326
339 3300005458 Ga0070681_10057164 Ga0070681_100571644 326
340 3300005530 Ga0070679_100014771 Ga0070679_1000147714 326
341 3300005563 Ga0068855_100140512 Ga0068855_1001405122 326
342 3300005614 Ga0068856_100009414 Ga0068856_10000941412 326
343 3300005617 Ga0068859_100013866 Ga0068859_1000138664 326
344 3300006237 Ga0097621_100126625 Ga0097621_1001266253 326
345 3300006844 Ga0075428_100002950 Ga0075428_1000029506 326
346 3300006931 Ga0097620_100013866 Ga0097620_1000138664 326
347 3300009147 Ga0114129_10027580 Ga0114129_100275804 326
348 3300009551 Ga0105238_10016176 Ga0105238_100161767 326
349 3300013296 Ga0157374_10000179 Ga0157374_1000017936 326
350 3300013308 Ga0157375_10007861 Ga0157375_100078615 326
351 3300014969 Ga0157376_10000422 Ga0157376_100004229 326
352 3300025912 Ga0207707_10161954 Ga0207707_101619542 326
353 3300025921 Ga0207652_10019051 Ga0207652_100190516 326
354 3300025924 Ga0207694_10003917 Ga0207694_1000391711 326
355 3300025936 Ga0207670_10029627 Ga0207670_100296272 326
356 3300026116 Ga0207674_10094777 Ga0207674_100947775 326
357 3300028800 Ga0265338_10041793 Ga0265338_100417933 326
358 3300029957 Ga0265324_10014011 Ga0265324_100140115 326
359 3300029957 Ga0265324_10026686 Ga0265324_100266863 326
360 3300031251 Ga0265327_10000215 Ga0265327_100002159 326
361 3300034816 Ga0373930_0014211 Ga0373930_0014211_294_1460 326
362 3300034818 Ga0373950_0001966 Ga0373950_0001966_1014_2180 326
363 3300035085 Ga0373929_0000998 Ga0373929_0000998_1435_2601 326
364 3300035089 Ga0373944_0005058 Ga0373944_0005058_1896_3062 326
365 3300035090 Ga0373949_0003077 Ga0373949_0003077_2219_3385 326
366 3300035091 Ga0373951_0013169 Ga0373951_0013169_383_1549 326
367 3300035112 Ga0373932_0000006 Ga0373932_0000006_139583_140749 326
368 3300035691 Ga0373931_0000009 Ga0373931_0000009_137898_139064 326
369 3300035725 Ga0373947_0007395 Ga0373947_0007395_4520_5686 326
370 3300037068 Ga0373925_0000235 Ga0373925_0000235_36666_37832 326
371 3300042876 Ga0451577_0109967 Ga0451577_0109967_1050_2252 326
372 3300044673 Ga0453683_0052130 Ga0453683_0052130_628_1794 326
373 3300045051 Ga0451576_0331011 Ga0451576_0331011_243_1409 326
374 3300046557 Ga0495622_0019079 Ga0495622_0019079_571_1737 326
375 3300047444 Ga0495675_0088383 Ga0495675_0088383_256_1422 326
376 3300047444 Ga0495675_0101079 Ga0495675_0101079_49_1215 326
377 3300049568 Ga0501031_0002585 Ga0501031_0002585_8145_9332 326
378 3300049569 Ga0501032_0027950 Ga0501032_0027950_2403_3593 326
379 3300049573 Ga0501037_0028480 Ga0501037_0028480_533_1723 326
380 3300049574 Ga0501038_0005671 Ga0501038_0005671_3544_4734 326
381 3300049575 Ga0501039_0000579 Ga0501039_0000579_23911_25098 326
382 3300049575 Ga0501039_0082026 Ga0501039_0082026_1302_2492 326
383 3300049576 Ga0501040_0103893 Ga0501040_0103893_386_1573 326
384 3300049577 Ga0501041_0004876 Ga0501041_0004876_600_1790 326
385 3300049578 Ga0501042_0013309 Ga0501042_0013309_2127_3314 326
386 3300049579 Ga0501043_0036500 Ga0501043_0036500_64_1251 326
387 3300049580 Ga0501046_0015390 Ga0501046_0015390_2462_3652 326
388 3300049580 Ga0501046_0050115 Ga0501046_0050115_283_1470 326
389 3300049582 Ga0501048_0114150 Ga0501048_0114150_507_1697 326
390 3300049822 Ga0501035_0040425 Ga0501035_0040425_2043_3230 326
391 3300049822 Ga0501035_0085545 Ga0501035_0085545_429_1595 326
392 3300005365 Ga0070688_100036789 Ga0070688_1000367893 327
393 3300006237 Ga0097621_100221130 Ga0097621_1002211302 327
394 3300009176 Ga0105242_10023670 Ga0105242_100236703 327
395 3300014325 Ga0163163_10062769 Ga0163163_100627694 327
396 3300025934 Ga0207686_10041464 Ga0207686_100414641 327
397 3300026095 Ga0207676_10302170 Ga0207676_103021702 327
398 3300028380 Ga0268265_10187344 Ga0268265_101873442 327
399 3300028800 Ga0265338_10004555 Ga0265338_1000455526 327
400 3300028800 Ga0265338_10017012 Ga0265338_100170123 327
401 3300031249 Ga0265339_10081483 Ga0265339_100814831 327
402 3300037312 Ga0395899_0000009 Ga0395899_0000009_377975_379135 327
403 3300037466 Ga0395898_0000170 Ga0395898_0000170_142036_143196 327
