F450138
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 468 | 262 | 465 | 264 |
Family's Representative Sequence
| Representative Sequence | 3300053146|Ga0500588_0010465|Ga0500588_0010465_600_1520 |
| Length | 306 |
| Sequence | VKRSPEAFDSRVRNCVLLSLLANAPRSDENRHEPPMKKATVVTDESNEIDDDSVSERRYRAPALEKGLEILELLAGEARAMPLSAIGQRLGRSTNELFRMMQVLQYKGFIDQEAGGGYRLTDKLFSLGMEQPRTRNLLEVALPAMRQLAVTIGQSCHLAVHSKGQIVVIARMESDEQIGFTVRVGYRRSLLNTTSGAVLYSYQNADTRKRWAAMWEPQPPEQEVAAFQRRCDSIRGRGHEMAVSNFVAGVTDISAPVMRGGQAAAALTVPFVHSSPLRLPMAETVGHIEAAAREISEQLLRSDSRV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 2 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 3 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 4 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 6 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 63 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 69 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 98 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 155 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 156 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 157 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 158 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 159 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 160 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 161 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 162 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 163 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 164 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 165 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 166 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 167 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 168 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 169 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 170 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 171 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 172 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 173 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 174 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 175 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 176 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 177 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 178 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 179 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 180 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 181 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 182 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 183 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 184 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 185 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 186 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 187 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 188 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 189 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 190 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 191 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 192 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 193 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 194 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 195 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 226 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 227 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 228 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 229 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 231 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 232 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 233 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 234 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 235 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 236 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 237 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 238 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 239 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 240 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 241 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 242 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 243 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 244 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 245 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 246 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 248 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 249 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 250 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 251 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 252 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 253 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 254 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 255 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 256 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 257 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 258 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 259 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 260 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 261 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 262 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.36 |
| Metatranscriptomes | 0 |
| Isolates | 0.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.97 |
| Nodule | 0.43 |
| Rhizoplane | 2.35 |
| Rhizosphere | 79.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c003356 | 3300000041 | Bacteria | 1426 |
| 2 | JGI24736J21556_1001759 | 3300001904 | Bacteria | 3904 |
| 3 | JGI24741J21665_1000192 | 3300001915 | Bacteria | 17936 |
| 4 | JGI24740J21852_10001303 | 3300001979 | Bacteria | 11343 |
| 5 | JGI24739J22299_10028129 | 3300001989 | Bacteria | 1962 |
| 6 | JGI24737J22298_10000764 | 3300001990 | Bacteria | 11363 |
| 7 | JGI24737J22298_10001431 | 3300001990 | Bacteria | 8495 |
| 8 | JGI24737J22298_10021360 | 3300001990 | Bacteria | 2063 |
| 9 | JGI24737J22298_10050002 | 3300001990 | Bacteria | 1271 |
| 10 | JGI24738J21930_10003405 | 3300002075 | Bacteria | 4014 |
| 11 | JGI24742J22300_10003082 | 3300002244 | Bacteria | 2697 |
| 12 | JGI25159J45721_1003057 | 3300002987 | Bacteria | 6052 |
| 13 | rootH1_10001452 | 3300003323 | Bacteria | 24345 |
| 14 | rootH1_10014040 | 3300003323 | Bacteria | 37606 |
| 15 | Ga0055525_1000096 | 3300003759 | Bacteria | 137836 |
| 16 | Ga0055542_1000012 | 3300003762 | Bacteria | 391808 |
| 17 | Ga0055542_1006686 | 3300003762 | Bacteria | 2433 |
| 18 | Ga0055529_1000002 | 3300003763 | Bacteria | 537914 |
| 19 | Ga0055529_1000021 | 3300003763 | Bacteria | 321484 |
| 20 | Ga0055537_1001600 | 3300003773 | Bacteria | 8535 |
| 21 | Ga0055524_1000345 | 3300003775 | Bacteria | 42426 |
| 22 | Ga0055530_10000061 | 3300003791 | Bacteria | 95363 |
| 23 | Ga0055531_10000035 | 3300003794 | Bacteria | 147414 |
| 24 | Ga0055531_10003469 | 3300003794 | Bacteria | 10032 |
| 25 | Ga0055543_1003246 | 3300004625 | Bacteria | 4921 |
| 26 | Ga0065165_1000051 | 3300005262 | Bacteria | 194844 |
| 27 | Ga0065165_1016766 | 3300005262 | Bacteria | 2729 |
| 28 | Ga0065165_1018532 | 3300005262 | Bacteria | 2517 |
| 29 | Ga0065165_1021190 | 3300005262 | Bacteria | 2264 |
| 30 | Ga0070658_10005243 | 3300005327 | Bacteria | 10531 |
| 31 | Ga0070676_10001114 | 3300005328 | Bacteria | 13419 |
| 32 | Ga0070683_100053362 | 3300005329 | Bacteria | 3746 |
| 33 | Ga0070670_100022078 | 3300005331 | Bacteria | 5478 |
| 34 | Ga0070677_10089713 | 3300005333 | Bacteria | 1334 |
| 35 | Ga0068869_100001804 | 3300005334 | Bacteria | 12852 |
| 36 | Ga0068868_100000496 | 3300005338 | Bacteria | 26255 |
| 37 | Ga0070660_100024003 | 3300005339 | Bacteria | 4522 |
| 38 | Ga0070660_100196389 | 3300005339 | Bacteria | 1636 |
| 39 | Ga0070661_100004931 | 3300005344 | Bacteria | 9187 |
| 40 | Ga0070661_100015845 | 3300005344 | Bacteria | 5319 |
| 41 | Ga0070668_100127681 | 3300005347 | Bacteria | 2038 |
| 42 | Ga0070675_100724106 | 3300005354 | Bacteria | 907 |
| 43 | Ga0070671_100276098 | 3300005355 | Bacteria | 1429 |
| 44 | Ga0070674_100006094 | 3300005356 | Bacteria | 7012 |
| 45 | Ga0070674_100015548 | 3300005356 | Bacteria | 4753 |
| 46 | Ga0070673_100000020 | 3300005364 | Bacteria | 102632 |
| 47 | Ga0070673_100186525 | 3300005364 | Bacteria | 1779 |
| 48 | Ga0070673_100345314 | 3300005364 | Bacteria | 1320 |
| 49 | Ga0070659_100000810 | 3300005366 | Bacteria | 22806 |
| 50 | Ga0070659_100008071 | 3300005366 | Bacteria | 7676 |
| 51 | Ga0070659_100081335 | 3300005366 | Bacteria | 2587 |
