F450138

General Info

Members Datasets Scaffolds Average Seq Length
468 262 465 264

Family's Representative Sequence

Representative Sequence 3300053146|Ga0500588_0010465|Ga0500588_0010465_600_1520
Length 306
Sequence VKRSPEAFDSRVRNCVLLSLLANAPRSDENRHEPPMKKATVVTDESNEIDDDSVSERRYRAPALEKGLEILELLAGEARAMPLSAIGQRLGRSTNELFRMMQVLQYKGFIDQEAGGGYRLTDKLFSLGMEQPRTRNLLEVALPAMRQLAVTIGQSCHLAVHSKGQIVVIARMESDEQIGFTVRVGYRRSLLNTTSGAVLYSYQNADTRKRWAAMWEPQPPEQEVAAFQRRCDSIRGRGHEMAVSNFVAGVTDISAPVMRGGQAAAALTVPFVHSSPLRLPMAETVGHIEAAAREISEQLLRSDSRV

Samples

Sample ID Description Type Environment
1 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
2 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
3 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
6 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
97 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
98 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
155 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
169 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
170 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
171 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
172 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
173 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
174 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
175 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
176 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
177 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
178 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
179 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
180 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
181 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
182 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
201 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
202 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
203 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
204 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
205 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
206 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
207 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
208 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
215 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
216 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
219 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
220 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
221 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
222 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
223 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
224 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
236 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
237 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
238 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
239 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
242 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
248 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
249 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
250 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
251 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
252 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
253 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
254 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
255 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
256 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
257 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
258 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
259 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
260 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
261 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
262 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.97
Nodule 0.43
Rhizoplane 2.35
Rhizosphere 79.06
Stem 0
Stem Tuber 0
Unclassified 6.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c003356 3300000041 Bacteria 1426
2 JGI24736J21556_1001759 3300001904 Bacteria 3904
3 JGI24741J21665_1000192 3300001915 Bacteria 17936
4 JGI24740J21852_10001303 3300001979 Bacteria 11343
5 JGI24739J22299_10028129 3300001989 Bacteria 1962
6 JGI24737J22298_10000764 3300001990 Bacteria 11363
7 JGI24737J22298_10001431 3300001990 Bacteria 8495
8 JGI24737J22298_10021360 3300001990 Bacteria 2063
9 JGI24737J22298_10050002 3300001990 Bacteria 1271
10 JGI24738J21930_10003405 3300002075 Bacteria 4014
11 JGI24742J22300_10003082 3300002244 Bacteria 2697
12 JGI25159J45721_1003057 3300002987 Bacteria 6052
13 rootH1_10001452 3300003323 Bacteria 24345
14 rootH1_10014040 3300003323 Bacteria 37606
15 Ga0055525_1000096 3300003759 Bacteria 137836
16 Ga0055542_1000012 3300003762 Bacteria 391808
17 Ga0055542_1006686 3300003762 Bacteria 2433
18 Ga0055529_1000002 3300003763 Bacteria 537914
19 Ga0055529_1000021 3300003763 Bacteria 321484
20 Ga0055537_1001600 3300003773 Bacteria 8535
21 Ga0055524_1000345 3300003775 Bacteria 42426
22 Ga0055530_10000061 3300003791 Bacteria 95363
23 Ga0055531_10000035 3300003794 Bacteria 147414
24 Ga0055531_10003469 3300003794 Bacteria 10032
25 Ga0055543_1003246 3300004625 Bacteria 4921
26 Ga0065165_1000051 3300005262 Bacteria 194844
27 Ga0065165_1016766 3300005262 Bacteria 2729
28 Ga0065165_1018532 3300005262 Bacteria 2517
29 Ga0065165_1021190 3300005262 Bacteria 2264
30 Ga0070658_10005243 3300005327 Bacteria 10531
31 Ga0070676_10001114 3300005328 Bacteria 13419
32 Ga0070683_100053362 3300005329 Bacteria 3746
33 Ga0070670_100022078 3300005331 Bacteria 5478
34 Ga0070677_10089713 3300005333 Bacteria 1334
35 Ga0068869_100001804 3300005334 Bacteria 12852
36 Ga0068868_100000496 3300005338 Bacteria 26255
37 Ga0070660_100024003 3300005339 Bacteria 4522
38 Ga0070660_100196389 3300005339 Bacteria 1636
39 Ga0070661_100004931 3300005344 Bacteria 9187
40 Ga0070661_100015845 3300005344 Bacteria 5319
41 Ga0070668_100127681 3300005347 Bacteria 2038
42 Ga0070675_100724106 3300005354 Bacteria 907
43 Ga0070671_100276098 3300005355 Bacteria 1429
44 Ga0070674_100006094 3300005356 Bacteria 7012
45 Ga0070674_100015548 3300005356 Bacteria 4753
46 Ga0070673_100000020 3300005364 Bacteria 102632
47 Ga0070673_100186525 3300005364 Bacteria 1779
48 Ga0070673_100345314 3300005364 Bacteria 1320
49 Ga0070659_100000810 3300005366 Bacteria 22806
50 Ga0070659_100008071 3300005366 Bacteria 7676
51 Ga0070659_100081335 3300005366 Bacteria 2587
52 Ga0070659_100185534 3300005366 Bacteria 1708
53 Ga0070659_100187223 3300005366 Bacteria 1700
54 Ga0070667_100012564 3300005367 Bacteria 7002
55 Ga0070667_100241882 3300005367 Bacteria 1612
56 Ga0070713_100297276 3300005436 Bacteria 1486
57 Ga0070663_100000623 3300005455 Bacteria 18969
58 Ga0070663_100003696 3300005455 Bacteria 8872
59 Ga0070663_100003883 3300005455 Bacteria 8710
60 Ga0070663_100007983 3300005455 Bacteria 6487
61 Ga0070663_100279104 3300005455 Bacteria 1331
62 Ga0070678_100000254 3300005456 Bacteria 24734
63 Ga0070678_100455806 3300005456 Bacteria 1121
64 Ga0070662_100176112 3300005457 Bacteria 1683
65 Ga0068867_100000205 3300005459 Bacteria 39436
66 Ga0068853_100059614 3300005539 Bacteria 3297
67 Ga0068853_100184389 3300005539 Bacteria 1894
68 Ga0068853_100273955 3300005539 Bacteria 1554
69 Ga0070672_100007102 3300005543 Bacteria 7574
70 Ga0070686_100480789 3300005544 Bacteria 960
71 Ga0070665_100051841 3300005548 Bacteria 4115
72 Ga0070665_100088481 3300005548 Bacteria 3103
73 Ga0068855_100000183 3300005563 Bacteria 80725
74 Ga0068855_100003190 3300005563 Bacteria 20090
75 Ga0068855_100310013 3300005563 Bacteria 1746
76 Ga0068855_100671733 3300005563 Bacteria 1111
77 Ga0070664_100006941 3300005564 Bacteria 9125
78 Ga0068857_100002772 3300005577 Bacteria 14400
79 Ga0068854_100000151 3300005578 Bacteria 48172
80 Ga0068854_100000790 3300005578 Bacteria 18843
81 Ga0068854_100036035 3300005578 Bacteria 3466
82 Ga0068856_100005191 3300005614 Bacteria 12858
83 Ga0068856_100072975 3300005614 Bacteria 3398
84 Ga0068856_100217557 3300005614 Bacteria 1925
85 Ga0068852_100023344 3300005616 Bacteria 4977
86 Ga0068852_100046112 3300005616 Bacteria 3712
87 Ga0068859_100000362 3300005617 Bacteria 45197
88 Ga0068851_10005927 3300005834 Bacteria 5562
89 Ga0068870_10135958 3300005840 Unclassified 1433
90 Ga0068863_100072664 3300005841 Bacteria 3254
91 Ga0068858_100006085 3300005842 Bacteria 11771
92 Ga0068858_100008824 3300005842 Bacteria 9668
93 Ga0068858_100009417 3300005842 Bacteria 9320
94 Ga0068860_100072927 3300005843 Bacteria 3263
95 Ga0081539_10062308 3300005985 Bacteria 2039
96 Ga0070717_10021093 3300006028 Bacteria 5132
97 Ga0075369_10177140 3300006186 Bacteria 980
98 Ga0075366_10170371 3300006195 Bacteria 1321
99 Ga0097621_100017460 3300006237 Bacteria 5449