404 3300049568 Ga0501031_0013686 Ga0501031_0013686_3795_4952 327
405 3300049574 Ga0501038_0088860 Ga0501038_0088860_1237_2394 327
406 3300049575 Ga0501039_0012191 Ga0501039_0012191_5196_6353 327
407 3300049579 Ga0501043_0001534 Ga0501043_0001534_8710_9867 327
408 3300049581 Ga0501047_0001057 Ga0501047_0001057_8539_9696 327
409 3300049586 Ga0501070_0000675 Ga0501070_0000675_18836_19993 327
410 3300049822 Ga0501035_0000002 Ga0501035_0000002_130765_131922 327
411 3300005328 Ga0070676_10014994 Ga0070676_100149941 329
412 3300005330 Ga0070690_100069004 Ga0070690_1000690043 329
413 3300005336 Ga0070680_100037835 Ga0070680_1000378354 329
414 3300005340 Ga0070689_100002853 Ga0070689_1000028535 329
415 3300005356 Ga0070674_100001544 Ga0070674_10000154414 329
416 3300005364 Ga0070673_100000493 Ga0070673_1000004931 329
417 3300005456 Ga0070678_100000262 Ga0070678_10000026222 329
418 3300005457 Ga0070662_100231638 Ga0070662_1002316381 329
419 3300005543 Ga0070672_100000158 Ga0070672_10000015830 329
420 3300005545 Ga0070695_100154532 Ga0070695_1001545321 329
421 3300005548 Ga0070665_100005728 Ga0070665_10000572810 329
422 3300005563 Ga0068855_100006984 Ga0068855_10000698413 329
423 3300006237 Ga0097621_100053315 Ga0097621_1000533155 329
424 3300006847 Ga0075431_100098589 Ga0075431_1000985895 329
425 3300006852 Ga0075433_10044410 Ga0075433_100444102 329
426 3300009551 Ga0105238_10018095 Ga0105238_100180957 329
427 3300009551 Ga0105238_10050018 Ga0105238_100500184 329
428 3300025903 Ga0207680_10015413 Ga0207680_100154132 329
429 3300025907 Ga0207645_10018062 Ga0207645_100180629 329
430 3300025925 Ga0207650_10079826 Ga0207650_100798263 329
431 3300025926 Ga0207659_10003858 Ga0207659_100038581 329
432 3300025936 Ga0207670_10003818 Ga0207670_100038188 329
433 3300025937 Ga0207669_10011817 Ga0207669_100118179 329
434 3300025940 Ga0207691_10000059 Ga0207691_100000592 329
435 3300025949 Ga0207667_10008825 Ga0207667_1000882512 329
436 3300025986 Ga0207658_10108904 Ga0207658_101089042 329
437 3300026121 Ga0207683_10000270 Ga0207683_1000027049 329
438 3300026142 Ga0207698_10299290 Ga0207698_102992901 329
439 3300027907 Ga0207428_10048308 Ga0207428_100483082 329
440 3300028379 Ga0268266_10316181 Ga0268266_103161811 329
441 3300028556 Ga0265337_1003808 Ga0265337_10038086 329
442 3300028558 Ga0265326_10005548 Ga0265326_100055484 329
443 3300028800 Ga0265338_10000038 Ga0265338_1000003818 329
444 3300028800 Ga0265338_10000528 Ga0265338_1000052838 329
445 3300028800 Ga0265338_10001068 Ga0265338_1000106813 329
446 3300028800 Ga0265338_10071295 Ga0265338_100712953 329
447 3300028800 Ga0265338_10090151 Ga0265338_100901512 329
448 3300028800 Ga0265338_10172128 Ga0265338_101721281 329
449 3300028800 Ga0265338_10203882 Ga0265338_102038822 329
450 3300029957 Ga0265324_10000268 Ga0265324_1000026823 329
451 3300029957 Ga0265324_10019003 Ga0265324_100190033 329
452 3300031251 Ga0265327_10006819 Ga0265327_100068192 329
453 3300035117 Ga0373953_0022180 Ga0373953_0022180_549_1715 329
454 3300042876 Ga0451577_0008063 Ga0451577_0008063_6821_7987 329
455 3300044712 Ga0453684_0053752 Ga0453684_0053752_3412_4578 329
456 3300046517 Ga0495630_0031673 Ga0495630_0031673_802_1968 329
457 3300046678 Ga0495599_0105630 Ga0495599_0105630_499_1665 329
458 3300047319 Ga0495674_0215904 Ga0495674_0215904_318_1484 329
459 3300047444 Ga0495675_0058592 Ga0495675_0058592_77_1243 329
460 3300048910 Ga0496107_0048627 Ga0496107_0048627_840_2006 329
461 3300049568 Ga0501031_0000631 Ga0501031_0000631_5836_7002 329
462 3300049569 Ga0501032_0002706 Ga0501032_0002706_7915_9081 329
463 3300049570 Ga0501033_0003368 Ga0501033_0003368_5936_7102 329
464 3300049822 Ga0501035_0027702 Ga0501035_0027702_2494_3660 329
465 3300049823 Ga0501044_0000442 Ga0501044_0000442_36051_37217 329
466 3300050507 nmdc:mga05p37_202870_c1 nmdc:mga05p37_202870_c1_404_1591 329
467 3300050510 nmdc:mga06r32_5924_c1 nmdc:mga06r32_5924_c1_8685_9851 329
468 3300050515 nmdc:mga0a205_18153_c1 nmdc:mga0a205_18153_c1_3257_4444 329
469 3300003320 rootH2_10156929 rootH2_101569292 341