| 52 | Ga0070659_100185534 | 3300005366 | Bacteria | 1708 |
| 53 | Ga0070659_100187223 | 3300005366 | Bacteria | 1700 |
| 54 | Ga0070667_100012564 | 3300005367 | Bacteria | 7002 |
| 55 | Ga0070667_100241882 | 3300005367 | Bacteria | 1612 |
| 56 | Ga0070713_100297276 | 3300005436 | Bacteria | 1486 |
| 57 | Ga0070663_100000623 | 3300005455 | Bacteria | 18969 |
| 58 | Ga0070663_100003696 | 3300005455 | Bacteria | 8872 |
| 59 | Ga0070663_100003883 | 3300005455 | Bacteria | 8710 |
| 60 | Ga0070663_100007983 | 3300005455 | Bacteria | 6487 |
| 61 | Ga0070663_100279104 | 3300005455 | Bacteria | 1331 |
| 62 | Ga0070678_100000254 | 3300005456 | Bacteria | 24734 |
| 63 | Ga0070678_100455806 | 3300005456 | Bacteria | 1121 |
| 64 | Ga0070662_100176112 | 3300005457 | Bacteria | 1683 |
| 65 | Ga0068867_100000205 | 3300005459 | Bacteria | 39436 |
| 66 | Ga0068853_100059614 | 3300005539 | Bacteria | 3297 |
| 67 | Ga0068853_100184389 | 3300005539 | Bacteria | 1894 |
| 68 | Ga0068853_100273955 | 3300005539 | Bacteria | 1554 |
| 69 | Ga0070672_100007102 | 3300005543 | Bacteria | 7574 |
| 70 | Ga0070686_100480789 | 3300005544 | Bacteria | 960 |
| 71 | Ga0070665_100051841 | 3300005548 | Bacteria | 4115 |
| 72 | Ga0070665_100088481 | 3300005548 | Bacteria | 3103 |
| 73 | Ga0068855_100000183 | 3300005563 | Bacteria | 80725 |
| 74 | Ga0068855_100003190 | 3300005563 | Bacteria | 20090 |
| 75 | Ga0068855_100310013 | 3300005563 | Bacteria | 1746 |
| 76 | Ga0068855_100671733 | 3300005563 | Bacteria | 1111 |
| 77 | Ga0070664_100006941 | 3300005564 | Bacteria | 9125 |
| 78 | Ga0068857_100002772 | 3300005577 | Bacteria | 14400 |
| 79 | Ga0068854_100000151 | 3300005578 | Bacteria | 48172 |
| 80 | Ga0068854_100000790 | 3300005578 | Bacteria | 18843 |
| 81 | Ga0068854_100036035 | 3300005578 | Bacteria | 3466 |
| 82 | Ga0068856_100005191 | 3300005614 | Bacteria | 12858 |
| 83 | Ga0068856_100072975 | 3300005614 | Bacteria | 3398 |
| 84 | Ga0068856_100217557 | 3300005614 | Bacteria | 1925 |
| 85 | Ga0068852_100023344 | 3300005616 | Bacteria | 4977 |
| 86 | Ga0068852_100046112 | 3300005616 | Bacteria | 3712 |
| 87 | Ga0068859_100000362 | 3300005617 | Bacteria | 45197 |
| 88 | Ga0068851_10005927 | 3300005834 | Bacteria | 5562 |
| 89 | Ga0068870_10135958 | 3300005840 | Unclassified | 1433 |
| 90 | Ga0068863_100072664 | 3300005841 | Bacteria | 3254 |
| 91 | Ga0068858_100006085 | 3300005842 | Bacteria | 11771 |
| 92 | Ga0068858_100008824 | 3300005842 | Bacteria | 9668 |
| 93 | Ga0068858_100009417 | 3300005842 | Bacteria | 9320 |
| 94 | Ga0068860_100072927 | 3300005843 | Bacteria | 3263 |
| 95 | Ga0081539_10062308 | 3300005985 | Bacteria | 2039 |
| 96 | Ga0070717_10021093 | 3300006028 | Bacteria | 5132 |
| 97 | Ga0075369_10177140 | 3300006186 | Bacteria | 980 |
| 98 | Ga0075366_10170371 | 3300006195 | Bacteria | 1321 |
| 99 | Ga0097621_100017460 | 3300006237 | Bacteria | 5449 |
| 100 | Ga0097621_100194272 | 3300006237 | Bacteria | 1759 |
| 101 | Ga0068871_100008714 | 3300006358 | Bacteria | 7297 |
| 102 | Ga0068865_100000126 | 3300006881 | Bacteria | 39451 |
| 103 | Ga0097620_100000362 | 3300006931 | Bacteria | 45197 |
| 104 | Ga0099826_10113760 | 3300006948 | Bacteria | 1607 |
| 105 | Ga0105250_10102335 | 3300009092 | Bacteria | 1169 |
| 106 | Ga0105240_10005910 | 3300009093 | Bacteria | 18125 |
| 107 | Ga0105240_10057240 | 3300009093 | Bacteria | 4872 |
| 108 | Ga0105240_10640739 | 3300009093 | Bacteria | 1166 |
| 109 | Ga0105245_10000421 | 3300009098 | Bacteria | 39455 |
| 110 | Ga0105245_10004388 | 3300009098 | Bacteria | 12484 |
| 111 | Ga0105247_10000668 | 3300009101 | Bacteria | 27068 |
| 112 | Ga0105243_10000441 | 3300009148 | Bacteria | 43295 |
| 113 | Ga0105243_10001343 | 3300009148 | Bacteria | 21905 |
| 114 | Ga0105243_10078042 | 3300009148 | Bacteria | 2695 |
| 115 | Ga0105241_10000496 | 3300009174 | Bacteria | 29797 |
| 116 | Ga0105241_10014164 | 3300009174 | Bacteria | 5843 |
| 117 | Ga0105242_10000155 | 3300009176 | Bacteria | 50755 |
| 118 | Ga0105248_10179313 | 3300009177 | Bacteria | 2387 |
| 119 | Ga0105238_10014791 | 3300009551 | Bacteria | 7891 |
| 120 | Ga0105238_10058335 | 3300009551 | Bacteria | 3869 |
| 121 | Ga0105249_10013745 | 3300009553 | Bacteria | 7148 |
| 122 | Ga0105239_10037903 | 3300010375 | Bacteria | 5282 |
| 123 | Ga0105239_10075397 | 3300010375 | Bacteria | 3709 |
| 124 | Ga0105239_10213012 | 3300010375 | Bacteria | 2166 |
| 125 | Ga0105246_10001606 | 3300011119 | Bacteria | 13465 |
| 126 | Ga0157373_10014302 | 3300013100 | Bacteria | 5819 |
| 127 | Ga0157373_10016243 | 3300013100 | Bacteria | 5433 |
| 128 | Ga0157373_10020574 | 3300013100 | Bacteria | 4794 |
| 129 | Ga0157373_10138531 | 3300013100 | Bacteria | 1711 |
| 130 | Ga0157373_10304199 | 3300013100 | Bacteria | 1132 |
| 131 | Ga0157371_10002077 | 3300013102 | Bacteria | 19617 |
| 132 | Ga0157371_10004390 | 3300013102 | Bacteria | 12331 |
| 133 | Ga0157371_10115858 | 3300013102 | Bacteria | 1903 |
| 134 | Ga0157370_10040534 | 3300013104 | Bacteria | 4496 |
| 135 | Ga0157370_10060640 | 3300013104 | Bacteria | 3591 |
| 136 | Ga0157370_10070578 | 3300013104 | Bacteria | 3297 |
| 137 | Ga0157370_10085656 | 3300013104 | Bacteria | 2961 |
| 138 | Ga0157369_10000043 | 3300013105 | Bacteria | 180713 |
| 139 | Ga0157369_10004830 | 3300013105 | Bacteria | 15825 |
| 140 | Ga0157369_10045471 | 3300013105 | Bacteria | 4775 |
| 141 | Ga0157369_10065154 | 3300013105 | Bacteria | 3922 |
| 142 | Ga0157369_10072322 | 3300013105 | Bacteria | 3701 |
| 143 | Ga0157374_10001229 | 3300013296 | Bacteria | 21903 |
| 144 | Ga0157374_10083234 | 3300013296 | Bacteria | 3040 |
| 145 | Ga0157378_10002458 | 3300013297 | Bacteria | 16475 |
| 146 | Ga0157378_10308070 | 3300013297 | Unclassified | 1535 |
| 147 | Ga0163162_10229434 | 3300013306 | Bacteria | 1987 |
| 148 | Ga0157372_10061058 | 3300013307 | Bacteria | 4219 |
| 149 | Ga0157372_10096354 | 3300013307 | Bacteria | 3371 |
| 150 | Ga0157372_10190501 | 3300013307 | Bacteria | 2376 |
| 151 | Ga0157375_10003161 | 3300013308 | Bacteria | 14294 |
| 152 | Ga0163163_10017234 | 3300014325 | Bacteria | 6733 |
| 153 | Ga0163163_10040336 | 3300014325 | Bacteria | 4558 |
| 154 | Ga0157379_10368635 | 3300014968 | Bacteria | 1317 |
| 155 | Ga0157376_10000233 | 3300014969 | Bacteria | 38780 |
| 156 | Ga0157376_10153487 | 3300014969 | Bacteria | 2079 |
| 157 | Ga0163161_10086945 | 3300017792 | Bacteria | 2308 |
| 158 | Ga0209674_111238 | 3300025226 | Bacteria | 920 |
| 159 | Ga0209563_100058 | 3300025230 | Bacteria | 302571 |
| 160 | Ga0207425_1020676 | 3300025245 | Bacteria | 1404 |
| 161 | Ga0209026_1013104 | 3300025250 | Bacteria | 1421 |
| 162 | Ga0209677_107172 | 3300025253 | Bacteria | 2435 |
| 163 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 164 | Ga0209148_1000318 | 3300025254 | Bacteria | 67692 |
| 165 | Ga0209565_1000008 | 3300025263 | Bacteria | 774179 |
| 166 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 167 | Ga0209673_1002083 | 3300025273 | Bacteria | 15037 |
| 168 | Ga0209130_1000063 | 3300025284 | Bacteria | 198142 |
| 169 | Ga0209675_1028851 | 3300025291 | Bacteria | 1344 |
| 170 | Ga0209758_1004526 | 3300025297 | Bacteria | 11514 |
| 171 | Ga0209050_1000014 | 3300025298 | Bacteria | 774327 |
| 172 | Ga0209256_1000009 | 3300025299 | Bacteria | 922071 |
| 173 | Ga0209256_1000010 | 3300025299 | Bacteria | 912110 |
| 174 | Ga0209257_1000019 | 3300025304 | Bacteria | 774261 |
| 175 | Ga0209257_1003277 | 3300025304 | Bacteria | 14131 |
| 176 | Ga0207656_10010773 | 3300025321 | Bacteria | 3436 |
| 177 | Ga0207710_10000722 | 3300025900 | Bacteria | 18297 |
| 178 | Ga0207688_10120586 | 3300025901 | Bacteria | 1530 |
| 179 | Ga0207647_10016570 | 3300025904 | Bacteria | 5026 |
| 180 | Ga0207647_10022357 | 3300025904 | Bacteria | 4201 |
| 181 | Ga0207647_10097860 | 3300025904 | Bacteria | 1744 |
| 182 | Ga0207645_10002854 | 3300025907 | Bacteria | 13402 |
| 183 | Ga0207643_10106056 | 3300025908 | Bacteria | 1651 |
| 184 | Ga0207705_10000033 | 3300025909 | Bacteria | 223997 |
| 185 | Ga0207705_10000175 | 3300025909 | Bacteria | 68190 |
| 186 | Ga0207654_10000020 | 3300025911 | Bacteria | 167053 |
| 187 | Ga0207695_10003379 | 3300025913 | Bacteria | 22549 |
| 188 | Ga0207695_10005885 | 3300025913 | Bacteria | 16087 |
| 189 | Ga0207695_10011751 | 3300025913 | Bacteria | 10576 |
| 190 | Ga0207671_10009369 | 3300025914 | Bacteria | 8189 |
| 191 | Ga0207657_10011169 | 3300025919 | Bacteria | 8927 |
| 192 | Ga0207657_10012995 | 3300025919 | Bacteria | 8184 |
| 193 | Ga0207649_10000356 | 3300025920 | Bacteria | 34254 |
| 194 | Ga0207649_10000444 | 3300025920 | Bacteria | 29932 |
| 195 | Ga0207649_10150907 | 3300025920 | Bacteria | 1600 |