100 Ga0097621_100194272 3300006237 Bacteria 1759
101 Ga0068871_100008714 3300006358 Bacteria 7297
102 Ga0068865_100000126 3300006881 Bacteria 39451
103 Ga0097620_100000362 3300006931 Bacteria 45197
104 Ga0099826_10113760 3300006948 Bacteria 1607
105 Ga0105250_10102335 3300009092 Bacteria 1169
106 Ga0105240_10005910 3300009093 Bacteria 18125
107 Ga0105240_10057240 3300009093 Bacteria 4872
108 Ga0105240_10640739 3300009093 Bacteria 1166
109 Ga0105245_10000421 3300009098 Bacteria 39455
110 Ga0105245_10004388 3300009098 Bacteria 12484
111 Ga0105247_10000668 3300009101 Bacteria 27068
112 Ga0105243_10000441 3300009148 Bacteria 43295
113 Ga0105243_10001343 3300009148 Bacteria 21905
114 Ga0105243_10078042 3300009148 Bacteria 2695
115 Ga0105241_10000496 3300009174 Bacteria 29797
116 Ga0105241_10014164 3300009174 Bacteria 5843
117 Ga0105242_10000155 3300009176 Bacteria 50755
118 Ga0105248_10179313 3300009177 Bacteria 2387
119 Ga0105238_10014791 3300009551 Bacteria 7891
120 Ga0105238_10058335 3300009551 Bacteria 3869
121 Ga0105249_10013745 3300009553 Bacteria 7148
122 Ga0105239_10037903 3300010375 Bacteria 5282
123 Ga0105239_10075397 3300010375 Bacteria 3709
124 Ga0105239_10213012 3300010375 Bacteria 2166
125 Ga0105246_10001606 3300011119 Bacteria 13465
126 Ga0157373_10014302 3300013100 Bacteria 5819
127 Ga0157373_10016243 3300013100 Bacteria 5433
128 Ga0157373_10020574 3300013100 Bacteria 4794
129 Ga0157373_10138531 3300013100 Bacteria 1711
130 Ga0157373_10304199 3300013100 Bacteria 1132
131 Ga0157371_10002077 3300013102 Bacteria 19617
132 Ga0157371_10004390 3300013102 Bacteria 12331
133 Ga0157371_10115858 3300013102 Bacteria 1903
134 Ga0157370_10040534 3300013104 Bacteria 4496
135 Ga0157370_10060640 3300013104 Bacteria 3591
136 Ga0157370_10070578 3300013104 Bacteria 3297
137 Ga0157370_10085656 3300013104 Bacteria 2961
138 Ga0157369_10000043 3300013105 Bacteria 180713
139 Ga0157369_10004830 3300013105 Bacteria 15825
140 Ga0157369_10045471 3300013105 Bacteria 4775
141 Ga0157369_10065154 3300013105 Bacteria 3922
142 Ga0157369_10072322 3300013105 Bacteria 3701
143 Ga0157374_10001229 3300013296 Bacteria 21903
144 Ga0157374_10083234 3300013296 Bacteria 3040
145 Ga0157378_10002458 3300013297 Bacteria 16475
146 Ga0157378_10308070 3300013297 Unclassified 1535
147 Ga0163162_10229434 3300013306 Bacteria 1987
148 Ga0157372_10061058 3300013307 Bacteria 4219
149 Ga0157372_10096354 3300013307 Bacteria 3371
150 Ga0157372_10190501 3300013307 Bacteria 2376
151 Ga0157375_10003161 3300013308 Bacteria 14294
152 Ga0163163_10017234 3300014325 Bacteria 6733
153 Ga0163163_10040336 3300014325 Bacteria 4558
154 Ga0157379_10368635 3300014968 Bacteria 1317
155 Ga0157376_10000233 3300014969 Bacteria 38780
156 Ga0157376_10153487 3300014969 Bacteria 2079
157 Ga0163161_10086945 3300017792 Bacteria 2308
158 Ga0209674_111238 3300025226 Bacteria 920
159 Ga0209563_100058 3300025230 Bacteria 302571
160 Ga0207425_1020676 3300025245 Bacteria 1404
161 Ga0209026_1013104 3300025250 Bacteria 1421
162 Ga0209677_107172 3300025253 Bacteria 2435
163 Ga0209148_1000008 3300025254 Bacteria 1504371
164 Ga0209148_1000318 3300025254 Bacteria 67692
165 Ga0209565_1000008 3300025263 Bacteria 774179
166 Ga0209455_1000002 3300025272 Bacteria 1505459
167 Ga0209673_1002083 3300025273 Bacteria 15037
168 Ga0209130_1000063 3300025284 Bacteria 198142
169 Ga0209675_1028851 3300025291 Bacteria 1344
170 Ga0209758_1004526 3300025297 Bacteria 11514
171 Ga0209050_1000014 3300025298 Bacteria 774327
172 Ga0209256_1000009 3300025299 Bacteria 922071
173 Ga0209256_1000010 3300025299 Bacteria 912110
174 Ga0209257_1000019 3300025304 Bacteria 774261
175 Ga0209257_1003277 3300025304 Bacteria 14131
176 Ga0207656_10010773 3300025321 Bacteria 3436
177 Ga0207710_10000722 3300025900 Bacteria 18297
178 Ga0207688_10120586 3300025901 Bacteria 1530
179 Ga0207647_10016570 3300025904 Bacteria 5026
180 Ga0207647_10022357 3300025904 Bacteria 4201
181 Ga0207647_10097860 3300025904 Bacteria 1744
182 Ga0207645_10002854 3300025907 Bacteria 13402
183 Ga0207643_10106056 3300025908 Bacteria 1651
184 Ga0207705_10000033 3300025909 Bacteria 223997
185 Ga0207705_10000175 3300025909 Bacteria 68190
186 Ga0207654_10000020 3300025911 Bacteria 167053
187 Ga0207695_10003379 3300025913 Bacteria 22549
188 Ga0207695_10005885 3300025913 Bacteria 16087
189 Ga0207695_10011751 3300025913 Bacteria 10576
190 Ga0207671_10009369 3300025914 Bacteria 8189
191 Ga0207657_10011169 3300025919 Bacteria 8927
192 Ga0207657_10012995 3300025919 Bacteria 8184
193 Ga0207649_10000356 3300025920 Bacteria 34254
194 Ga0207649_10000444 3300025920 Bacteria 29932
195 Ga0207649_10150907 3300025920 Bacteria 1600
196 Ga0207694_10007150 3300025924 Bacteria 8484
197 Ga0207694_10206508 3300025924 Bacteria 1599
198 Ga0207650_10006698 3300025925 Bacteria 7855
199 Ga0207687_10000755 3300025927 Bacteria 21846
200 Ga0207700_10005386 3300025928 Bacteria 7644
201 Ga0207644_10062614 3300025931 Bacteria 2699
202 Ga0207690_10000063 3300025932 Bacteria 95620
203 Ga0207690_10017616 3300025932 Bacteria 4367
204 Ga0207690_10050663 3300025932 Bacteria 2773
205 Ga0207706_10046770 3300025933 Bacteria 3830
206 Ga0207686_10000492 3300025934 Bacteria 25942
207 Ga0207709_10000093 3300025935 Bacteria 139110
208 Ga0207709_10000359 3300025935 Bacteria 46099
209 Ga0207709_10038760 3300025935 Bacteria 2841
210 Ga0207669_10000543 3300025937 Bacteria 16413
211 Ga0207669_10003631 3300025937 Bacteria 6695
212 Ga0207704_10000048 3300025938 Bacteria 83529
213 Ga0207691_10089487 3300025940 Bacteria 2760
214 Ga0207691_10505789 3300025940 Bacteria 1026
215 Ga0207689_10001300 3300025942 Bacteria 24064
216 Ga0207661_10035454 3300025944 Bacteria 3888
217 Ga0207667_10000006 3300025949 Bacteria 679876
218 Ga0207667_10000007 3300025949 Bacteria 630590
219 Ga0207667_10003597 3300025949 Bacteria 19136
220 Ga0207667_10014552 3300025949 Bacteria 8963
221 Ga0207651_10000001 3300025960 Bacteria 516823
222 Ga0207651_10270511 3300025960 Bacteria 1399
223 Ga0207712_10074278 3300025961 Bacteria 2454
224 Ga0207712_10106552 3300025961 Bacteria 2094
225 Ga0207640_10000031 3300025981 Bacteria 120815
226 Ga0207640_10000447 3300025981 Bacteria 25145
227 Ga0207640_10001038 3300025981 Bacteria 15363
228 Ga0207640_10524208 3300025981 Bacteria 991
229 Ga0207658_10074556 3300025986 Bacteria 2578
230 Ga0207658_10361114 3300025986 Bacteria 1267
231 Ga0207677_10000125 3300026023 Bacteria 63161
232 Ga0207703_10001429 3300026035 Bacteria 21791
233 Ga0207703_10006205 3300026035 Bacteria 9564
234 Ga0207703_10008571 3300026035 Bacteria 8071
235 Ga0207639_10000785 3300026041 Bacteria 21614
236 Ga0207639_10423979 3300026041 Bacteria 1203
237 Ga0207678_10000225 3300026067 Bacteria 50510
238 Ga0207678_10001276 3300026067 Bacteria 23275
239 Ga0207678_10002610 3300026067 Bacteria 16424
240 Ga0207678_10003964 3300026067 Bacteria 13318
241 Ga0207678_10079436 3300026067 Bacteria 2809
242 Ga0207702_10001866 3300026078 Bacteria 20690
243 Ga0207702_10002347 3300026078 Bacteria 18064
244 Ga0207702_10005553 3300026078 Bacteria 11013
245 Ga0207702_10098275 3300026078 Bacteria 2578
246 Ga0207702_10583900 3300026078 Bacteria 1095
247 Ga0207641_10121415 3300026088 Bacteria 2332
248 Ga0207648_10000633 3300026089 Bacteria 39430
249 Ga0207676_10382685 3300026095 Bacteria 1310
250 Ga0207674_10000057 3300026116 Bacteria 113117
251 Ga0207674_10008800 3300026116 Bacteria 11622
252 Ga0207674_10019526 3300026116 Bacteria 7339
253 Ga0207675_100326559 3300026118 Unclassified 1499
254 Ga0207683_10000181 3300026121 Bacteria 54142
255 Ga0207698_10005364 3300026142 Bacteria 7913
256 Ga0207698_10022359 3300026142 Bacteria 4392
257 Ga0207698_10030988 3300026142 Bacteria 3855
258 Ga0209282_1090715 3300027666 Bacteria 1601
259 Ga0268266_10037280 3300028379 Bacteria 4143
260 Ga0268266_10171976 3300028379 Bacteria 1967
261 Ga0307517_10043627 3300028786 Bacteria 4770
262 Ga0307511_10000640 3300030521 Bacteria 37443
263 Ga0307513_10005107 3300031456 Bacteria 17372
264 Ga0307513_10041208 3300031456 Bacteria 5100
265 Ga0307513_10054436 3300031456 Bacteria 4290
266 Ga0307513_10058134 3300031456 Bacteria 4113
267 Ga0307513_10058920 3300031456 Bacteria 4078
268 Ga0307509_10175224 3300031507 Bacteria 2018
269 Ga0307408_100000044 3300031548 Bacteria 169498
270 Ga0307408_100000295 3300031548 Bacteria 48475
271 Ga0307508_10001949 3300031616 Bacteria 22585
272 Ga0316575_10004036 3300031665 Bacteria 5141
273 Ga0307414_10085110 3300032004 Bacteria 2328
274 Ga0307510_10039538 3300033180 Bacteria 5194
275 Ga0395899_0000018 3300037312 Bacteria 423194
276 Ga0395899_0015001 3300037312 Bacteria 5911
277 Ga0395899_0016349 3300037312 Bacteria 5655
278 Ga0395899_0034003 3300037312 Bacteria 3827
279 Ga0395899_0035235 3300037312 Bacteria 3757
280 Ga0395899_0245627 3300037312 Bacteria 1230