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02012

BNR

BNR/Asp-box repeat

209

220

0.89

PF02012

BNR

BNR/Asp-box repeat

74

85

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bne-assembly3.cif.gz_C barnase a43c/s80c disulfide mutant 0.8711 133 156
3b7f-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase with bnr repeats (reut_b4987) from ralstonia eutropha jmp134 at 2.20 a resolution 0.868 2 286
7s0u-assembly1.cif.gz_B prmt5/mep50 crystal structure with mta and phthalazinone fragment bound 0.7421 4 267
4x61-assembly1.cif.gz_B crystal structure of prmt5:mep50 with epz015666 and sam 0.7385 4 267
7s1p-assembly1.cif.gz_B prmt5/mep50 crystal structure with sinefungin bound 0.7358 4 267
ID Description Score Start End Superfamily
3b7fA00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8609 2 286 2.130.10.10
af_Q4E4S0_27_142_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7717 122 203 2.130.10.10
af_A0A0R0FM96_16_129_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7629 122 250 2.130.10.10
af_I1MUK8_214_355_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.7625 125 265 2.40.128.630
af_A0A0P0WC96_1_125_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7491 177 267 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A2V5WFI9-F1-model_v4 Exo-alpha-sialidase 0.9739 1 287 GO:0000272
GO:0010411
GO:0016798
AF-A0A2H5YSX7-F1-model_v4 Exo-alpha-sialidase 0.9728 1 287 GO:0000272
GO:0010411
GO:0016798
AF-A0A2V8B9L8-F1-model_v4 Exo-alpha-sialidase 0.9716 1 248 GO:0000272
GO:0010411
GO:0016798
AF-A0A838S5Q7-F1-model_v4 Exo-alpha-sialidase 0.9703 1 265 GO:0000272
GO:0010411
GO:0016798
AF-A0A7V8SV37-F1-model_v4 Exo-alpha-sialidase 0.9685 1 156 GO:0000272
GO:0010411
GO:0016798

Feature Viewer

pLDDT pTM Quality
75.46 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map