| 196 | Ga0207694_10007150 | 3300025924 | Bacteria | 8484 |
| 197 | Ga0207694_10206508 | 3300025924 | Bacteria | 1599 |
| 198 | Ga0207650_10006698 | 3300025925 | Bacteria | 7855 |
| 199 | Ga0207687_10000755 | 3300025927 | Bacteria | 21846 |
| 200 | Ga0207700_10005386 | 3300025928 | Bacteria | 7644 |
| 201 | Ga0207644_10062614 | 3300025931 | Bacteria | 2699 |
| 202 | Ga0207690_10000063 | 3300025932 | Bacteria | 95620 |
| 203 | Ga0207690_10017616 | 3300025932 | Bacteria | 4367 |
| 204 | Ga0207690_10050663 | 3300025932 | Bacteria | 2773 |
| 205 | Ga0207706_10046770 | 3300025933 | Bacteria | 3830 |
| 206 | Ga0207686_10000492 | 3300025934 | Bacteria | 25942 |
| 207 | Ga0207709_10000093 | 3300025935 | Bacteria | 139110 |
| 208 | Ga0207709_10000359 | 3300025935 | Bacteria | 46099 |
| 209 | Ga0207709_10038760 | 3300025935 | Bacteria | 2841 |
| 210 | Ga0207669_10000543 | 3300025937 | Bacteria | 16413 |
| 211 | Ga0207669_10003631 | 3300025937 | Bacteria | 6695 |
| 212 | Ga0207704_10000048 | 3300025938 | Bacteria | 83529 |
| 213 | Ga0207691_10089487 | 3300025940 | Bacteria | 2760 |
| 214 | Ga0207691_10505789 | 3300025940 | Bacteria | 1026 |
| 215 | Ga0207689_10001300 | 3300025942 | Bacteria | 24064 |
| 216 | Ga0207661_10035454 | 3300025944 | Bacteria | 3888 |
| 217 | Ga0207667_10000006 | 3300025949 | Bacteria | 679876 |
| 218 | Ga0207667_10000007 | 3300025949 | Bacteria | 630590 |
| 219 | Ga0207667_10003597 | 3300025949 | Bacteria | 19136 |
| 220 | Ga0207667_10014552 | 3300025949 | Bacteria | 8963 |
| 221 | Ga0207651_10000001 | 3300025960 | Bacteria | 516823 |
| 222 | Ga0207651_10270511 | 3300025960 | Bacteria | 1399 |
| 223 | Ga0207712_10074278 | 3300025961 | Bacteria | 2454 |
| 224 | Ga0207712_10106552 | 3300025961 | Bacteria | 2094 |
| 225 | Ga0207640_10000031 | 3300025981 | Bacteria | 120815 |
| 226 | Ga0207640_10000447 | 3300025981 | Bacteria | 25145 |
| 227 | Ga0207640_10001038 | 3300025981 | Bacteria | 15363 |
| 228 | Ga0207640_10524208 | 3300025981 | Bacteria | 991 |
| 229 | Ga0207658_10074556 | 3300025986 | Bacteria | 2578 |
| 230 | Ga0207658_10361114 | 3300025986 | Bacteria | 1267 |
| 231 | Ga0207677_10000125 | 3300026023 | Bacteria | 63161 |
| 232 | Ga0207703_10001429 | 3300026035 | Bacteria | 21791 |
| 233 | Ga0207703_10006205 | 3300026035 | Bacteria | 9564 |
| 234 | Ga0207703_10008571 | 3300026035 | Bacteria | 8071 |
| 235 | Ga0207639_10000785 | 3300026041 | Bacteria | 21614 |
| 236 | Ga0207639_10423979 | 3300026041 | Bacteria | 1203 |
| 237 | Ga0207678_10000225 | 3300026067 | Bacteria | 50510 |
| 238 | Ga0207678_10001276 | 3300026067 | Bacteria | 23275 |
| 239 | Ga0207678_10002610 | 3300026067 | Bacteria | 16424 |
| 240 | Ga0207678_10003964 | 3300026067 | Bacteria | 13318 |
| 241 | Ga0207678_10079436 | 3300026067 | Bacteria | 2809 |
| 242 | Ga0207702_10001866 | 3300026078 | Bacteria | 20690 |
| 243 | Ga0207702_10002347 | 3300026078 | Bacteria | 18064 |
| 244 | Ga0207702_10005553 | 3300026078 | Bacteria | 11013 |
| 245 | Ga0207702_10098275 | 3300026078 | Bacteria | 2578 |
| 246 | Ga0207702_10583900 | 3300026078 | Bacteria | 1095 |
| 247 | Ga0207641_10121415 | 3300026088 | Bacteria | 2332 |
| 248 | Ga0207648_10000633 | 3300026089 | Bacteria | 39430 |
| 249 | Ga0207676_10382685 | 3300026095 | Bacteria | 1310 |
| 250 | Ga0207674_10000057 | 3300026116 | Bacteria | 113117 |
| 251 | Ga0207674_10008800 | 3300026116 | Bacteria | 11622 |
| 252 | Ga0207674_10019526 | 3300026116 | Bacteria | 7339 |
| 253 | Ga0207675_100326559 | 3300026118 | Unclassified | 1499 |
| 254 | Ga0207683_10000181 | 3300026121 | Bacteria | 54142 |
| 255 | Ga0207698_10005364 | 3300026142 | Bacteria | 7913 |
| 256 | Ga0207698_10022359 | 3300026142 | Bacteria | 4392 |
| 257 | Ga0207698_10030988 | 3300026142 | Bacteria | 3855 |
| 258 | Ga0209282_1090715 | 3300027666 | Bacteria | 1601 |
| 259 | Ga0268266_10037280 | 3300028379 | Bacteria | 4143 |
| 260 | Ga0268266_10171976 | 3300028379 | Bacteria | 1967 |
| 261 | Ga0307517_10043627 | 3300028786 | Bacteria | 4770 |
| 262 | Ga0307511_10000640 | 3300030521 | Bacteria | 37443 |
| 263 | Ga0307513_10005107 | 3300031456 | Bacteria | 17372 |
| 264 | Ga0307513_10041208 | 3300031456 | Bacteria | 5100 |
| 265 | Ga0307513_10054436 | 3300031456 | Bacteria | 4290 |
| 266 | Ga0307513_10058134 | 3300031456 | Bacteria | 4113 |
| 267 | Ga0307513_10058920 | 3300031456 | Bacteria | 4078 |
| 268 | Ga0307509_10175224 | 3300031507 | Bacteria | 2018 |
| 269 | Ga0307408_100000044 | 3300031548 | Bacteria | 169498 |
| 270 | Ga0307408_100000295 | 3300031548 | Bacteria | 48475 |
| 271 | Ga0307508_10001949 | 3300031616 | Bacteria | 22585 |
| 272 | Ga0316575_10004036 | 3300031665 | Bacteria | 5141 |
| 273 | Ga0307414_10085110 | 3300032004 | Bacteria | 2328 |
| 274 | Ga0307510_10039538 | 3300033180 | Bacteria | 5194 |
| 275 | Ga0395899_0000018 | 3300037312 | Bacteria | 423194 |
| 276 | Ga0395899_0015001 | 3300037312 | Bacteria | 5911 |
| 277 | Ga0395899_0016349 | 3300037312 | Bacteria | 5655 |
| 278 | Ga0395899_0034003 | 3300037312 | Bacteria | 3827 |
| 279 | Ga0395899_0035235 | 3300037312 | Bacteria | 3757 |
| 280 | Ga0395899_0245627 | 3300037312 | Bacteria | 1230 |
| 281 | Ga0395899_0246013 | 3300037312 | Unclassified | 1229 |
| 282 | Ga0395900_0000605 | 3300037418 | Bacteria | 49062 |
| 283 | Ga0395900_0008897 | 3300037418 | Bacteria | 10306 |
| 284 | Ga0395900_0018552 | 3300037418 | Bacteria | 7094 |
| 285 | Ga0395900_0019364 | 3300037418 | Bacteria | 6943 |
| 286 | Ga0395900_0033951 | 3300037418 | Bacteria | 5251 |
| 287 | Ga0395900_0036433 | 3300037418 | Bacteria | 5072 |
| 288 | Ga0395900_0101689 | 3300037418 | Bacteria | 2952 |
| 289 | Ga0395900_0125476 | 3300037418 | Bacteria | 2632 |
| 290 | Ga0395900_0154418 | 3300037418 | Bacteria | 2344 |
| 291 | Ga0395900_0163059 | 3300037418 | Bacteria | 2273 |
| 292 | Ga0395900_0225699 | 3300037418 | Bacteria | 1886 |
| 293 | Ga0395900_0238959 | 3300037418 | Bacteria | 1823 |
| 294 | Ga0395900_0404451 | 3300037418 | Bacteria | 1328 |
| 295 | Ga0395900_0409782 | 3300037418 | Bacteria | 1318 |
| 296 | Ga0395898_0004872 | 3300037466 | Bacteria | 14575 |
| 297 | Ga0395898_0012983 | 3300037466 | Bacteria | 8589 |
| 298 | Ga0395898_0066897 | 3300037466 | Bacteria | 3480 |
| 299 | Ga0395898_0113620 | 3300037466 | Bacteria | 2595 |
| 300 | Ga0395898_0123903 | 3300037466 | Bacteria | 2476 |
| 301 | Ga0395898_0365504 | 3300037466 | Bacteria | 1376 |
| 302 | Ga0395905_0000967 | 3300037471 | Bacteria | 36867 |
| 303 | Ga0395905_0001467 | 3300037471 | Bacteria | 28279 |
| 304 | Ga0395905_0001987 | 3300037471 | Bacteria | 23369 |
| 305 | Ga0395905_0003610 | 3300037471 | Bacteria | 16445 |
| 306 | Ga0395905_0010105 | 3300037471 | Bacteria | 9199 |
| 307 | Ga0395905_0026421 | 3300037471 | Bacteria | 5474 |
| 308 | Ga0395905_0051307 | 3300037471 | Bacteria | 3863 |
| 309 | Ga0395905_0056825 | 3300037471 | Bacteria | 3660 |
| 310 | Ga0395905_0060309 | 3300037471 | Bacteria | 3547 |
| 311 | Ga0395905_0095909 | 3300037471 | Unclassified | 2784 |
| 312 | Ga0395905_0126297 | 3300037471 | Bacteria | 2405 |
| 313 | Ga0395905_0152092 | 3300037471 | Bacteria | 2177 |
| 314 | Ga0395905_0194893 | 3300037471 | Bacteria | 1900 |
| 315 | Ga0395905_0467183 | 3300037471 | Bacteria | 1160 |
| 316 | Ga0395901_0018936 | 3300038443 | Bacteria | 7039 |
| 317 | Ga0395901_0025651 | 3300038443 | Bacteria | 6051 |
| 318 | Ga0395901_0028548 | 3300038443 | Bacteria | 5738 |
| 319 | Ga0395901_0030991 | 3300038443 | Bacteria | 5512 |
| 320 | Ga0395901_0034730 | 3300038443 | Bacteria | 5208 |
| 321 | Ga0395901_0046465 | 3300038443 | Bacteria | 4510 |
| 322 | Ga0395901_0081356 | 3300038443 | Bacteria | 3383 |
| 323 | Ga0395901_0098238 | 3300038443 | Bacteria | 3070 |
| 324 | Ga0395901_0125823 | 3300038443 | Bacteria | 2694 |
| 325 | Ga0395901_0219543 | 3300038443 | Bacteria | 1987 |
| 326 | Ga0395901_0551798 | 3300038443 | Bacteria | 1168 |
| 327 | Ga0395901_0583208 | 3300038443 | Unclassified | 1129 |
| 328 | Ga0439436_0015818 | 3300041404 | Bacteria | 2267 |
| 329 | Ga0439439_0008024 | 3300041406 | Bacteria | 2481 |
| 330 | Ga0439461_0000938 | 3300041410 | Bacteria | 4359 |
| 331 | Ga0439465_0000889 | 3300041413 | Bacteria | 9445 |
| 332 | Ga0439431_0000346 | 3300041997 | Bacteria | 9719 |
| 333 | Ga0439431_0008316 | 3300041997 | Bacteria | 2330 |
| 334 | Ga0439433_0065294 | 3300041999 | Bacteria | 872 |
| 335 | Ga0439445_0002563 | 3300042004 | Bacteria | 4043 |
| 336 | Ga0439448_0047020 | 3300042005 | Bacteria | 1407 |
| 337 | Ga0439448_0056003 | 3300042005 | Unclassified | 1297 |
| 338 | Ga0439432_011589 | 3300042006 | Bacteria | 3037 |
| 339 | Ga0439455_0005311 | 3300042012 | Bacteria | 2609 |
| 340 | Ga0439462_0000664 | 3300042015 | Bacteria | 6975 |