281 Ga0395899_0246013 3300037312 Unclassified 1229
282 Ga0395900_0000605 3300037418 Bacteria 49062
283 Ga0395900_0008897 3300037418 Bacteria 10306
284 Ga0395900_0018552 3300037418 Bacteria 7094
285 Ga0395900_0019364 3300037418 Bacteria 6943
286 Ga0395900_0033951 3300037418 Bacteria 5251
287 Ga0395900_0036433 3300037418 Bacteria 5072
288 Ga0395900_0101689 3300037418 Bacteria 2952
289 Ga0395900_0125476 3300037418 Bacteria 2632
290 Ga0395900_0154418 3300037418 Bacteria 2344
291 Ga0395900_0163059 3300037418 Bacteria 2273
292 Ga0395900_0225699 3300037418 Bacteria 1886
293 Ga0395900_0238959 3300037418 Bacteria 1823
294 Ga0395900_0404451 3300037418 Bacteria 1328
295 Ga0395900_0409782 3300037418 Bacteria 1318
296 Ga0395898_0004872 3300037466 Bacteria 14575
297 Ga0395898_0012983 3300037466 Bacteria 8589
298 Ga0395898_0066897 3300037466 Bacteria 3480
299 Ga0395898_0113620 3300037466 Bacteria 2595
300 Ga0395898_0123903 3300037466 Bacteria 2476
301 Ga0395898_0365504 3300037466 Bacteria 1376
302 Ga0395905_0000967 3300037471 Bacteria 36867
303 Ga0395905_0001467 3300037471 Bacteria 28279
304 Ga0395905_0001987 3300037471 Bacteria 23369
305 Ga0395905_0003610 3300037471 Bacteria 16445
306 Ga0395905_0010105 3300037471 Bacteria 9199
307 Ga0395905_0026421 3300037471 Bacteria 5474
308 Ga0395905_0051307 3300037471 Bacteria 3863
309 Ga0395905_0056825 3300037471 Bacteria 3660
310 Ga0395905_0060309 3300037471 Bacteria 3547
311 Ga0395905_0095909 3300037471 Unclassified 2784
312 Ga0395905_0126297 3300037471 Bacteria 2405
313 Ga0395905_0152092 3300037471 Bacteria 2177
314 Ga0395905_0194893 3300037471 Bacteria 1900
315 Ga0395905_0467183 3300037471 Bacteria 1160
316 Ga0395901_0018936 3300038443 Bacteria 7039
317 Ga0395901_0025651 3300038443 Bacteria 6051
318 Ga0395901_0028548 3300038443 Bacteria 5738
319 Ga0395901_0030991 3300038443 Bacteria 5512
320 Ga0395901_0034730 3300038443 Bacteria 5208
321 Ga0395901_0046465 3300038443 Bacteria 4510
322 Ga0395901_0081356 3300038443 Bacteria 3383
323 Ga0395901_0098238 3300038443 Bacteria 3070
324 Ga0395901_0125823 3300038443 Bacteria 2694
325 Ga0395901_0219543 3300038443 Bacteria 1987
326 Ga0395901_0551798 3300038443 Bacteria 1168
327 Ga0395901_0583208 3300038443 Unclassified 1129
328 Ga0439436_0015818 3300041404 Bacteria 2267
329 Ga0439439_0008024 3300041406 Bacteria 2481
330 Ga0439461_0000938 3300041410 Bacteria 4359
331 Ga0439465_0000889 3300041413 Bacteria 9445
332 Ga0439431_0000346 3300041997 Bacteria 9719
333 Ga0439431_0008316 3300041997 Bacteria 2330
334 Ga0439433_0065294 3300041999 Bacteria 872
335 Ga0439445_0002563 3300042004 Bacteria 4043
336 Ga0439448_0047020 3300042005 Bacteria 1407
337 Ga0439448_0056003 3300042005 Unclassified 1297
338 Ga0439432_011589 3300042006 Bacteria 3037
339 Ga0439455_0005311 3300042012 Bacteria 2609
340 Ga0439462_0000664 3300042015 Bacteria 6975
341 Ga0439446_0021021 3300042156 Bacteria 1842
342 Ga0439458_0001159 3300042157 Bacteria 6679
343 Ga0439458_0002905 3300042157 Bacteria 4116
344 Ga0450909_014968 3300042185 Bacteria 1143
345 Ga0439434_0002510 3300042435 Bacteria 5340
346 Ga0466969_0007957 3300044656 Bacteria 5626
347 Ga0466972_0054917 3300044658 Bacteria 1916
348 Ga0466965_0104981 3300044683 Bacteria 1448
349 Ga0466965_0125160 3300044683 Bacteria 1329
350 Ga0466966_0001152 3300044684 Bacteria 16994
351 Ga0466966_0005216 3300044684 Bacteria 8538
352 Ga0466966_0121710 3300044684 Bacteria 1602
353 Ga0466966_0175296 3300044684 Bacteria 1302
354 Ga0466961_0116630 3300044693 Bacteria 1678
355 Ga0466963_0001344 3300044694 Bacteria 13120
356 Ga0466963_0022717 3300044694 Bacteria 3975
357 Ga0466963_0279378 3300044694 Bacteria 1173
358 Ga0466971_0010080 3300044719 Bacteria 4128
359 Ga0466971_0069305 3300044719 Bacteria 1600
360 Ga0466970_0001624 3300044765 Bacteria 10829
361 Ga0466957_0004917 3300044842 Bacteria 7477
362 Ga0466957_0009211 3300044842 Bacteria 5630
363 Ga0466959_0014526 3300045049 Bacteria 5727
364 Ga0466959_0014658 3300045049 Bacteria 5703
365 Ga0466959_0065384 3300045049 Plasmid 2639
366 Ga0466959_0469082 3300045049 Unclassified 852
367 Ga0466958_0000774 3300045836 Bacteria 14055
368 Ga0466958_0028377 3300045836 Bacteria 3318
369 Ga0466967_0314489 3300045976 Bacteria 1509
370 Ga0495627_080399 3300046453 Bacteria 945
371 Ga0495638_0000134 3300046460 Bacteria 119114
372 Ga0495638_0022224 3300046460 Bacteria 4166
373 Ga0495650_0000083 3300046471 Bacteria 237725
374 Ga0495650_0000408 3300046471 Bacteria 70787
375 Ga0495584_0003917 3300046491 Bacteria 8047
376 Ga0495585_0001044 3300046492 Bacteria 22944
377 Ga0495585_0084636 3300046492 Bacteria 1715
378 Ga0495583_0001697 3300046506 Bacteria 21264
379 Ga0495583_0002962 3300046506 Bacteria 13639
380 Ga0495583_0004955 3300046506 Bacteria 9245
381 Ga0495606_0005475 3300046507 Bacteria 12154
382 Ga0495620_0105731 3300046515 Bacteria 1119
383 Ga0495631_0002177 3300046518 Bacteria 11311
384 Ga0495631_0020569 3300046518 Bacteria 3082
385 Ga0495637_0019750 3300046520 Bacteria 3111
386 Ga0495648_0000097 3300046524 Bacteria 109887
387 Ga0495663_0000245 3300046525 Bacteria 21455
388 Ga0495622_0009948 3300046557 Bacteria 4399
389 Ga0495633_0001735 3300046558 Bacteria 16283
390 Ga0495633_0002574 3300046558 Bacteria 12703
391 Ga0495633_0003967 3300046558 Bacteria 9611
392 Ga0495668_0222132 3300046616 Bacteria 1034
393 Ga0495611_0001160 3300046648 Bacteria 13758
394 Ga0495611_0007848 3300046648 Bacteria 4531
395 Ga0495611_0010099 3300046648 Bacteria 3996
396 Ga0495625_0000496 3300046660 Bacteria 58853
397 Ga0495625_0001084 3300046660 Bacteria 35324
398 Ga0495625_0007394 3300046660 Bacteria 9569
399 Ga0495625_0041863 3300046660 Bacteria 3332
400 Ga0495625_0189068 3300046660 Bacteria 1365
401 Ga0495661_0075963 3300046665 Bacteria 1951
402 Ga0495669_0000023 3300046684 Bacteria 117158
403 Ga0495670_0000014 3300046691 Bacteria 138993
404 Ga0495671_0058933 3300046692 Bacteria 1899
405 Ga0495649_0000700 3300046694 Bacteria 27353
406 Ga0495649_0002955 3300046694 Bacteria 11716
407 Ga0495600_0010427 3300046809 Bacteria 5769
408 Ga0495660_0049635 3300046810 Bacteria 2289
409 Ga0495636_0094355 3300047318 Bacteria 1302
410 Ga0495683_0003318 3300047323 Bacteria 9406
411 Ga0495687_000076 3300047443 Bacteria 149259
412 Ga0495687_132906 3300047443 Unclassified 878
413 Ga0495677_0028997 3300047445 Bacteria 2012
414 Ga0495673_0093426 3300047469 Bacteria 1226
415 Ga0495681_0044509 3300047470 Bacteria 2132
416 Ga0495681_0094429 3300047470 Bacteria 1316
417 Ga0496102_0000261 3300048905 Bacteria 67440
418 Ga0496103_0000052 3300048906 Bacteria 149437
419 Ga0496105_0000173 3300048908 Bacteria 42940
420 Ga0496107_0028471 3300048910 Bacteria 3971
421 Ga0496107_0178241 3300048910 Bacteria 1578
422 Ga0496109_0719213 3300048912 Bacteria 936
423 Ga0496110_0002413 3300048913 Bacteria 13991
424 Ga0496111_0009793 3300048914 Bacteria 6407
425 Ga0496112_0360459 3300048915 Bacteria 1396
426 Ga0496114_0018135 3300048917 Bacteria 5687
427 Ga0496115_0000086 3300048918 Bacteria 86625
428 Ga0496116_0003600 3300048919 Bacteria 15236
429 Ga0496117_0000141 3300048920 Bacteria 158041
430 Ga0496118_0000103 3300048921 Bacteria 158099
431 Ga0496119_0008218 3300048922 Bacteria 9226
432 Ga0496120_0010715 3300048923 Bacteria 6362
433 Ga0496121_0000156 3300048924 Bacteria 149376
434 Ga0496121_0076653 3300048924 Bacteria 2665
435 Ga0496122_0005013 3300048925 Bacteria 16020
436 Ga0496123_0011085 3300048926 Bacteria 7866
437 Ga0496124_0000041 3300048927 Bacteria 303887
438 Ga0496125_0001443 3300048928 Bacteria 34571
439 Ga0496126_0000155 3300048929 Bacteria 158816
440 Ga0496126_0050901 3300048929 Bacteria 3774
441 Ga0501034_0721235 3300049571 Bacteria 894
442 Ga0501034_0779453 3300049571 Bacteria 850
443 Ga0500610_0000116 3300053079 Bacteria 24225
444 Ga0500566_0002505 3300053094 Bacteria 10913
445 Ga0500641_0008436 3300053096 Bacteria 3677
446 Ga0500641_0019654 3300053096 Bacteria 2556
447 Ga0500562_027992 3300053108 Bacteria 1480
448 Ga0500595_000256 3300053119 Bacteria 35290
449 Ga0500595_002304 3300053119 Bacteria 9564
450 Ga0500658_0000562 3300053134 Bacteria 15628
451 Ga0500658_0002294 3300053134 Bacteria 7411
452 Ga0500658_0003604 3300053134 Bacteria 5838
453 Ga0500559_0025405 3300053136 Bacteria 2520
454 Ga0500568_0019335 3300053139 Bacteria 2962
455 Ga0500586_000212 3300053145 Bacteria 11458
456 Ga0500588_0010465 3300053146 Unclassified 2241
457 Ga0500588_0026626 3300053146 Bacteria 1620
458 Ga0500619_074962 3300053154 Bacteria 1130
459 Ga0500622_0009443 3300053156 Bacteria 5396
460 Ga0500636_0001285 3300053177 Bacteria 13628
461 Ga0500637_0005297 3300053178 Bacteria 6232
462 Ga0500645_000003 3300053730 Bacteria 305887
463 Ga0500645_000777 3300053730 Bacteria 19309
464 Ga0466962_0000640 3300061719 Bacteria 15596
465 Ga0466962_0005161 3300061719 Bacteria 6281

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053136 Ga0500559_0025405 Ga0500559_0025405_917_1663 241
2 3300031456 Ga0307513_10041208 Ga0307513_100412085 253
3 3300005843 Ga0068860_100072927 Ga0068860_1000729273 254
4 3300026078 Ga0207702_10583900 Ga0207702_105839002 254
5 3300032004 Ga0307414_10085110 Ga0307414_100851103 254
6 3300037418 Ga0395900_0036433 Ga0395900_0036433_2873_3643 254
7 3300037418 Ga0395900_0101689 Ga0395900_0101689_1290_2060 254
8 3300037466 Ga0395898_0123903 Ga0395898_0123903_1459_2229 254
9 3300037466 Ga0395898_0365504 Ga0395898_0365504_179_949 254
10 3300037471 Ga0395905_0026421 Ga0395905_0026421_3048_3818 254
11 3300038443 Ga0395901_0046465 Ga0395901_0046465_2848_3618 254
12 3300046694 Ga0495649_0000700 Ga0495649_0000700_25569_26339 254
13 iso_pu_bacteria 2643221663 2644353827 254
14 3300005436 Ga0070713_100297276 Ga0070713_1002972762 255
15 3300006028 Ga0070717_10021093 Ga0070717_100210933 255
16 3300025928 Ga0207700_10005386 Ga0207700_100053863 255
17 3300005262 Ga0065165_1016766 Ga0065165_10167662 256
18 3300044658 Ga0466972_0054917 Ga0466972_0054917_1019_1789 256
19 3300044683 Ga0466965_0125160 Ga0466965_0125160_403_1173 256
20 3300044684 Ga0466966_0121710 Ga0466966_0121710_415_1185 256
21 3300044842 Ga0466957_0009211 Ga0466957_0009211_2955_3725 256
22 3300045049 Ga0466959_0014658 Ga0466959_0014658_2074_2844 256
23 3300046460 Ga0495638_0022224 Ga0495638_0022224_2725_3495 256
24 3300046471 Ga0495650_0000408 Ga0495650_0000408_44219_44989 256
25 3300046507 Ga0495606_0005475 Ga0495606_0005475_9720_10490 256
26 3300046558 Ga0495633_0001735 Ga0495633_0001735_5180_5950 256
27 3300046660 Ga0495625_0001084 Ga0495625_0001084_22817_23587 256
28 3300053145 Ga0500586_000212 Ga0500586_000212_898_1668 256
29 3300001915 JGI24741J21665_1000192 JGI24741J21665_100019215 258
30 3300001979 JGI24740J21852_10001303 JGI24740J21852_1000130313 258
31 3300001989 JGI24739J22299_10028129 JGI24739J22299_100281292 258
32 3300001990 JGI24737J22298_10001431 JGI24737J22298_100014314 258
33 3300002075 JGI24738J21930_10003405 JGI24738J21930_100034053 258
34 3300002244 JGI24742J22300_10003082 JGI24742J22300_100030822 258
35 3300003323 rootH1_10014040 rootH1_100140407 258
36 3300003759 Ga0055525_1000096 Ga0055525_100009652 258
37 3300003762 Ga0055542_1000012 Ga0055542_1000012350 258
38 3300003763 Ga0055529_1000002 Ga0055529_1000002266 258
39 3300003763 Ga0055529_1000021 Ga0055529_1000021215 258
40 3300005327 Ga0070658_10005243 Ga0070658_1000524310 258
41 3300005333 Ga0070677_10089713 Ga0070677_100897131 258
42 3300005339 Ga0070660_100196389 Ga0070660_1001963891 258
43 3300005347 Ga0070668_100127681 Ga0070668_1001276811 258
44 3300005355 Ga0070671_100276098 Ga0070671_1002760982 258
45 3300005356 Ga0070674_100015548 Ga0070674_1000155483 258
46 3300005364 Ga0070673_100345314 Ga0070673_1003453141 258
47 3300005366 Ga0070659_100187223 Ga0070659_1001872232 258
48 3300005367 Ga0070667_100241882 Ga0070667_1002418822 258
49 3300005455 Ga0070663_100000623 Ga0070663_1000006234 258
50 3300005455 Ga0070663_100003883 Ga0070663_1000038836 258
51 3300005456 Ga0070678_100455806 Ga0070678_1004558061 258
52 3300005539 Ga0068853_100059614 Ga0068853_1000596143 258
53 3300005539 Ga0068853_100273955 Ga0068853_1002739552 258
54 3300005548 Ga0070665_100051841 Ga0070665_1000518415 258
55 3300005563 Ga0068855_100000183 Ga0068855_10000018345 258
56 3300005564 Ga0070664_100006941 Ga0070664_1000069417 258
57 3300005578 Ga0068854_100000151 Ga0068854_10000015134 258
58 3300005614 Ga0068856_100072975 Ga0068856_1000729752 258
59 3300005834 Ga0068851_10005927 Ga0068851_100059272 258
60 3300005840 Ga0068870_10135958 Ga0068870_101359582 258
61 3300005842 Ga0068858_100009417 Ga0068858_1000094177 258
62 3300005985 Ga0081539_10062308 Ga0081539_100623082 258
63 3300006186 Ga0075369_10177140 Ga0075369_101771402 258
64 3300006195 Ga0075366_10170371 Ga0075366_101703712 258
65 3300006237 Ga0097621_100017460 Ga0097621_1000174602 258
66 3300006237 Ga0097621_100194272 Ga0097621_1001942722 258
67 3300006358 Ga0068871_100008714 Ga0068871_1000087142 258
68 3300009093 Ga0105240_10640739 Ga0105240_106407391 258
69 3300009174 Ga0105241_10000496 Ga0105241_1000049625 258
70 3300009174 Ga0105241_10014164 Ga0105241_100141642 258
71 3300009551 Ga0105238_10058335 Ga0105238_100583352 258
72 3300010375 Ga0105239_10037903 Ga0105239_100379034 258
73 3300010375 Ga0105239_10075397 Ga0105239_100753972 258
74 3300013100 Ga0157373_10016243 Ga0157373_100162434 258
75 3300013100 Ga0157373_10020574 Ga0157373_100205745 258
76 3300013102 Ga0157371_10002077 Ga0157371_100020774 258
77 3300013104 Ga0157370_10085656 Ga0157370_100856562 258
78 3300013105 Ga0157369_10072322 Ga0157369_100723224 258
79 3300013307 Ga0157372_10096354 Ga0157372_100963544 258
80 3300017792 Ga0163161_10086945 Ga0163161_100869452 258
81 3300025226 Ga0209674_111238 Ga0209674_1112381 258
82 3300025230 Ga0209563_100058 Ga0209563_10005871 258
83 3300025250 Ga0209026_1013104 Ga0209026_10131042 258
84 3300025253 Ga0209677_107172 Ga0209677_1071722 258
85 3300025254 Ga0209148_1000008 Ga0209148_1000008983 258
86 3300025272 Ga0209455_1000002 Ga0209455_1000002442 258
87 3300025321 Ga0207656_10010773 Ga0207656_100107731 258
88 3300025901 Ga0207688_10120586 Ga0207688_101205861 258
89 3300025904 Ga0207647_10022357 Ga0207647_100223573 258
90 3300025908 Ga0207643_10106056 Ga0207643_101060562 258
91 3300025909 Ga0207705_10000175 Ga0207705_1000017572 258
92 3300025911 Ga0207654_10000020 Ga0207654_1000002078 258
93 3300025913 Ga0207695_10011751 Ga0207695_1001175110 258
94 3300025914 Ga0207671_10009369 Ga0207671_100093695 258
95 3300025919 Ga0207657_10011169 Ga0207657_100111694 258
96 3300025920 Ga0207649_10000356 Ga0207649_100003563 258
97 3300025924 Ga0207694_10007150 Ga0207694_100071507 258
98 3300025927 Ga0207687_10000755 Ga0207687_1000075512 258
99 3300025932 Ga0207690_10000063 Ga0207690_100000633 258
100 3300025933 Ga0207706_10046770 Ga0207706_100467703 258
101 3300025935 Ga0207709_10000093 Ga0207709_1000009329 258
102 3300025935 Ga0207709_10038760 Ga0207709_100387602 258
103 3300025937 Ga0207669_10000543 Ga0207669_100005432 258
104 3300025937 Ga0207669_10003631 Ga0207669_100036315 258
105 3300025940 Ga0207691_10505789 Ga0207691_105057892 258
106 3300025949 Ga0207667_10000006 Ga0207667_10000006154 258
107 3300025949 Ga0207667_10000007 Ga0207667_10000007554 258
108 3300025960 Ga0207651_10270511 Ga0207651_102705112 258
109 3300025981 Ga0207640_10000031 Ga0207640_10000031115 258
110 3300025981 Ga0207640_10001038 Ga0207640_100010388 258
111 3300025986 Ga0207658_10361114 Ga0207658_103611142 258
112 3300026035 Ga0207703_10006205 Ga0207703_100062053 258
113 3300026041 Ga0207639_10000785 Ga0207639_1000078510 258
114 3300026041 Ga0207639_10423979 Ga0207639_104239791 258
115 3300026067 Ga0207678_10000225 Ga0207678_100002254 258
116 3300026067 Ga0207678_10001276 Ga0207678_100012763 258
117 3300026078 Ga0207702_10002347 Ga0207702_100023478 258
118 3300026116 Ga0207674_10008800 Ga0207674_1000880011 258
119 3300026121 Ga0207683_10000181 Ga0207683_100001814 258
120 3300026142 Ga0207698_10005364 Ga0207698_100053645 258
121 3300028379 Ga0268266_10037280 Ga0268266_100372802 258