| 341 | Ga0439446_0021021 | 3300042156 | Bacteria | 1842 |
| 342 | Ga0439458_0001159 | 3300042157 | Bacteria | 6679 |
| 343 | Ga0439458_0002905 | 3300042157 | Bacteria | 4116 |
| 344 | Ga0450909_014968 | 3300042185 | Bacteria | 1143 |
| 345 | Ga0439434_0002510 | 3300042435 | Bacteria | 5340 |
| 346 | Ga0466969_0007957 | 3300044656 | Bacteria | 5626 |
| 347 | Ga0466972_0054917 | 3300044658 | Bacteria | 1916 |
| 348 | Ga0466965_0104981 | 3300044683 | Bacteria | 1448 |
| 349 | Ga0466965_0125160 | 3300044683 | Bacteria | 1329 |
| 350 | Ga0466966_0001152 | 3300044684 | Bacteria | 16994 |
| 351 | Ga0466966_0005216 | 3300044684 | Bacteria | 8538 |
| 352 | Ga0466966_0121710 | 3300044684 | Bacteria | 1602 |
| 353 | Ga0466966_0175296 | 3300044684 | Bacteria | 1302 |
| 354 | Ga0466961_0116630 | 3300044693 | Bacteria | 1678 |
| 355 | Ga0466963_0001344 | 3300044694 | Bacteria | 13120 |
| 356 | Ga0466963_0022717 | 3300044694 | Bacteria | 3975 |
| 357 | Ga0466963_0279378 | 3300044694 | Bacteria | 1173 |
| 358 | Ga0466971_0010080 | 3300044719 | Bacteria | 4128 |
| 359 | Ga0466971_0069305 | 3300044719 | Bacteria | 1600 |
| 360 | Ga0466970_0001624 | 3300044765 | Bacteria | 10829 |
| 361 | Ga0466957_0004917 | 3300044842 | Bacteria | 7477 |
| 362 | Ga0466957_0009211 | 3300044842 | Bacteria | 5630 |
| 363 | Ga0466959_0014526 | 3300045049 | Bacteria | 5727 |
| 364 | Ga0466959_0014658 | 3300045049 | Bacteria | 5703 |
| 365 | Ga0466959_0065384 | 3300045049 | Plasmid | 2639 |
| 366 | Ga0466959_0469082 | 3300045049 | Unclassified | 852 |
| 367 | Ga0466958_0000774 | 3300045836 | Bacteria | 14055 |
| 368 | Ga0466958_0028377 | 3300045836 | Bacteria | 3318 |
| 369 | Ga0466967_0314489 | 3300045976 | Bacteria | 1509 |
| 370 | Ga0495627_080399 | 3300046453 | Bacteria | 945 |
| 371 | Ga0495638_0000134 | 3300046460 | Bacteria | 119114 |
| 372 | Ga0495638_0022224 | 3300046460 | Bacteria | 4166 |
| 373 | Ga0495650_0000083 | 3300046471 | Bacteria | 237725 |
| 374 | Ga0495650_0000408 | 3300046471 | Bacteria | 70787 |
| 375 | Ga0495584_0003917 | 3300046491 | Bacteria | 8047 |
| 376 | Ga0495585_0001044 | 3300046492 | Bacteria | 22944 |
| 377 | Ga0495585_0084636 | 3300046492 | Bacteria | 1715 |
| 378 | Ga0495583_0001697 | 3300046506 | Bacteria | 21264 |
| 379 | Ga0495583_0002962 | 3300046506 | Bacteria | 13639 |
| 380 | Ga0495583_0004955 | 3300046506 | Bacteria | 9245 |
| 381 | Ga0495606_0005475 | 3300046507 | Bacteria | 12154 |
| 382 | Ga0495620_0105731 | 3300046515 | Bacteria | 1119 |
| 383 | Ga0495631_0002177 | 3300046518 | Bacteria | 11311 |
| 384 | Ga0495631_0020569 | 3300046518 | Bacteria | 3082 |
| 385 | Ga0495637_0019750 | 3300046520 | Bacteria | 3111 |
| 386 | Ga0495648_0000097 | 3300046524 | Bacteria | 109887 |
| 387 | Ga0495663_0000245 | 3300046525 | Bacteria | 21455 |
| 388 | Ga0495622_0009948 | 3300046557 | Bacteria | 4399 |
| 389 | Ga0495633_0001735 | 3300046558 | Bacteria | 16283 |
| 390 | Ga0495633_0002574 | 3300046558 | Bacteria | 12703 |
| 391 | Ga0495633_0003967 | 3300046558 | Bacteria | 9611 |
| 392 | Ga0495668_0222132 | 3300046616 | Bacteria | 1034 |
| 393 | Ga0495611_0001160 | 3300046648 | Bacteria | 13758 |
| 394 | Ga0495611_0007848 | 3300046648 | Bacteria | 4531 |
| 395 | Ga0495611_0010099 | 3300046648 | Bacteria | 3996 |
| 396 | Ga0495625_0000496 | 3300046660 | Bacteria | 58853 |
| 397 | Ga0495625_0001084 | 3300046660 | Bacteria | 35324 |
| 398 | Ga0495625_0007394 | 3300046660 | Bacteria | 9569 |
| 399 | Ga0495625_0041863 | 3300046660 | Bacteria | 3332 |
| 400 | Ga0495625_0189068 | 3300046660 | Bacteria | 1365 |
| 401 | Ga0495661_0075963 | 3300046665 | Bacteria | 1951 |
| 402 | Ga0495669_0000023 | 3300046684 | Bacteria | 117158 |
| 403 | Ga0495670_0000014 | 3300046691 | Bacteria | 138993 |
| 404 | Ga0495671_0058933 | 3300046692 | Bacteria | 1899 |
| 405 | Ga0495649_0000700 | 3300046694 | Bacteria | 27353 |
| 406 | Ga0495649_0002955 | 3300046694 | Bacteria | 11716 |
| 407 | Ga0495600_0010427 | 3300046809 | Bacteria | 5769 |
| 408 | Ga0495660_0049635 | 3300046810 | Bacteria | 2289 |
| 409 | Ga0495636_0094355 | 3300047318 | Bacteria | 1302 |
| 410 | Ga0495683_0003318 | 3300047323 | Bacteria | 9406 |
| 411 | Ga0495687_000076 | 3300047443 | Bacteria | 149259 |
| 412 | Ga0495687_132906 | 3300047443 | Unclassified | 878 |
| 413 | Ga0495677_0028997 | 3300047445 | Bacteria | 2012 |
| 414 | Ga0495673_0093426 | 3300047469 | Bacteria | 1226 |
| 415 | Ga0495681_0044509 | 3300047470 | Bacteria | 2132 |
| 416 | Ga0495681_0094429 | 3300047470 | Bacteria | 1316 |
| 417 | Ga0496102_0000261 | 3300048905 | Bacteria | 67440 |
| 418 | Ga0496103_0000052 | 3300048906 | Bacteria | 149437 |
| 419 | Ga0496105_0000173 | 3300048908 | Bacteria | 42940 |
| 420 | Ga0496107_0028471 | 3300048910 | Bacteria | 3971 |
| 421 | Ga0496107_0178241 | 3300048910 | Bacteria | 1578 |
| 422 | Ga0496109_0719213 | 3300048912 | Bacteria | 936 |
| 423 | Ga0496110_0002413 | 3300048913 | Bacteria | 13991 |
| 424 | Ga0496111_0009793 | 3300048914 | Bacteria | 6407 |
| 425 | Ga0496112_0360459 | 3300048915 | Bacteria | 1396 |
| 426 | Ga0496114_0018135 | 3300048917 | Bacteria | 5687 |
| 427 | Ga0496115_0000086 | 3300048918 | Bacteria | 86625 |
| 428 | Ga0496116_0003600 | 3300048919 | Bacteria | 15236 |
| 429 | Ga0496117_0000141 | 3300048920 | Bacteria | 158041 |
| 430 | Ga0496118_0000103 | 3300048921 | Bacteria | 158099 |
| 431 | Ga0496119_0008218 | 3300048922 | Bacteria | 9226 |
| 432 | Ga0496120_0010715 | 3300048923 | Bacteria | 6362 |
| 433 | Ga0496121_0000156 | 3300048924 | Bacteria | 149376 |
| 434 | Ga0496121_0076653 | 3300048924 | Bacteria | 2665 |
| 435 | Ga0496122_0005013 | 3300048925 | Bacteria | 16020 |
| 436 | Ga0496123_0011085 | 3300048926 | Bacteria | 7866 |
| 437 | Ga0496124_0000041 | 3300048927 | Bacteria | 303887 |
| 438 | Ga0496125_0001443 | 3300048928 | Bacteria | 34571 |
| 439 | Ga0496126_0000155 | 3300048929 | Bacteria | 158816 |
| 440 | Ga0496126_0050901 | 3300048929 | Bacteria | 3774 |
| 441 | Ga0501034_0721235 | 3300049571 | Bacteria | 894 |
| 442 | Ga0501034_0779453 | 3300049571 | Bacteria | 850 |
| 443 | Ga0500610_0000116 | 3300053079 | Bacteria | 24225 |
| 444 | Ga0500566_0002505 | 3300053094 | Bacteria | 10913 |
| 445 | Ga0500641_0008436 | 3300053096 | Bacteria | 3677 |
| 446 | Ga0500641_0019654 | 3300053096 | Bacteria | 2556 |
| 447 | Ga0500562_027992 | 3300053108 | Bacteria | 1480 |
| 448 | Ga0500595_000256 | 3300053119 | Bacteria | 35290 |
| 449 | Ga0500595_002304 | 3300053119 | Bacteria | 9564 |
| 450 | Ga0500658_0000562 | 3300053134 | Bacteria | 15628 |
| 451 | Ga0500658_0002294 | 3300053134 | Bacteria | 7411 |
| 452 | Ga0500658_0003604 | 3300053134 | Bacteria | 5838 |
| 453 | Ga0500559_0025405 | 3300053136 | Bacteria | 2520 |
| 454 | Ga0500568_0019335 | 3300053139 | Bacteria | 2962 |
| 455 | Ga0500586_000212 | 3300053145 | Bacteria | 11458 |
| 456 | Ga0500588_0010465 | 3300053146 | Unclassified | 2241 |
| 457 | Ga0500588_0026626 | 3300053146 | Bacteria | 1620 |
| 458 | Ga0500619_074962 | 3300053154 | Bacteria | 1130 |
| 459 | Ga0500622_0009443 | 3300053156 | Bacteria | 5396 |
| 460 | Ga0500636_0001285 | 3300053177 | Bacteria | 13628 |
| 461 | Ga0500637_0005297 | 3300053178 | Bacteria | 6232 |
| 462 | Ga0500645_000003 | 3300053730 | Bacteria | 305887 |
| 463 | Ga0500645_000777 | 3300053730 | Bacteria | 19309 |
| 464 | Ga0466962_0000640 | 3300061719 | Bacteria | 15596 |
| 465 | Ga0466962_0005161 | 3300061719 | Bacteria | 6281 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053136 | Ga0500559_0025405 | Ga0500559_0025405_917_1663 | 241 |
| 2 | 3300031456 | Ga0307513_10041208 | Ga0307513_100412085 | 253 |
| 3 | 3300005843 | Ga0068860_100072927 | Ga0068860_1000729273 | 254 |
| 4 | 3300026078 | Ga0207702_10583900 | Ga0207702_105839002 | 254 |
| 5 | 3300032004 | Ga0307414_10085110 | Ga0307414_100851103 | 254 |
| 6 | 3300037418 | Ga0395900_0036433 | Ga0395900_0036433_2873_3643 | 254 |
| 7 | 3300037418 | Ga0395900_0101689 | Ga0395900_0101689_1290_2060 | 254 |
| 8 | 3300037466 | Ga0395898_0123903 | Ga0395898_0123903_1459_2229 | 254 |
| 9 | 3300037466 | Ga0395898_0365504 | Ga0395898_0365504_179_949 | 254 |
| 10 | 3300037471 | Ga0395905_0026421 | Ga0395905_0026421_3048_3818 | 254 |
| 11 | 3300038443 | Ga0395901_0046465 | Ga0395901_0046465_2848_3618 | 254 |
| 12 | 3300046694 | Ga0495649_0000700 | Ga0495649_0000700_25569_26339 | 254 |
| 13 | iso_pu_bacteria | 2643221663 | 2644353827 | 254 |
| 14 | 3300005436 | Ga0070713_100297276 | Ga0070713_1002972762 | 255 |
| 15 | 3300006028 | Ga0070717_10021093 | Ga0070717_100210933 | 255 |
| 16 | 3300025928 | Ga0207700_10005386 | Ga0207700_100053863 | 255 |
| 17 | 3300005262 | Ga0065165_1016766 | Ga0065165_10167662 | 256 |