122 3300028786 Ga0307517_10043627 Ga0307517_100436273 258
123 3300031456 Ga0307513_10054436 Ga0307513_100544362 258
124 3300031548 Ga0307408_100000044 Ga0307408_10000004423 258
125 3300031548 Ga0307408_100000295 Ga0307408_10000029545 258
126 3300033180 Ga0307510_10039538 Ga0307510_100395384 258
127 3300037312 Ga0395899_0034003 Ga0395899_0034003_3006_3791 258
128 3300037418 Ga0395900_0225699 Ga0395900_0225699_765_1541 258
129 3300037471 Ga0395905_0010105 Ga0395905_0010105_5192_5968 258
130 3300037471 Ga0395905_0194893 Ga0395905_0194893_862_1647 258
131 3300044694 Ga0466963_0279378 Ga0466963_0279378_127_903 258
132 3300044719 Ga0466971_0069305 Ga0466971_0069305_575_1351 258
133 3300045836 Ga0466958_0028377 Ga0466958_0028377_92_868 258
134 3300045976 Ga0466967_0314489 Ga0466967_0314489_361_1137 258
135 3300046471 Ga0495650_0000083 Ga0495650_0000083_198841_199629 258
136 3300046491 Ga0495584_0003917 Ga0495584_0003917_4091_4876 258
137 3300046492 Ga0495585_0084636 Ga0495585_0084636_833_1618 258
138 3300046506 Ga0495583_0001697 Ga0495583_0001697_11292_12080 258
139 3300046506 Ga0495583_0002962 Ga0495583_0002962_11751_12536 258
140 3300046506 Ga0495583_0004955 Ga0495583_0004955_3696_4481 258
141 3300046515 Ga0495620_0105731 Ga0495620_0105731_92_877 258
142 3300046518 Ga0495631_0002177 Ga0495631_0002177_5569_6354 258
143 3300046518 Ga0495631_0020569 Ga0495631_0020569_1004_1789 258
144 3300046520 Ga0495637_0019750 Ga0495637_0019750_2240_3025 258
145 3300046525 Ga0495663_0000245 Ga0495663_0000245_14668_15453 258
146 3300046557 Ga0495622_0009948 Ga0495622_0009948_2139_2927 258
147 3300046558 Ga0495633_0002574 Ga0495633_0002574_6051_6836 258
148 3300046558 Ga0495633_0003967 Ga0495633_0003967_6628_7416 258
149 3300046616 Ga0495668_0222132 Ga0495668_0222132_149_934 258
150 3300046648 Ga0495611_0001160 Ga0495611_0001160_12355_13140 258
151 3300046648 Ga0495611_0007848 Ga0495611_0007848_842_1627 258
152 3300046648 Ga0495611_0010099 Ga0495611_0010099_1743_2531 258
153 3300046660 Ga0495625_0007394 Ga0495625_0007394_372_1157 258
154 3300046660 Ga0495625_0041863 Ga0495625_0041863_2230_3015 258
155 3300046665 Ga0495661_0075963 Ga0495661_0075963_841_1629 258
156 3300046684 Ga0495669_0000023 Ga0495669_0000023_100715_101500 258
157 3300046692 Ga0495671_0058933 Ga0495671_0058933_1086_1871 258
158 3300046694 Ga0495649_0002955 Ga0495649_0002955_2793_3578 258
159 3300046809 Ga0495600_0010427 Ga0495600_0010427_2786_3574 258
160 3300046810 Ga0495660_0049635 Ga0495660_0049635_501_1286 258
161 3300047318 Ga0495636_0094355 Ga0495636_0094355_429_1214 258
162 3300047323 Ga0495683_0003318 Ga0495683_0003318_7466_8251 258
163 3300047443 Ga0495687_000076 Ga0495687_000076_95718_96503 258
164 3300047443 Ga0495687_132906 Ga0495687_132906_45_845 258
165 3300047445 Ga0495677_0028997 Ga0495677_0028997_1089_1874 258
166 3300047469 Ga0495673_0093426 Ga0495673_0093426_145_930 258
167 3300047470 Ga0495681_0044509 Ga0495681_0044509_1016_1801 258
168 3300048912 Ga0496109_0719213 Ga0496109_0719213_49_834 258
169 3300048915 Ga0496112_0360459 Ga0496112_0360459_457_1242 258
170 3300048925 Ga0496122_0005013 Ga0496122_0005013_9362_10147 258
171 3300048926 Ga0496123_0011085 Ga0496123_0011085_3327_4112 258
172 3300048928 Ga0496125_0001443 Ga0496125_0001443_889_1674 258
173 3300049571 Ga0501034_0721235 Ga0501034_0721235_50_856 258
174 3300053079 Ga0500610_0000116 Ga0500610_0000116_7754_8539 258
175 3300053119 Ga0500595_000256 Ga0500595_000256_15800_16588 258
176 3300053119 Ga0500595_002304 Ga0500595_002304_3374_4162 258
177 3300053154 Ga0500619_074962 Ga0500619_074962_260_1048 258
178 3300053177 Ga0500636_0001285 Ga0500636_0001285_6916_7704 258
179 3300053730 Ga0500645_000003 Ga0500645_000003_197597_198382 258
180 3300061719 Ga0466962_0000640 Ga0466962_0000640_9690_10466 258
181 iso_pu_bacteria 2738541276 2738716032 258
182 3300001904 JGI24736J21556_1001759 JGI24736J21556_10017593 259
183 3300001990 JGI24737J22298_10000764 JGI24737J22298_100007645 259
184 3300001990 JGI24737J22298_10050002 JGI24737J22298_100500022 259
185 3300003323 rootH1_10001452 rootH1_1000145213 259
186 3300005329 Ga0070683_100053362 Ga0070683_1000533623 259
187 3300005331 Ga0070670_100022078 Ga0070670_1000220784 259
188 3300005339 Ga0070660_100024003 Ga0070660_1000240033 259
189 3300005344 Ga0070661_100004931 Ga0070661_1000049314 259
190 3300005344 Ga0070661_100015845 Ga0070661_1000158453 259
191 3300005354 Ga0070675_100724106 Ga0070675_1007241061 259
192 3300005364 Ga0070673_100186525 Ga0070673_1001865252 259
193 3300005366 Ga0070659_100000810 Ga0070659_10000081017 259
194 3300005366 Ga0070659_100185534 Ga0070659_1001855342 259
195 3300005367 Ga0070667_100012564 Ga0070667_1000125644 259
196 3300005455 Ga0070663_100003696 Ga0070663_1000036966 259
197 3300005457 Ga0070662_100176112 Ga0070662_1001761122 259
198 3300005539 Ga0068853_100184389 Ga0068853_1001843892 259
199 3300005544 Ga0070686_100480789 Ga0070686_1004807891 259
200 3300005563 Ga0068855_100003190 Ga0068855_10000319016 259
201 3300005563 Ga0068855_100310013 Ga0068855_1003100131 259
202 3300005563 Ga0068855_100671733 Ga0068855_1006717331 259
203 3300005577 Ga0068857_100002772 Ga0068857_1000027728 259
204 3300005578 Ga0068854_100036035 Ga0068854_1000360353 259
205 3300005614 Ga0068856_100005191 Ga0068856_1000051918 259
206 3300005614 Ga0068856_100217557 Ga0068856_1002175572 259
207 3300005616 Ga0068852_100023344 Ga0068852_1000233444 259
208 3300005616 Ga0068852_100046112 Ga0068852_1000461121 259
209 3300005617 Ga0068859_100000362 Ga0068859_10000036228 259
210 3300005841 Ga0068863_100072664 Ga0068863_1000726644 259
211 3300005842 Ga0068858_100006085 Ga0068858_1000060852 259
212 3300006931 Ga0097620_100000362 Ga0097620_1000003625 259
213 3300009092 Ga0105250_10102335 Ga0105250_101023352 259
214 3300009093 Ga0105240_10057240 Ga0105240_100572402 259
215 3300009101 Ga0105247_10000668 Ga0105247_100006682 259
216 3300009177 Ga0105248_10179313 Ga0105248_101793132 259
217 3300013104 Ga0157370_10040534 Ga0157370_100405342 259
218 3300013307 Ga0157372_10190501 Ga0157372_101905012 259
219 3300014325 Ga0163163_10040336 Ga0163163_100403363 259
220 3300014968 Ga0157379_10368635 Ga0157379_103686351 259
221 3300025900 Ga0207710_10000722 Ga0207710_1000072215 259
222 3300025904 Ga0207647_10016570 Ga0207647_100165703 259
223 3300025904 Ga0207647_10097860 Ga0207647_100978602 259
224 3300025909 Ga0207705_10000033 Ga0207705_10000033183 259
225 3300025913 Ga0207695_10005885 Ga0207695_100058856 259
226 3300025919 Ga0207657_10012995 Ga0207657_100129955 259
227 3300025920 Ga0207649_10000444 Ga0207649_100004446 259
228 3300025920 Ga0207649_10150907 Ga0207649_101509072 259
229 3300025925 Ga0207650_10006698 Ga0207650_100066985 259
230 3300025931 Ga0207644_10062614 Ga0207644_100626142 259
231 3300025932 Ga0207690_10017616 Ga0207690_100176165 259
232 3300025932 Ga0207690_10050663 Ga0207690_100506631 259
233 3300025944 Ga0207661_10035454 Ga0207661_100354543 259
234 3300025949 Ga0207667_10003597 Ga0207667_1000359712 259
235 3300025949 Ga0207667_10014552 Ga0207667_100145525 259
236 3300025961 Ga0207712_10106552 Ga0207712_101065522 259
237 3300025981 Ga0207640_10524208 Ga0207640_105242081 259
238 3300025986 Ga0207658_10074556 Ga0207658_100745562 259
239 3300026035 Ga0207703_10008571 Ga0207703_100085713 259
240 3300026067 Ga0207678_10002610 Ga0207678_1000261015 259
241 3300026067 Ga0207678_10003964 Ga0207678_100039647 259
242 3300026078 Ga0207702_10005553 Ga0207702_100055537 259
243 3300026078 Ga0207702_10098275 Ga0207702_100982752 259
244 3300026088 Ga0207641_10121415 Ga0207641_101214153 259
245 3300026095 Ga0207676_10382685 Ga0207676_103826852 259
246 3300026116 Ga0207674_10000057 Ga0207674_1000005773 259
247 3300026116 Ga0207674_10019526 Ga0207674_100195264 259
248 3300026118 Ga0207675_100326559 Ga0207675_1003265591 259
249 3300026142 Ga0207698_10022359 Ga0207698_100223593 259
250 3300026142 Ga0207698_10030988 Ga0207698_100309884 259
251 3300030521 Ga0307511_10000640 Ga0307511_1000064030 259
252 3300031507 Ga0307509_10175224 Ga0307509_101752242 259
253 3300037418 Ga0395900_0000605 Ga0395900_0000605_6591_7382 259
254 3300037418 Ga0395900_0008897 Ga0395900_0008897_1284_2075 259
255 3300037418 Ga0395900_0019364 Ga0395900_0019364_1844_2635 259
256 3300037418 Ga0395900_0033951 Ga0395900_0033951_2996_3787 259
257 3300037418 Ga0395900_0163059 Ga0395900_0163059_350_1141 259
258 3300037466 Ga0395898_0012983 Ga0395898_0012983_3428_4219 259
259 3300037466 Ga0395898_0113620 Ga0395898_0113620_295_1086 259
260 3300037471 Ga0395905_0001467 Ga0395905_0001467_18057_18848 259
261 3300037471 Ga0395905_0003610 Ga0395905_0003610_14184_14975 259
262 3300037471 Ga0395905_0051307 Ga0395905_0051307_289_1080 259
263 3300037471 Ga0395905_0060309 Ga0395905_0060309_2051_2842 259
264 3300037471 Ga0395905_0095909 Ga0395905_0095909_1072_1863 259
265 3300037471 Ga0395905_0152092 Ga0395905_0152092_986_1777 259
266 3300037471 Ga0395905_0467183 Ga0395905_0467183_209_1000 259
267 3300038443 Ga0395901_0025651 Ga0395901_0025651_4679_5470 259
268 3300038443 Ga0395901_0030991 Ga0395901_0030991_4675_5466 259
269 3300038443 Ga0395901_0034730 Ga0395901_0034730_3513_4304 259
270 3300038443 Ga0395901_0081356 Ga0395901_0081356_1763_2554 259
271 3300038443 Ga0395901_0219543 Ga0395901_0219543_1150_1941 259
272 3300042005 Ga0439448_0047020 Ga0439448_0047020_27_818 259
273 3300042005 Ga0439448_0056003 Ga0439448_0056003_214_1005 259
274 3300042012 Ga0439455_0005311 Ga0439455_0005311_668_1459 259
275 3300042157 Ga0439458_0001159 Ga0439458_0001159_2815_3606 259
276 3300042157 Ga0439458_0002905 Ga0439458_0002905_1903_2694 259
277 3300044656 Ga0466969_0007957 Ga0466969_0007957_2293_3084 259
278 3300044684 Ga0466966_0001152 Ga0466966_0001152_12110_12901 259
279 3300044684 Ga0466966_0005216 Ga0466966_0005216_45_836 259
280 3300044684 Ga0466966_0175296 Ga0466966_0175296_495_1289 259
281 3300044693 Ga0466961_0116630 Ga0466961_0116630_226_1020 259
282 3300044694 Ga0466963_0001344 Ga0466963_0001344_6254_7045 259
283 3300044719 Ga0466971_0010080 Ga0466971_0010080_3326_4117 259
284 3300044765 Ga0466970_0001624 Ga0466970_0001624_9040_9831 259
285 3300044842 Ga0466957_0004917 Ga0466957_0004917_3419_4210 259
286 3300045049 Ga0466959_0014526 Ga0466959_0014526_1818_2612 259
287 3300045049 Ga0466959_0065384 Ga0466959_0065384_1833_2624 259
288 3300045049 Ga0466959_0469082 Ga0466959_0469082_45_836 259
289 3300045836 Ga0466958_0000774 Ga0466958_0000774_3090_3881 259
290 3300048924 Ga0496121_0076653 Ga0496121_0076653_1413_2216 259
291 3300053096 Ga0500641_0019654 Ga0500641_0019654_605_1396 259
292 3300053146 Ga0500588_0026626 Ga0500588_0026626_154_945 259
293 3300053178 Ga0500637_0005297 Ga0500637_0005297_1563_2369 259
294 3300061719 Ga0466962_0005161 Ga0466962_0005161_2561_3352 259
295 iso_pu_bacteria 2643221622 2644128814 259
296 3300001990 JGI24737J22298_10021360 JGI24737J22298_100213602 260
297 3300002987 JGI25159J45721_1003057 JGI25159J45721_10030573 260
298 3300003762 Ga0055542_1006686 Ga0055542_10066862 260
299 3300004625 Ga0055543_1003246 Ga0055543_10032465 260
300 3300005262 Ga0065165_1000051 Ga0065165_1000051104 260
301 3300005328 Ga0070676_10001114 Ga0070676_100011148 260
302 3300005334 Ga0068869_100001804 Ga0068869_1000018048 260
303 3300005338 Ga0068868_100000496 Ga0068868_1000004968 260
304 3300005364 Ga0070673_100000020 Ga0070673_1000000208 260
305 3300005455 Ga0070663_100279104 Ga0070663_1002791042 260
306 3300005459 Ga0068867_100000205 Ga0068867_10000020518 260
307 3300005548 Ga0070665_100088481 Ga0070665_1000884813 260
308 3300005578 Ga0068854_100000790 Ga0068854_1000007906 260
309 3300005842 Ga0068858_100008824 Ga0068858_1000088244 260
310 3300006881 Ga0068865_100000126 Ga0068865_10000012618 260
311 3300009093 Ga0105240_10005910 Ga0105240_100059107 260
312 3300009098 Ga0105245_10000421 Ga0105245_100004218 260
313 3300009148 Ga0105243_10001343 Ga0105243_100013438 260
314 3300009176 Ga0105242_10000155 Ga0105242_1000015528 260
315 3300009553 Ga0105249_10013745 Ga0105249_100137452 260
316 3300011119 Ga0105246_10001606 Ga0105246_100016068 260
317 3300013100 Ga0157373_10014302 Ga0157373_100143025 260
318 3300013102 Ga0157371_10115858 Ga0157371_101158582 260
319 3300013104 Ga0157370_10070578 Ga0157370_100705782 260
320 3300013105 Ga0157369_10045471 Ga0157369_100454713 260
321 3300013105 Ga0157369_10065154 Ga0157369_100651544 260
322 3300013296 Ga0157374_10001229 Ga0157374_100012298 260
323 3300013297 Ga0157378_10002458 Ga0157378_100024588 260
324 3300013307 Ga0157372_10061058 Ga0157372_100610582 260
325 3300013308 Ga0157375_10003161 Ga0157375_100031616 260
326 3300014969 Ga0157376_10000233 Ga0157376_1000023317 260
327 3300025254 Ga0209148_1000318 Ga0209148_100031812 260
328 3300025284 Ga0209130_1000063 Ga0209130_100006393 260
329 3300025907 Ga0207645_10002854 Ga0207645_100028544 260
330 3300025913 Ga0207695_10003379 Ga0207695_100033792 260
331 3300025934 Ga0207686_10000492 Ga0207686_100004928 260
332 3300025935 Ga0207709_10000359 Ga0207709_1000035923 260
333 3300025938 Ga0207704_10000048 Ga0207704_100000488 260
334 3300025942 Ga0207689_10001300 Ga0207689_100013008 260
335 3300025960 Ga0207651_10000001 Ga0207651_100000019 260
336 3300025961 Ga0207712_10074278 Ga0207712_100742782 260
337 3300025981 Ga0207640_10000447 Ga0207640_1000044719 260
338 3300026023 Ga0207677_10000125 Ga0207677_1000012542 260
339 3300026035 Ga0207703_10001429 Ga0207703_1000142914 260
340 3300026067 Ga0207678_10079436 Ga0207678_100794362 260
341 3300026078 Ga0207702_10001866 Ga0207702_1000186610 260
342 3300026089 Ga0207648_10000633 Ga0207648_1000063317 260
343 3300028379 Ga0268266_10171976 Ga0268266_101719763 260
344 3300031456 Ga0307513_10005107 Ga0307513_1000510711 260
345 3300031456 Ga0307513_10058134 Ga0307513_100581344 260
346 3300031456 Ga0307513_10058920 Ga0307513_100589204 260
347 3300037312 Ga0395899_0000018 Ga0395899_0000018_384755_385552 260
348 3300037312 Ga0395899_0035235 Ga0395899_0035235_1660_2463 260
349 3300037418 Ga0395900_0154418 Ga0395900_0154418_38_844 260
350 3300037418 Ga0395900_0238959 Ga0395900_0238959_676_1479 260
351 3300037466 Ga0395898_0066897 Ga0395898_0066897_561_1364 260
352 3300038443 Ga0395901_0125823 Ga0395901_0125823_1718_2521 260
353 3300038443 Ga0395901_0583208 Ga0395901_0583208_189_995 260
354 3300044683 Ga0466965_0104981 Ga0466965_0104981_481_1269 260