| 18 | 3300044658 | Ga0466972_0054917 | Ga0466972_0054917_1019_1789 | 256 |
| 19 | 3300044683 | Ga0466965_0125160 | Ga0466965_0125160_403_1173 | 256 |
| 20 | 3300044684 | Ga0466966_0121710 | Ga0466966_0121710_415_1185 | 256 |
| 21 | 3300044842 | Ga0466957_0009211 | Ga0466957_0009211_2955_3725 | 256 |
| 22 | 3300045049 | Ga0466959_0014658 | Ga0466959_0014658_2074_2844 | 256 |
| 23 | 3300046460 | Ga0495638_0022224 | Ga0495638_0022224_2725_3495 | 256 |
| 24 | 3300046471 | Ga0495650_0000408 | Ga0495650_0000408_44219_44989 | 256 |
| 25 | 3300046507 | Ga0495606_0005475 | Ga0495606_0005475_9720_10490 | 256 |
| 26 | 3300046558 | Ga0495633_0001735 | Ga0495633_0001735_5180_5950 | 256 |
| 27 | 3300046660 | Ga0495625_0001084 | Ga0495625_0001084_22817_23587 | 256 |
| 28 | 3300053145 | Ga0500586_000212 | Ga0500586_000212_898_1668 | 256 |
| 29 | 3300001915 | JGI24741J21665_1000192 | JGI24741J21665_100019215 | 258 |
| 30 | 3300001979 | JGI24740J21852_10001303 | JGI24740J21852_1000130313 | 258 |
| 31 | 3300001989 | JGI24739J22299_10028129 | JGI24739J22299_100281292 | 258 |
| 32 | 3300001990 | JGI24737J22298_10001431 | JGI24737J22298_100014314 | 258 |
| 33 | 3300002075 | JGI24738J21930_10003405 | JGI24738J21930_100034053 | 258 |
| 34 | 3300002244 | JGI24742J22300_10003082 | JGI24742J22300_100030822 | 258 |
| 35 | 3300003323 | rootH1_10014040 | rootH1_100140407 | 258 |
| 36 | 3300003759 | Ga0055525_1000096 | Ga0055525_100009652 | 258 |
| 37 | 3300003762 | Ga0055542_1000012 | Ga0055542_1000012350 | 258 |
| 38 | 3300003763 | Ga0055529_1000002 | Ga0055529_1000002266 | 258 |
| 39 | 3300003763 | Ga0055529_1000021 | Ga0055529_1000021215 | 258 |
| 40 | 3300005327 | Ga0070658_10005243 | Ga0070658_1000524310 | 258 |
| 41 | 3300005333 | Ga0070677_10089713 | Ga0070677_100897131 | 258 |
| 42 | 3300005339 | Ga0070660_100196389 | Ga0070660_1001963891 | 258 |
| 43 | 3300005347 | Ga0070668_100127681 | Ga0070668_1001276811 | 258 |
| 44 | 3300005355 | Ga0070671_100276098 | Ga0070671_1002760982 | 258 |
| 45 | 3300005356 | Ga0070674_100015548 | Ga0070674_1000155483 | 258 |
| 46 | 3300005364 | Ga0070673_100345314 | Ga0070673_1003453141 | 258 |
| 47 | 3300005366 | Ga0070659_100187223 | Ga0070659_1001872232 | 258 |
| 48 | 3300005367 | Ga0070667_100241882 | Ga0070667_1002418822 | 258 |
| 49 | 3300005455 | Ga0070663_100000623 | Ga0070663_1000006234 | 258 |
| 50 | 3300005455 | Ga0070663_100003883 | Ga0070663_1000038836 | 258 |
| 51 | 3300005456 | Ga0070678_100455806 | Ga0070678_1004558061 | 258 |
| 52 | 3300005539 | Ga0068853_100059614 | Ga0068853_1000596143 | 258 |
| 53 | 3300005539 | Ga0068853_100273955 | Ga0068853_1002739552 | 258 |
| 54 | 3300005548 | Ga0070665_100051841 | Ga0070665_1000518415 | 258 |
| 55 | 3300005563 | Ga0068855_100000183 | Ga0068855_10000018345 | 258 |
| 56 | 3300005564 | Ga0070664_100006941 | Ga0070664_1000069417 | 258 |
| 57 | 3300005578 | Ga0068854_100000151 | Ga0068854_10000015134 | 258 |
| 58 | 3300005614 | Ga0068856_100072975 | Ga0068856_1000729752 | 258 |
| 59 | 3300005834 | Ga0068851_10005927 | Ga0068851_100059272 | 258 |
| 60 | 3300005840 | Ga0068870_10135958 | Ga0068870_101359582 | 258 |
| 61 | 3300005842 | Ga0068858_100009417 | Ga0068858_1000094177 | 258 |
| 62 | 3300005985 | Ga0081539_10062308 | Ga0081539_100623082 | 258 |
| 63 | 3300006186 | Ga0075369_10177140 | Ga0075369_101771402 | 258 |
| 64 | 3300006195 | Ga0075366_10170371 | Ga0075366_101703712 | 258 |
| 65 | 3300006237 | Ga0097621_100017460 | Ga0097621_1000174602 | 258 |
| 66 | 3300006237 | Ga0097621_100194272 | Ga0097621_1001942722 | 258 |
| 67 | 3300006358 | Ga0068871_100008714 | Ga0068871_1000087142 | 258 |
| 68 | 3300009093 | Ga0105240_10640739 | Ga0105240_106407391 | 258 |
| 69 | 3300009174 | Ga0105241_10000496 | Ga0105241_1000049625 | 258 |
| 70 | 3300009174 | Ga0105241_10014164 | Ga0105241_100141642 | 258 |
| 71 | 3300009551 | Ga0105238_10058335 | Ga0105238_100583352 | 258 |
| 72 | 3300010375 | Ga0105239_10037903 | Ga0105239_100379034 | 258 |
| 73 | 3300010375 | Ga0105239_10075397 | Ga0105239_100753972 | 258 |
| 74 | 3300013100 | Ga0157373_10016243 | Ga0157373_100162434 | 258 |
| 75 | 3300013100 | Ga0157373_10020574 | Ga0157373_100205745 | 258 |
| 76 | 3300013102 | Ga0157371_10002077 | Ga0157371_100020774 | 258 |
| 77 | 3300013104 | Ga0157370_10085656 | Ga0157370_100856562 | 258 |
| 78 | 3300013105 | Ga0157369_10072322 | Ga0157369_100723224 | 258 |
| 79 | 3300013307 | Ga0157372_10096354 | Ga0157372_100963544 | 258 |
| 80 | 3300017792 | Ga0163161_10086945 | Ga0163161_100869452 | 258 |
| 81 | 3300025226 | Ga0209674_111238 | Ga0209674_1112381 | 258 |
| 82 | 3300025230 | Ga0209563_100058 | Ga0209563_10005871 | 258 |
| 83 | 3300025250 | Ga0209026_1013104 | Ga0209026_10131042 | 258 |
| 84 | 3300025253 | Ga0209677_107172 | Ga0209677_1071722 | 258 |
| 85 | 3300025254 | Ga0209148_1000008 | Ga0209148_1000008983 | 258 |
| 86 | 3300025272 | Ga0209455_1000002 | Ga0209455_1000002442 | 258 |
| 87 | 3300025321 | Ga0207656_10010773 | Ga0207656_100107731 | 258 |
| 88 | 3300025901 | Ga0207688_10120586 | Ga0207688_101205861 | 258 |
| 89 | 3300025904 | Ga0207647_10022357 | Ga0207647_100223573 | 258 |
| 90 | 3300025908 | Ga0207643_10106056 | Ga0207643_101060562 | 258 |
| 91 | 3300025909 | Ga0207705_10000175 | Ga0207705_1000017572 | 258 |
| 92 | 3300025911 | Ga0207654_10000020 | Ga0207654_1000002078 | 258 |
| 93 | 3300025913 | Ga0207695_10011751 | Ga0207695_1001175110 | 258 |
| 94 | 3300025914 | Ga0207671_10009369 | Ga0207671_100093695 | 258 |
| 95 | 3300025919 | Ga0207657_10011169 | Ga0207657_100111694 | 258 |
| 96 | 3300025920 | Ga0207649_10000356 | Ga0207649_100003563 | 258 |
| 97 | 3300025924 | Ga0207694_10007150 | Ga0207694_100071507 | 258 |
| 98 | 3300025927 | Ga0207687_10000755 | Ga0207687_1000075512 | 258 |
| 99 | 3300025932 | Ga0207690_10000063 | Ga0207690_100000633 | 258 |
| 100 | 3300025933 | Ga0207706_10046770 | Ga0207706_100467703 | 258 |
| 101 | 3300025935 | Ga0207709_10000093 | Ga0207709_1000009329 | 258 |
| 102 | 3300025935 | Ga0207709_10038760 | Ga0207709_100387602 | 258 |
| 103 | 3300025937 | Ga0207669_10000543 | Ga0207669_100005432 | 258 |
| 104 | 3300025937 | Ga0207669_10003631 | Ga0207669_100036315 | 258 |
| 105 | 3300025940 | Ga0207691_10505789 | Ga0207691_105057892 | 258 |
| 106 | 3300025949 | Ga0207667_10000006 | Ga0207667_10000006154 | 258 |
| 107 | 3300025949 | Ga0207667_10000007 | Ga0207667_10000007554 | 258 |
| 108 | 3300025960 | Ga0207651_10270511 | Ga0207651_102705112 | 258 |
| 109 | 3300025981 | Ga0207640_10000031 | Ga0207640_10000031115 | 258 |
| 110 | 3300025981 | Ga0207640_10001038 | Ga0207640_100010388 | 258 |
| 111 | 3300025986 | Ga0207658_10361114 | Ga0207658_103611142 | 258 |
| 112 | 3300026035 | Ga0207703_10006205 | Ga0207703_100062053 | 258 |
| 113 | 3300026041 | Ga0207639_10000785 | Ga0207639_1000078510 | 258 |
| 114 | 3300026041 | Ga0207639_10423979 | Ga0207639_104239791 | 258 |
| 115 | 3300026067 | Ga0207678_10000225 | Ga0207678_100002254 | 258 |
| 116 | 3300026067 | Ga0207678_10001276 | Ga0207678_100012763 | 258 |
| 117 | 3300026078 | Ga0207702_10002347 | Ga0207702_100023478 | 258 |
| 118 | 3300026116 | Ga0207674_10008800 | Ga0207674_1000880011 | 258 |
| 119 | 3300026121 | Ga0207683_10000181 | Ga0207683_100001814 | 258 |
| 120 | 3300026142 | Ga0207698_10005364 | Ga0207698_100053645 | 258 |
| 121 | 3300028379 | Ga0268266_10037280 | Ga0268266_100372802 | 258 |
| 122 | 3300028786 | Ga0307517_10043627 | Ga0307517_100436273 | 258 |
| 123 | 3300031456 | Ga0307513_10054436 | Ga0307513_100544362 | 258 |
| 124 | 3300031548 | Ga0307408_100000044 | Ga0307408_10000004423 | 258 |
| 125 | 3300031548 | Ga0307408_100000295 | Ga0307408_10000029545 | 258 |
| 126 | 3300033180 | Ga0307510_10039538 | Ga0307510_100395384 | 258 |
| 127 | 3300037312 | Ga0395899_0034003 | Ga0395899_0034003_3006_3791 | 258 |
| 128 | 3300037418 | Ga0395900_0225699 | Ga0395900_0225699_765_1541 | 258 |
| 129 | 3300037471 | Ga0395905_0010105 | Ga0395905_0010105_5192_5968 | 258 |
| 130 | 3300037471 | Ga0395905_0194893 | Ga0395905_0194893_862_1647 | 258 |
| 131 | 3300044694 | Ga0466963_0279378 | Ga0466963_0279378_127_903 | 258 |
| 132 | 3300044719 | Ga0466971_0069305 | Ga0466971_0069305_575_1351 | 258 |
| 133 | 3300045836 | Ga0466958_0028377 | Ga0466958_0028377_92_868 | 258 |
| 134 | 3300045976 | Ga0466967_0314489 | Ga0466967_0314489_361_1137 | 258 |
| 135 | 3300046471 | Ga0495650_0000083 | Ga0495650_0000083_198841_199629 | 258 |
| 136 | 3300046491 | Ga0495584_0003917 | Ga0495584_0003917_4091_4876 | 258 |
| 137 | 3300046492 | Ga0495585_0084636 | Ga0495585_0084636_833_1618 | 258 |
| 138 | 3300046506 | Ga0495583_0001697 | Ga0495583_0001697_11292_12080 | 258 |
| 139 | 3300046506 | Ga0495583_0002962 | Ga0495583_0002962_11751_12536 | 258 |