355 3300048929 Ga0496126_0050901 Ga0496126_0050901_2658_3467 260
356 3300049571 Ga0501034_0779453 Ga0501034_0779453_22_816 260
357 3300053156 Ga0500622_0009443 Ga0500622_0009443_2827_3624 260
358 3300005356 Ga0070674_100006094 Ga0070674_1000060945 261
359 3300005456 Ga0070678_100000254 Ga0070678_10000025416 261
360 3300005543 Ga0070672_100007102 Ga0070672_1000071024 261
361 3300009098 Ga0105245_10004388 Ga0105245_1000438819 261
362 3300009148 Ga0105243_10000441 Ga0105243_1000044128 261
363 3300009148 Ga0105243_10078042 Ga0105243_100780423 261
364 3300013100 Ga0157373_10138531 Ga0157373_101385312 261
365 3300013296 Ga0157374_10083234 Ga0157374_100832343 261
366 3300013297 Ga0157378_10308070 Ga0157378_103080702 261
367 3300013306 Ga0163162_10229434 Ga0163162_102294342 261
368 3300014969 Ga0157376_10153487 Ga0157376_101534872 261
369 3300025940 Ga0207691_10089487 Ga0207691_100894873 261
370 3300031665 Ga0316575_10004036 Ga0316575_100040364 261
371 3300046492 Ga0495585_0001044 Ga0495585_0001044_21708_22502 261
372 3300046524 Ga0495648_0000097 Ga0495648_0000097_64582_65388 261
373 3300046660 Ga0495625_0000496 Ga0495625_0000496_48185_48979 261
374 3300048905 Ga0496102_0000261 Ga0496102_0000261_25112_25918 261
375 3300048906 Ga0496103_0000052 Ga0496103_0000052_42425_43231 261
376 3300048908 Ga0496105_0000173 Ga0496105_0000173_12380_13186 261
377 3300048910 Ga0496107_0028471 Ga0496107_0028471_1393_2199 261
378 3300048913 Ga0496110_0002413 Ga0496110_0002413_9370_10176 261
379 3300048914 Ga0496111_0009793 Ga0496111_0009793_234_1040 261
380 3300048917 Ga0496114_0018135 Ga0496114_0018135_3654_4460 261
381 3300048918 Ga0496115_0000086 Ga0496115_0000086_25059_25865 261
382 3300048919 Ga0496116_0003600 Ga0496116_0003600_4732_5538 261
383 3300048920 Ga0496117_0000141 Ga0496117_0000141_114810_115616 261
384 3300048921 Ga0496118_0000103 Ga0496118_0000103_114868_115674 261
385 3300048922 Ga0496119_0008218 Ga0496119_0008218_7856_8662 261
386 3300048923 Ga0496120_0010715 Ga0496120_0010715_4312_5118 261
387 3300048924 Ga0496121_0000156 Ga0496121_0000156_42407_43213 261
388 3300048927 Ga0496124_0000041 Ga0496124_0000041_44298_45104 261
389 3300048929 Ga0496126_0000155 Ga0496126_0000155_114862_115668 261
390 3300005262 Ga0065165_1018532 Ga0065165_10185323 262
391 3300005366 Ga0070659_100008071 Ga0070659_1000080716 262
392 3300005455 Ga0070663_100007983 Ga0070663_1000079833 262
393 3300009551 Ga0105238_10014791 Ga0105238_100147912 262
394 3300010375 Ga0105239_10213012 Ga0105239_102130122 262
395 3300013100 Ga0157373_10304199 Ga0157373_103041991 262
396 3300013102 Ga0157371_10004390 Ga0157371_100043908 262
397 3300013104 Ga0157370_10060640 Ga0157370_100606403 262
398 3300013105 Ga0157369_10000043 Ga0157369_10000043118 262
399 3300013105 Ga0157369_10004830 Ga0157369_1000483012 262
400 3300014325 Ga0163163_10017234 Ga0163163_100172341 262
401 3300025924 Ga0207694_10206508 Ga0207694_102065082 262
402 3300031616 Ga0307508_10001949 Ga0307508_1000194918 262
403 3300037312 Ga0395899_0015001 Ga0395899_0015001_1335_2150 262
404 3300037312 Ga0395899_0016349 Ga0395899_0016349_2669_3475 262
405 3300037312 Ga0395899_0245627 Ga0395899_0245627_372_1199 262
406 3300037312 Ga0395899_0246013 Ga0395899_0246013_52_879 262
407 3300037418 Ga0395900_0018552 Ga0395900_0018552_1436_2251 262
408 3300037418 Ga0395900_0125476 Ga0395900_0125476_98_913 262
409 3300037418 Ga0395900_0404451 Ga0395900_0404451_416_1231 262
410 3300037418 Ga0395900_0409782 Ga0395900_0409782_370_1173 262
411 3300037466 Ga0395898_0004872 Ga0395898_0004872_11285_12091 262
412 3300037471 Ga0395905_0000967 Ga0395905_0000967_13886_14713 262
413 3300037471 Ga0395905_0001987 Ga0395905_0001987_10291_11112 262
414 3300037471 Ga0395905_0056825 Ga0395905_0056825_699_1514 262
415 3300037471 Ga0395905_0126297 Ga0395905_0126297_584_1411 262
416 3300038443 Ga0395901_0018936 Ga0395901_0018936_5515_6330 262
417 3300038443 Ga0395901_0028548 Ga0395901_0028548_2632_3459 262
418 3300038443 Ga0395901_0098238 Ga0395901_0098238_55_948 262
419 3300038443 Ga0395901_0551798 Ga0395901_0551798_184_1005 262
420 3300041404 Ga0439436_0015818 Ga0439436_0015818_702_1490 262
421 3300041410 Ga0439461_0000938 Ga0439461_0000938_2475_3263 262
422 3300041413 Ga0439465_0000889 Ga0439465_0000889_6973_7761 262
423 3300041997 Ga0439431_0000346 Ga0439431_0000346_1959_2747 262
424 3300042004 Ga0439445_0002563 Ga0439445_0002563_2760_3548 262
425 3300042006 Ga0439432_011589 Ga0439432_011589_2084_2872 262
426 3300042015 Ga0439462_0000664 Ga0439462_0000664_1939_2727 262
427 3300042435 Ga0439434_0002510 Ga0439434_0002510_2068_2856 262
428 3300044694 Ga0466963_0022717 Ga0466963_0022717_2544_3359 262
429 3300046460 Ga0495638_0000134 Ga0495638_0000134_94427_95230 262
430 3300046660 Ga0495625_0189068 Ga0495625_0189068_121_987 262
431 3300048910 Ga0496107_0178241 Ga0496107_0178241_397_1224 262
432 3300053094 Ga0500566_0002505 Ga0500566_0002505_5592_6380 262
433 3300053096 Ga0500641_0008436 Ga0500641_0008436_2600_3415 262
434 3300053134 Ga0500658_0003604 Ga0500658_0003604_2821_3687 262
435 3300053146 Ga0500588_0010465 Ga0500588_0010465_600_1520 262
436 3300000041 ARcpr5oldR_c003356 ARcpr5oldR_0033562 263
437 3300003773 Ga0055537_1001600 Ga0055537_10016002 263
438 3300003775 Ga0055524_1000345 Ga0055524_100034515 263
439 3300003791 Ga0055530_10000061 Ga0055530_1000006112 263
440 3300003794 Ga0055531_10000035 Ga0055531_1000003544 263
441 3300003794 Ga0055531_10003469 Ga0055531_100034693 263
442 3300005262 Ga0065165_1021190 Ga0065165_10211902 263
443 3300005366 Ga0070659_100081335 Ga0070659_1000813353 263
444 3300006948 Ga0099826_10113760 Ga0099826_101137602 263
445 3300025245 Ga0207425_1020676 Ga0207425_10206761 263
446 3300025263 Ga0209565_1000008 Ga0209565_1000008271 263
447 3300025273 Ga0209673_1002083 Ga0209673_10020836 263
448 3300025291 Ga0209675_1028851 Ga0209675_10288512 263
449 3300025297 Ga0209758_1004526 Ga0209758_10045264 263
450 3300025298 Ga0209050_1000014 Ga0209050_1000014406 263
451 3300025299 Ga0209256_1000009 Ga0209256_1000009599 263
452 3300025299 Ga0209256_1000010 Ga0209256_1000010523 263
453 3300025304 Ga0209257_1000019 Ga0209257_1000019286 263
454 3300025304 Ga0209257_1003277 Ga0209257_10032775 263
455 3300027666 Ga0209282_1090715 Ga0209282_10907151 263
456 3300041406 Ga0439439_0008024 Ga0439439_0008024_1589_2380 263
457 3300041997 Ga0439431_0008316 Ga0439431_0008316_891_1682 263
458 3300041999 Ga0439433_0065294 Ga0439433_0065294_43_834 263
459 3300042156 Ga0439446_0021021 Ga0439446_0021021_953_1744 263
460 3300042185 Ga0450909_014968 Ga0450909_014968_287_1078 263
461 3300046453 Ga0495627_080399 Ga0495627_080399_67_858 263
462 3300046691 Ga0495670_0000014 Ga0495670_0000014_131891_132724 263
463 3300047470 Ga0495681_0094429 Ga0495681_0094429_334_1125 263
464 3300053108 Ga0500562_027992 Ga0500562_027992_509_1342 263
465 3300053134 Ga0500658_0000562 Ga0500658_0000562_12242_13033 263
466 3300053134 Ga0500658_0002294 Ga0500658_0002294_2007_2798 263
467 3300053139 Ga0500568_0019335 Ga0500568_0019335_1700_2491 263
468 3300053730 Ga0500645_000777 Ga0500645_000777_4655_5491 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09339