| 140 | 3300046506 | Ga0495583_0004955 | Ga0495583_0004955_3696_4481 | 258 |
| 141 | 3300046515 | Ga0495620_0105731 | Ga0495620_0105731_92_877 | 258 |
| 142 | 3300046518 | Ga0495631_0002177 | Ga0495631_0002177_5569_6354 | 258 |
| 143 | 3300046518 | Ga0495631_0020569 | Ga0495631_0020569_1004_1789 | 258 |
| 144 | 3300046520 | Ga0495637_0019750 | Ga0495637_0019750_2240_3025 | 258 |
| 145 | 3300046525 | Ga0495663_0000245 | Ga0495663_0000245_14668_15453 | 258 |
| 146 | 3300046557 | Ga0495622_0009948 | Ga0495622_0009948_2139_2927 | 258 |
| 147 | 3300046558 | Ga0495633_0002574 | Ga0495633_0002574_6051_6836 | 258 |
| 148 | 3300046558 | Ga0495633_0003967 | Ga0495633_0003967_6628_7416 | 258 |
| 149 | 3300046616 | Ga0495668_0222132 | Ga0495668_0222132_149_934 | 258 |
| 150 | 3300046648 | Ga0495611_0001160 | Ga0495611_0001160_12355_13140 | 258 |
| 151 | 3300046648 | Ga0495611_0007848 | Ga0495611_0007848_842_1627 | 258 |
| 152 | 3300046648 | Ga0495611_0010099 | Ga0495611_0010099_1743_2531 | 258 |
| 153 | 3300046660 | Ga0495625_0007394 | Ga0495625_0007394_372_1157 | 258 |
| 154 | 3300046660 | Ga0495625_0041863 | Ga0495625_0041863_2230_3015 | 258 |
| 155 | 3300046665 | Ga0495661_0075963 | Ga0495661_0075963_841_1629 | 258 |
| 156 | 3300046684 | Ga0495669_0000023 | Ga0495669_0000023_100715_101500 | 258 |
| 157 | 3300046692 | Ga0495671_0058933 | Ga0495671_0058933_1086_1871 | 258 |
| 158 | 3300046694 | Ga0495649_0002955 | Ga0495649_0002955_2793_3578 | 258 |
| 159 | 3300046809 | Ga0495600_0010427 | Ga0495600_0010427_2786_3574 | 258 |
| 160 | 3300046810 | Ga0495660_0049635 | Ga0495660_0049635_501_1286 | 258 |
| 161 | 3300047318 | Ga0495636_0094355 | Ga0495636_0094355_429_1214 | 258 |
| 162 | 3300047323 | Ga0495683_0003318 | Ga0495683_0003318_7466_8251 | 258 |
| 163 | 3300047443 | Ga0495687_000076 | Ga0495687_000076_95718_96503 | 258 |
| 164 | 3300047443 | Ga0495687_132906 | Ga0495687_132906_45_845 | 258 |
| 165 | 3300047445 | Ga0495677_0028997 | Ga0495677_0028997_1089_1874 | 258 |
| 166 | 3300047469 | Ga0495673_0093426 | Ga0495673_0093426_145_930 | 258 |
| 167 | 3300047470 | Ga0495681_0044509 | Ga0495681_0044509_1016_1801 | 258 |
| 168 | 3300048912 | Ga0496109_0719213 | Ga0496109_0719213_49_834 | 258 |
| 169 | 3300048915 | Ga0496112_0360459 | Ga0496112_0360459_457_1242 | 258 |
| 170 | 3300048925 | Ga0496122_0005013 | Ga0496122_0005013_9362_10147 | 258 |
| 171 | 3300048926 | Ga0496123_0011085 | Ga0496123_0011085_3327_4112 | 258 |
| 172 | 3300048928 | Ga0496125_0001443 | Ga0496125_0001443_889_1674 | 258 |
| 173 | 3300049571 | Ga0501034_0721235 | Ga0501034_0721235_50_856 | 258 |
| 174 | 3300053079 | Ga0500610_0000116 | Ga0500610_0000116_7754_8539 | 258 |
| 175 | 3300053119 | Ga0500595_000256 | Ga0500595_000256_15800_16588 | 258 |
| 176 | 3300053119 | Ga0500595_002304 | Ga0500595_002304_3374_4162 | 258 |
| 177 | 3300053154 | Ga0500619_074962 | Ga0500619_074962_260_1048 | 258 |
| 178 | 3300053177 | Ga0500636_0001285 | Ga0500636_0001285_6916_7704 | 258 |
| 179 | 3300053730 | Ga0500645_000003 | Ga0500645_000003_197597_198382 | 258 |
| 180 | 3300061719 | Ga0466962_0000640 | Ga0466962_0000640_9690_10466 | 258 |
| 181 | iso_pu_bacteria | 2738541276 | 2738716032 | 258 |
| 182 | 3300001904 | JGI24736J21556_1001759 | JGI24736J21556_10017593 | 259 |
| 183 | 3300001990 | JGI24737J22298_10000764 | JGI24737J22298_100007645 | 259 |
| 184 | 3300001990 | JGI24737J22298_10050002 | JGI24737J22298_100500022 | 259 |
| 185 | 3300003323 | rootH1_10001452 | rootH1_1000145213 | 259 |
| 186 | 3300005329 | Ga0070683_100053362 | Ga0070683_1000533623 | 259 |
| 187 | 3300005331 | Ga0070670_100022078 | Ga0070670_1000220784 | 259 |
| 188 | 3300005339 | Ga0070660_100024003 | Ga0070660_1000240033 | 259 |
| 189 | 3300005344 | Ga0070661_100004931 | Ga0070661_1000049314 | 259 |
| 190 | 3300005344 | Ga0070661_100015845 | Ga0070661_1000158453 | 259 |
| 191 | 3300005354 | Ga0070675_100724106 | Ga0070675_1007241061 | 259 |
| 192 | 3300005364 | Ga0070673_100186525 | Ga0070673_1001865252 | 259 |
| 193 | 3300005366 | Ga0070659_100000810 | Ga0070659_10000081017 | 259 |
| 194 | 3300005366 | Ga0070659_100185534 | Ga0070659_1001855342 | 259 |
| 195 | 3300005367 | Ga0070667_100012564 | Ga0070667_1000125644 | 259 |
| 196 | 3300005455 | Ga0070663_100003696 | Ga0070663_1000036966 | 259 |
| 197 | 3300005457 | Ga0070662_100176112 | Ga0070662_1001761122 | 259 |
| 198 | 3300005539 | Ga0068853_100184389 | Ga0068853_1001843892 | 259 |
| 199 | 3300005544 | Ga0070686_100480789 | Ga0070686_1004807891 | 259 |
| 200 | 3300005563 | Ga0068855_100003190 | Ga0068855_10000319016 | 259 |
| 201 | 3300005563 | Ga0068855_100310013 | Ga0068855_1003100131 | 259 |
| 202 | 3300005563 | Ga0068855_100671733 | Ga0068855_1006717331 | 259 |
| 203 | 3300005577 | Ga0068857_100002772 | Ga0068857_1000027728 | 259 |
| 204 | 3300005578 | Ga0068854_100036035 | Ga0068854_1000360353 | 259 |
| 205 | 3300005614 | Ga0068856_100005191 | Ga0068856_1000051918 | 259 |
| 206 | 3300005614 | Ga0068856_100217557 | Ga0068856_1002175572 | 259 |
| 207 | 3300005616 | Ga0068852_100023344 | Ga0068852_1000233444 | 259 |
| 208 | 3300005616 | Ga0068852_100046112 | Ga0068852_1000461121 | 259 |
| 209 | 3300005617 | Ga0068859_100000362 | Ga0068859_10000036228 | 259 |
| 210 | 3300005841 | Ga0068863_100072664 | Ga0068863_1000726644 | 259 |
| 211 | 3300005842 | Ga0068858_100006085 | Ga0068858_1000060852 | 259 |
| 212 | 3300006931 | Ga0097620_100000362 | Ga0097620_1000003625 | 259 |
| 213 | 3300009092 | Ga0105250_10102335 | Ga0105250_101023352 | 259 |
| 214 | 3300009093 | Ga0105240_10057240 | Ga0105240_100572402 | 259 |
| 215 | 3300009101 | Ga0105247_10000668 | Ga0105247_100006682 | 259 |
| 216 | 3300009177 | Ga0105248_10179313 | Ga0105248_101793132 | 259 |
| 217 | 3300013104 | Ga0157370_10040534 | Ga0157370_100405342 | 259 |
| 218 | 3300013307 | Ga0157372_10190501 | Ga0157372_101905012 | 259 |
| 219 | 3300014325 | Ga0163163_10040336 | Ga0163163_100403363 | 259 |
| 220 | 3300014968 | Ga0157379_10368635 | Ga0157379_103686351 | 259 |
| 221 | 3300025900 | Ga0207710_10000722 | Ga0207710_1000072215 | 259 |
| 222 | 3300025904 | Ga0207647_10016570 | Ga0207647_100165703 | 259 |
| 223 | 3300025904 | Ga0207647_10097860 | Ga0207647_100978602 | 259 |
| 224 | 3300025909 | Ga0207705_10000033 | Ga0207705_10000033183 | 259 |
| 225 | 3300025913 | Ga0207695_10005885 | Ga0207695_100058856 | 259 |
| 226 | 3300025919 | Ga0207657_10012995 | Ga0207657_100129955 | 259 |
| 227 | 3300025920 | Ga0207649_10000444 | Ga0207649_100004446 | 259 |
| 228 | 3300025920 | Ga0207649_10150907 | Ga0207649_101509072 | 259 |
| 229 | 3300025925 | Ga0207650_10006698 | Ga0207650_100066985 | 259 |
| 230 | 3300025931 | Ga0207644_10062614 | Ga0207644_100626142 | 259 |
| 231 | 3300025932 | Ga0207690_10017616 | Ga0207690_100176165 | 259 |
| 232 | 3300025932 | Ga0207690_10050663 | Ga0207690_100506631 | 259 |
| 233 | 3300025944 | Ga0207661_10035454 | Ga0207661_100354543 | 259 |
| 234 | 3300025949 | Ga0207667_10003597 | Ga0207667_1000359712 | 259 |
| 235 | 3300025949 | Ga0207667_10014552 | Ga0207667_100145525 | 259 |
| 236 | 3300025961 | Ga0207712_10106552 | Ga0207712_101065522 | 259 |
| 237 | 3300025981 | Ga0207640_10524208 | Ga0207640_105242081 | 259 |
| 238 | 3300025986 | Ga0207658_10074556 | Ga0207658_100745562 | 259 |
| 239 | 3300026035 | Ga0207703_10008571 | Ga0207703_100085713 | 259 |
| 240 | 3300026067 | Ga0207678_10002610 | Ga0207678_1000261015 | 259 |
| 241 | 3300026067 | Ga0207678_10003964 | Ga0207678_100039647 | 259 |
| 242 | 3300026078 | Ga0207702_10005553 | Ga0207702_100055537 | 259 |
| 243 | 3300026078 | Ga0207702_10098275 | Ga0207702_100982752 | 259 |
| 244 | 3300026088 | Ga0207641_10121415 | Ga0207641_101214153 | 259 |
| 245 | 3300026095 | Ga0207676_10382685 | Ga0207676_103826852 | 259 |
| 246 | 3300026116 | Ga0207674_10000057 | Ga0207674_1000005773 | 259 |
| 247 | 3300026116 | Ga0207674_10019526 | Ga0207674_100195264 | 259 |
| 248 | 3300026118 | Ga0207675_100326559 | Ga0207675_1003265591 | 259 |
| 249 | 3300026142 | Ga0207698_10022359 | Ga0207698_100223593 | 259 |
| 250 | 3300026142 | Ga0207698_10030988 | Ga0207698_100309884 | 259 |
| 251 | 3300030521 | Ga0307511_10000640 | Ga0307511_1000064030 | 259 |
| 252 | 3300031507 | Ga0307509_10175224 | Ga0307509_101752242 | 259 |
| 253 | 3300037418 | Ga0395900_0000605 | Ga0395900_0000605_6591_7382 | 259 |
| 254 | 3300037418 | Ga0395900_0008897 | Ga0395900_0008897_1284_2075 | 259 |
| 255 | 3300037418 | Ga0395900_0019364 | Ga0395900_0019364_1844_2635 | 259 |
| 256 | 3300037418 | Ga0395900_0033951 | Ga0395900_0033951_2996_3787 | 259 |
| 257 | 3300037418 | Ga0395900_0163059 | Ga0395900_0163059_350_1141 | 259 |