HTH_IclR

IclR helix-turn-helix domain

63

114

0.97

PF01614

IclR

Bacterial transcriptional regulator

131

297

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9211 23 77
4wcg-assembly1.cif.gz_B the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna 0.9107 21 78
5n07-assembly1.cif.gz_A-2 structure of the [4fe-4s] form of the no response regulator nsrr 0.9055 17 80
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9002 23 78
4wcg-assembly1.cif.gz_A the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna 0.8833 21 78
ID Description Score Start End Superfamily
af_P77569_1_73_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9477 16 78 1.10.10.10
af_P77732_3_78_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9353 16 85 1.10.10.10
af_P76268_11_86_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9227 16 87 1.10.10.10
4ijaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9216 23 78 1.10.10.10
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9211 23 77 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A239PVD5-F1-model_v4 Transcriptional regulator, IclR family 0.8989 6 258 GO:0003677
GO:0003700
GO:0045892
AF-A0A1I6VGX8-F1-model_v4 Transcriptional regulator, IclR family 0.8682 15 257 GO:0003677
GO:0003700
GO:0045892
AF-A0A239PVD5-F1-model_v4 Transcriptional regulator, IclR family 0.8644 6 258 GO:0003677
GO:0003700
GO:0045892
AF-A0A3S2AT97-F1-model_v4 IclR family transcriptional regulator 0.8608 64 261 GO:0003677
GO:0003700
GO:0045892
AF-A0A3L8Q277-F1-model_v4 IclR family transcriptional regulator 0.8493 15 260 GO:0003677
GO:0003700
GO:0045892

Feature Viewer

pLDDT pTM Quality
87.52 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map