| 258 | 3300037466 | Ga0395898_0012983 | Ga0395898_0012983_3428_4219 | 259 |
| 259 | 3300037466 | Ga0395898_0113620 | Ga0395898_0113620_295_1086 | 259 |
| 260 | 3300037471 | Ga0395905_0001467 | Ga0395905_0001467_18057_18848 | 259 |
| 261 | 3300037471 | Ga0395905_0003610 | Ga0395905_0003610_14184_14975 | 259 |
| 262 | 3300037471 | Ga0395905_0051307 | Ga0395905_0051307_289_1080 | 259 |
| 263 | 3300037471 | Ga0395905_0060309 | Ga0395905_0060309_2051_2842 | 259 |
| 264 | 3300037471 | Ga0395905_0095909 | Ga0395905_0095909_1072_1863 | 259 |
| 265 | 3300037471 | Ga0395905_0152092 | Ga0395905_0152092_986_1777 | 259 |
| 266 | 3300037471 | Ga0395905_0467183 | Ga0395905_0467183_209_1000 | 259 |
| 267 | 3300038443 | Ga0395901_0025651 | Ga0395901_0025651_4679_5470 | 259 |
| 268 | 3300038443 | Ga0395901_0030991 | Ga0395901_0030991_4675_5466 | 259 |
| 269 | 3300038443 | Ga0395901_0034730 | Ga0395901_0034730_3513_4304 | 259 |
| 270 | 3300038443 | Ga0395901_0081356 | Ga0395901_0081356_1763_2554 | 259 |
| 271 | 3300038443 | Ga0395901_0219543 | Ga0395901_0219543_1150_1941 | 259 |
| 272 | 3300042005 | Ga0439448_0047020 | Ga0439448_0047020_27_818 | 259 |
| 273 | 3300042005 | Ga0439448_0056003 | Ga0439448_0056003_214_1005 | 259 |
| 274 | 3300042012 | Ga0439455_0005311 | Ga0439455_0005311_668_1459 | 259 |
| 275 | 3300042157 | Ga0439458_0001159 | Ga0439458_0001159_2815_3606 | 259 |
| 276 | 3300042157 | Ga0439458_0002905 | Ga0439458_0002905_1903_2694 | 259 |
| 277 | 3300044656 | Ga0466969_0007957 | Ga0466969_0007957_2293_3084 | 259 |
| 278 | 3300044684 | Ga0466966_0001152 | Ga0466966_0001152_12110_12901 | 259 |
| 279 | 3300044684 | Ga0466966_0005216 | Ga0466966_0005216_45_836 | 259 |
| 280 | 3300044684 | Ga0466966_0175296 | Ga0466966_0175296_495_1289 | 259 |
| 281 | 3300044693 | Ga0466961_0116630 | Ga0466961_0116630_226_1020 | 259 |
| 282 | 3300044694 | Ga0466963_0001344 | Ga0466963_0001344_6254_7045 | 259 |
| 283 | 3300044719 | Ga0466971_0010080 | Ga0466971_0010080_3326_4117 | 259 |
| 284 | 3300044765 | Ga0466970_0001624 | Ga0466970_0001624_9040_9831 | 259 |
| 285 | 3300044842 | Ga0466957_0004917 | Ga0466957_0004917_3419_4210 | 259 |
| 286 | 3300045049 | Ga0466959_0014526 | Ga0466959_0014526_1818_2612 | 259 |
| 287 | 3300045049 | Ga0466959_0065384 | Ga0466959_0065384_1833_2624 | 259 |
| 288 | 3300045049 | Ga0466959_0469082 | Ga0466959_0469082_45_836 | 259 |
| 289 | 3300045836 | Ga0466958_0000774 | Ga0466958_0000774_3090_3881 | 259 |
| 290 | 3300048924 | Ga0496121_0076653 | Ga0496121_0076653_1413_2216 | 259 |
| 291 | 3300053096 | Ga0500641_0019654 | Ga0500641_0019654_605_1396 | 259 |
| 292 | 3300053146 | Ga0500588_0026626 | Ga0500588_0026626_154_945 | 259 |
| 293 | 3300053178 | Ga0500637_0005297 | Ga0500637_0005297_1563_2369 | 259 |
| 294 | 3300061719 | Ga0466962_0005161 | Ga0466962_0005161_2561_3352 | 259 |
| 295 | iso_pu_bacteria | 2643221622 | 2644128814 | 259 |
| 296 | 3300001990 | JGI24737J22298_10021360 | JGI24737J22298_100213602 | 260 |
| 297 | 3300002987 | JGI25159J45721_1003057 | JGI25159J45721_10030573 | 260 |
| 298 | 3300003762 | Ga0055542_1006686 | Ga0055542_10066862 | 260 |
| 299 | 3300004625 | Ga0055543_1003246 | Ga0055543_10032465 | 260 |
| 300 | 3300005262 | Ga0065165_1000051 | Ga0065165_1000051104 | 260 |
| 301 | 3300005328 | Ga0070676_10001114 | Ga0070676_100011148 | 260 |
| 302 | 3300005334 | Ga0068869_100001804 | Ga0068869_1000018048 | 260 |
| 303 | 3300005338 | Ga0068868_100000496 | Ga0068868_1000004968 | 260 |
| 304 | 3300005364 | Ga0070673_100000020 | Ga0070673_1000000208 | 260 |
| 305 | 3300005455 | Ga0070663_100279104 | Ga0070663_1002791042 | 260 |
| 306 | 3300005459 | Ga0068867_100000205 | Ga0068867_10000020518 | 260 |
| 307 | 3300005548 | Ga0070665_100088481 | Ga0070665_1000884813 | 260 |
| 308 | 3300005578 | Ga0068854_100000790 | Ga0068854_1000007906 | 260 |
| 309 | 3300005842 | Ga0068858_100008824 | Ga0068858_1000088244 | 260 |
| 310 | 3300006881 | Ga0068865_100000126 | Ga0068865_10000012618 | 260 |
| 311 | 3300009093 | Ga0105240_10005910 | Ga0105240_100059107 | 260 |
| 312 | 3300009098 | Ga0105245_10000421 | Ga0105245_100004218 | 260 |
| 313 | 3300009148 | Ga0105243_10001343 | Ga0105243_100013438 | 260 |
| 314 | 3300009176 | Ga0105242_10000155 | Ga0105242_1000015528 | 260 |
| 315 | 3300009553 | Ga0105249_10013745 | Ga0105249_100137452 | 260 |
| 316 | 3300011119 | Ga0105246_10001606 | Ga0105246_100016068 | 260 |
| 317 | 3300013100 | Ga0157373_10014302 | Ga0157373_100143025 | 260 |
| 318 | 3300013102 | Ga0157371_10115858 | Ga0157371_101158582 | 260 |
| 319 | 3300013104 | Ga0157370_10070578 | Ga0157370_100705782 | 260 |
| 320 | 3300013105 | Ga0157369_10045471 | Ga0157369_100454713 | 260 |
| 321 | 3300013105 | Ga0157369_10065154 | Ga0157369_100651544 | 260 |
| 322 | 3300013296 | Ga0157374_10001229 | Ga0157374_100012298 | 260 |
| 323 | 3300013297 | Ga0157378_10002458 | Ga0157378_100024588 | 260 |
| 324 | 3300013307 | Ga0157372_10061058 | Ga0157372_100610582 | 260 |
| 325 | 3300013308 | Ga0157375_10003161 | Ga0157375_100031616 | 260 |
| 326 | 3300014969 | Ga0157376_10000233 | Ga0157376_1000023317 | 260 |
| 327 | 3300025254 | Ga0209148_1000318 | Ga0209148_100031812 | 260 |
| 328 | 3300025284 | Ga0209130_1000063 | Ga0209130_100006393 | 260 |
| 329 | 3300025907 | Ga0207645_10002854 | Ga0207645_100028544 | 260 |
| 330 | 3300025913 | Ga0207695_10003379 | Ga0207695_100033792 | 260 |
| 331 | 3300025934 | Ga0207686_10000492 | Ga0207686_100004928 | 260 |
| 332 | 3300025935 | Ga0207709_10000359 | Ga0207709_1000035923 | 260 |
| 333 | 3300025938 | Ga0207704_10000048 | Ga0207704_100000488 | 260 |
| 334 | 3300025942 | Ga0207689_10001300 | Ga0207689_100013008 | 260 |
| 335 | 3300025960 | Ga0207651_10000001 | Ga0207651_100000019 | 260 |
| 336 | 3300025961 | Ga0207712_10074278 | Ga0207712_100742782 | 260 |
| 337 | 3300025981 | Ga0207640_10000447 | Ga0207640_1000044719 | 260 |
| 338 | 3300026023 | Ga0207677_10000125 | Ga0207677_1000012542 | 260 |
| 339 | 3300026035 | Ga0207703_10001429 | Ga0207703_1000142914 | 260 |
| 340 | 3300026067 | Ga0207678_10079436 | Ga0207678_100794362 | 260 |
| 341 | 3300026078 | Ga0207702_10001866 | Ga0207702_1000186610 | 260 |
| 342 | 3300026089 | Ga0207648_10000633 | Ga0207648_1000063317 | 260 |
| 343 | 3300028379 | Ga0268266_10171976 | Ga0268266_101719763 | 260 |
| 344 | 3300031456 | Ga0307513_10005107 | Ga0307513_1000510711 | 260 |
| 345 | 3300031456 | Ga0307513_10058134 | Ga0307513_100581344 | 260 |
| 346 | 3300031456 | Ga0307513_10058920 | Ga0307513_100589204 | 260 |
| 347 | 3300037312 | Ga0395899_0000018 | Ga0395899_0000018_384755_385552 | 260 |
| 348 | 3300037312 | Ga0395899_0035235 | Ga0395899_0035235_1660_2463 | 260 |
| 349 | 3300037418 | Ga0395900_0154418 | Ga0395900_0154418_38_844 | 260 |
| 350 | 3300037418 | Ga0395900_0238959 | Ga0395900_0238959_676_1479 | 260 |
| 351 | 3300037466 | Ga0395898_0066897 | Ga0395898_0066897_561_1364 | 260 |
| 352 | 3300038443 | Ga0395901_0125823 | Ga0395901_0125823_1718_2521 | 260 |
| 353 | 3300038443 | Ga0395901_0583208 | Ga0395901_0583208_189_995 | 260 |
| 354 | 3300044683 | Ga0466965_0104981 | Ga0466965_0104981_481_1269 | 260 |
| 355 | 3300048929 | Ga0496126_0050901 | Ga0496126_0050901_2658_3467 | 260 |
| 356 | 3300049571 | Ga0501034_0779453 | Ga0501034_0779453_22_816 | 260 |
| 357 | 3300053156 | Ga0500622_0009443 | Ga0500622_0009443_2827_3624 | 260 |
| 358 | 3300005356 | Ga0070674_100006094 | Ga0070674_1000060945 | 261 |
| 359 | 3300005456 | Ga0070678_100000254 | Ga0070678_10000025416 | 261 |
| 360 | 3300005543 | Ga0070672_100007102 | Ga0070672_1000071024 | 261 |
| 361 | 3300009098 | Ga0105245_10004388 | Ga0105245_1000438819 | 261 |
| 362 | 3300009148 | Ga0105243_10000441 | Ga0105243_1000044128 | 261 |
| 363 | 3300009148 | Ga0105243_10078042 | Ga0105243_100780423 | 261 |
| 364 | 3300013100 | Ga0157373_10138531 | Ga0157373_101385312 | 261 |
| 365 | 3300013296 | Ga0157374_10083234 | Ga0157374_100832343 | 261 |
| 366 | 3300013297 | Ga0157378_10308070 | Ga0157378_103080702 | 261 |
| 367 | 3300013306 | Ga0163162_10229434 | Ga0163162_102294342 | 261 |
| 368 | 3300014969 | Ga0157376_10153487 | Ga0157376_101534872 | 261 |
| 369 | 3300025940 | Ga0207691_10089487 | Ga0207691_100894873 | 261 |
| 370 | 3300031665 | Ga0316575_10004036 | Ga0316575_100040364 | 261 |
| 371 | 3300046492 | Ga0495585_0001044 | Ga0495585_0001044_21708_22502 | 261 |
| 372 | 3300046524 | Ga0495648_0000097 | Ga0495648_0000097_64582_65388 | 261 |
| 373 | 3300046660 | Ga0495625_0000496 | Ga0495625_0000496_48185_48979 | 261 |
| 374 | 3300048905 | Ga0496102_0000261 | Ga0496102_0000261_25112_25918 | 261 |
| 375 | 3300048906 | Ga0496103_0000052 | Ga0496103_0000052_42425_43231 | 261 |
| 376 | 3300048908 | Ga0496105_0000173 | Ga0496105_0000173_12380_13186 | 261 |
| 377 | 3300048910 | Ga0496107_0028471 | Ga0496107_0028471_1393_2199 | 261 |
| 378 | 3300048913 | Ga0496110_0002413 | Ga0496110_0002413_9370_10176 | 261 |
| 379 | 3300048914 | Ga0496111_0009793 | Ga0496111_0009793_234_1040 | 261 |
| 380 | 3300048917 | Ga0496114_0018135 | Ga0496114_0018135_3654_4460 | 261 |
| 381 | 3300048918 | Ga0496115_0000086 | Ga0496115_0000086_25059_25865 | 261 |
| 382 | 3300048919 | Ga0496116_0003600 | Ga0496116_0003600_4732_5538 | 261 |
| 383 | 3300048920 | Ga0496117_0000141 | Ga0496117_0000141_114810_115616 | 261 |
| 384 | 3300048921 | Ga0496118_0000103 | Ga0496118_0000103_114868_115674 | 261 |
| 385 | 3300048922 | Ga0496119_0008218 | Ga0496119_0008218_7856_8662 | 261 |
| 386 | 3300048923 | Ga0496120_0010715 | Ga0496120_0010715_4312_5118 | 261 |
| 387 | 3300048924 | Ga0496121_0000156 | Ga0496121_0000156_42407_43213 | 261 |
| 388 | 3300048927 | Ga0496124_0000041 | Ga0496124_0000041_44298_45104 | 261 |
| 389 | 3300048929 | Ga0496126_0000155 | Ga0496126_0000155_114862_115668 | 261 |
| 390 | 3300005262 | Ga0065165_1018532 | Ga0065165_10185323 | 262 |
| 391 | 3300005366 | Ga0070659_100008071 | Ga0070659_1000080716 | 262 |
| 392 | 3300005455 | Ga0070663_100007983 | Ga0070663_1000079833 | 262 |
| 393 | 3300009551 | Ga0105238_10014791 | Ga0105238_100147912 | 262 |
| 394 | 3300010375 | Ga0105239_10213012 | Ga0105239_102130122 | 262 |
| 395 | 3300013100 | Ga0157373_10304199 | Ga0157373_103041991 | 262 |
| 396 | 3300013102 | Ga0157371_10004390 | Ga0157371_100043908 | 262 |
| 397 | 3300013104 | Ga0157370_10060640 | Ga0157370_100606403 | 262 |
| 398 | 3300013105 | Ga0157369_10000043 | Ga0157369_10000043118 | 262 |
| 399 | 3300013105 | Ga0157369_10004830 | Ga0157369_1000483012 | 262 |
| 400 | 3300014325 | Ga0163163_10017234 | Ga0163163_100172341 | 262 |
| 401 | 3300025924 | Ga0207694_10206508 | Ga0207694_102065082 | 262 |
| 402 | 3300031616 | Ga0307508_10001949 | Ga0307508_1000194918 | 262 |
| 403 | 3300037312 | Ga0395899_0015001 | Ga0395899_0015001_1335_2150 | 262 |
| 404 | 3300037312 | Ga0395899_0016349 | Ga0395899_0016349_2669_3475 | 262 |
| 405 | 3300037312 | Ga0395899_0245627 | Ga0395899_0245627_372_1199 | 262 |
| 406 | 3300037312 | Ga0395899_0246013 | Ga0395899_0246013_52_879 | 262 |
| 407 | 3300037418 | Ga0395900_0018552 | Ga0395900_0018552_1436_2251 | 262 |
| 408 | 3300037418 | Ga0395900_0125476 | Ga0395900_0125476_98_913 | 262 |
| 409 | 3300037418 | Ga0395900_0404451 | Ga0395900_0404451_416_1231 | 262 |
| 410 | 3300037418 | Ga0395900_0409782 | Ga0395900_0409782_370_1173 | 262 |
| 411 | 3300037466 | Ga0395898_0004872 | Ga0395898_0004872_11285_12091 | 262 |
| 412 | 3300037471 | Ga0395905_0000967 | Ga0395905_0000967_13886_14713 | 262 |
| 413 | 3300037471 | Ga0395905_0001987 | Ga0395905_0001987_10291_11112 | 262 |
| 414 | 3300037471 | Ga0395905_0056825 | Ga0395905_0056825_699_1514 | 262 |
| 415 | 3300037471 | Ga0395905_0126297 | Ga0395905_0126297_584_1411 | 262 |
| 416 | 3300038443 | Ga0395901_0018936 | Ga0395901_0018936_5515_6330 | 262 |
| 417 | 3300038443 | Ga0395901_0028548 | Ga0395901_0028548_2632_3459 | 262 |
| 418 | 3300038443 | Ga0395901_0098238 | Ga0395901_0098238_55_948 | 262 |
| 419 | 3300038443 | Ga0395901_0551798 | Ga0395901_0551798_184_1005 | 262 |
| 420 | 3300041404 | Ga0439436_0015818 | Ga0439436_0015818_702_1490 | 262 |
| 421 | 3300041410 | Ga0439461_0000938 | Ga0439461_0000938_2475_3263 | 262 |
| 422 | 3300041413 | Ga0439465_0000889 | Ga0439465_0000889_6973_7761 | 262 |
| 423 | 3300041997 | Ga0439431_0000346 | Ga0439431_0000346_1959_2747 | 262 |
| 424 | 3300042004 | Ga0439445_0002563 | Ga0439445_0002563_2760_3548 | 262 |
| 425 | 3300042006 | Ga0439432_011589 | Ga0439432_011589_2084_2872 | 262 |
| 426 | 3300042015 | Ga0439462_0000664 | Ga0439462_0000664_1939_2727 | 262 |
| 427 | 3300042435 | Ga0439434_0002510 | Ga0439434_0002510_2068_2856 | 262 |
| 428 | 3300044694 | Ga0466963_0022717 | Ga0466963_0022717_2544_3359 | 262 |
| 429 | 3300046460 | Ga0495638_0000134 | Ga0495638_0000134_94427_95230 | 262 |
| 430 | 3300046660 | Ga0495625_0189068 | Ga0495625_0189068_121_987 | 262 |
| 431 | 3300048910 | Ga0496107_0178241 | Ga0496107_0178241_397_1224 | 262 |
| 432 | 3300053094 | Ga0500566_0002505 | Ga0500566_0002505_5592_6380 | 262 |
| 433 | 3300053096 | Ga0500641_0008436 | Ga0500641_0008436_2600_3415 | 262 |
| 434 | 3300053134 | Ga0500658_0003604 | Ga0500658_0003604_2821_3687 | 262 |
| 435 | 3300053146 | Ga0500588_0010465 | Ga0500588_0010465_600_1520 | 262 |
| 436 | 3300000041 | ARcpr5oldR_c003356 | ARcpr5oldR_0033562 | 263 |
| 437 | 3300003773 | Ga0055537_1001600 | Ga0055537_10016002 | 263 |
| 438 | 3300003775 | Ga0055524_1000345 | Ga0055524_100034515 | 263 |
| 439 | 3300003791 | Ga0055530_10000061 | Ga0055530_1000006112 | 263 |
| 440 | 3300003794 | Ga0055531_10000035 | Ga0055531_1000003544 | 263 |
| 441 | 3300003794 | Ga0055531_10003469 | Ga0055531_100034693 | 263 |
| 442 | 3300005262 | Ga0065165_1021190 | Ga0065165_10211902 | 263 |
| 443 | 3300005366 | Ga0070659_100081335 | Ga0070659_1000813353 | 263 |
| 444 | 3300006948 | Ga0099826_10113760 | Ga0099826_101137602 | 263 |
| 445 | 3300025245 | Ga0207425_1020676 | Ga0207425_10206761 | 263 |
| 446 | 3300025263 | Ga0209565_1000008 | Ga0209565_1000008271 | 263 |
| 447 | 3300025273 | Ga0209673_1002083 | Ga0209673_10020836 | 263 |
| 448 | 3300025291 | Ga0209675_1028851 | Ga0209675_10288512 | 263 |
| 449 | 3300025297 | Ga0209758_1004526 | Ga0209758_10045264 | 263 |
| 450 | 3300025298 | Ga0209050_1000014 | Ga0209050_1000014406 | 263 |
| 451 | 3300025299 | Ga0209256_1000009 | Ga0209256_1000009599 | 263 |
| 452 | 3300025299 | Ga0209256_1000010 | Ga0209256_1000010523 | 263 |
| 453 | 3300025304 | Ga0209257_1000019 | Ga0209257_1000019286 | 263 |
| 454 | 3300025304 | Ga0209257_1003277 | Ga0209257_10032775 | 263 |
| 455 | 3300027666 | Ga0209282_1090715 | Ga0209282_10907151 | 263 |
| 456 | 3300041406 | Ga0439439_0008024 | Ga0439439_0008024_1589_2380 | 263 |
| 457 | 3300041997 | Ga0439431_0008316 | Ga0439431_0008316_891_1682 | 263 |
| 458 | 3300041999 | Ga0439433_0065294 | Ga0439433_0065294_43_834 | 263 |
| 459 | 3300042156 | Ga0439446_0021021 | Ga0439446_0021021_953_1744 | 263 |
| 460 | 3300042185 | Ga0450909_014968 | Ga0450909_014968_287_1078 | 263 |
| 461 | 3300046453 | Ga0495627_080399 | Ga0495627_080399_67_858 | 263 |
| 462 | 3300046691 | Ga0495670_0000014 | Ga0495670_0000014_131891_132724 | 263 |
| 463 | 3300047470 | Ga0495681_0094429 | Ga0495681_0094429_334_1125 | 263 |
| 464 | 3300053108 | Ga0500562_027992 | Ga0500562_027992_509_1342 | 263 |
| 465 | 3300053134 | Ga0500658_0000562 | Ga0500658_0000562_12242_13033 | 263 |
| 466 | 3300053134 | Ga0500658_0002294 | Ga0500658_0002294_2007_2798 | 263 |
| 467 | 3300053139 | Ga0500568_0019335 | Ga0500568_0019335_1700_2491 | 263 |
| 468 | 3300053730 | Ga0500645_000777 | Ga0500645_000777_4655_5491 | 263 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4awx-assembly1.cif.gz_B | moonlighting functions of feoc in the regulation of ferrous iron transport in feo | 0.9211 | 23 | 77 |
| 4wcg-assembly1.cif.gz_B | the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna | 0.9107 | 21 | 78 |
| 5n07-assembly1.cif.gz_A-2 | structure of the [4fe-4s] form of the no response regulator nsrr | 0.9055 | 17 | 80 |
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9002 | 23 | 78 |
| 4wcg-assembly1.cif.gz_A | the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna | 0.8833 | 21 | 78 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77569_1_73_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9477 | 16 | 78 | 1.10.10.10 |
| af_P77732_3_78_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9353 | 16 | 85 | 1.10.10.10 |
| af_P76268_11_86_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9227 | 16 | 87 | 1.10.10.10 |
| 4ijaB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9216 | 23 | 78 | 1.10.10.10 |
| 4awxB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9211 | 23 | 77 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A239PVD5-F1-model_v4 | Transcriptional regulator, IclR family | 0.8989 | 6 | 258 |
GO:0003677
GO:0003700 GO:0045892 |
| AF-A0A1I6VGX8-F1-model_v4 | Transcriptional regulator, IclR family | 0.8682 | 15 | 257 |
GO:0003677
GO:0003700 GO:0045892 |
| AF-A0A239PVD5-F1-model_v4 | Transcriptional regulator, IclR family | 0.8644 | 6 | 258 |
GO:0003677
GO:0003700 GO:0045892 |
| AF-A0A3S2AT97-F1-model_v4 | IclR family transcriptional regulator | 0.8608 | 64 | 261 |
GO:0003677
GO:0003700 GO:0045892 |
| AF-A0A3L8Q277-F1-model_v4 | IclR family transcriptional regulator | 0.8493 | 15 | 260 |
GO:0003677
GO:0003700 GO:0045892 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar