F450104

General Info

Members Datasets Scaffolds Average Seq Length
468 225 936 153

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0061425|Ga0495606_0061425_1616_2170
Length 184
Sequence LTDRELTKIAEKTPVSYLLIHDSDYIATKYKNVRAVLQRVSEASCRVDGQITGEIQTGFLVLLGIEETDTDDDLNWLANKIAGMRVFSDENGLMNKALADIEGEILLISQFTLYAQTKKGNRPSFIRAARPDKAIPLYEQMITTLQNLTGKKIATGIFGADMKISLVNDGPVTIIMDTKDKENH

Samples

Sample ID Description Type Environment
1 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
119 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
123 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
124 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
125 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
126 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
127 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
150 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
151 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
168 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
171 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
172 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
176 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
187 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
188 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
189 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
190 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
191 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
192 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
197 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
198 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
199 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
206 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
211 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
212 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
213 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
214 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
215 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
216 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
217 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
218 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
219 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
220 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
221 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
222 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
223 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
224 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
225 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.44
Metatranscriptomes 0
Isolates 2.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.49
Nodule 0
Rhizoplane 0.43
Rhizosphere 88.68
Stem 0
Stem Tuber 0
Unclassified 7.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495606_0061425 3300046507 Bacteria 2403
2 SwRhRL2b_contig_2461763 2162886007 Bacteria 1311
3 JGI24736J21556_1003173 3300001904 Bacteria 2864
4 JGI24739J22299_10010223 3300001989 Bacteria 3485
5 JGI24737J22298_10001803 3300001990 Bacteria 7671
6 JGI24737J22298_10021871 3300001990 Bacteria 2034
7 JGI24735J21928_10000084 3300002067 Bacteria 35383
8 JGI24735J21928_10039963 3300002067 Bacteria 1370
9 JGI24735J21928_10092979 3300002067 Bacteria 865
10 JGI24744J21845_10002386 3300002077 Bacteria 3832
11 JGI25162J39368_1000097 3300002737 Bacteria 96520
12 JGI25162J39368_1001654 3300002737 Bacteria 11049
13 JGI25164J39214_1006838 3300002772 Bacteria 1179
14 JGI25165J46597_1000733 3300003214 Bacteria 25678
15 rootH1_10048299 3300003316 Bacteria 1521
16 rootH1_10112531 3300003316 Bacteria 6059
17 rootH2_10009716 3300003320 Bacteria 46057
18 rootH2_10033863 3300003320 Bacteria 12920
19 rootH2_10044604 3300003320 Bacteria 1957
20 rootH2_10059924 3300003320 Bacteria 1696
21 rootH1_10025651 3300003323 Bacteria 11383
22 rootH1_10033417 3300003323 Bacteria 27769
23 rootH1_10120143 3300003323 Bacteria 4000
24 rootH1_10131146 3300003323 Bacteria 3719
25 Ga0065714_10084558 3300005288 Bacteria 2174
26 Ga0065704_10001986 3300005289 Bacteria 7583
27 Ga0065704_10145283 3300005289 Bacteria 1478
28 Ga0070658_10000069 3300005327 Bacteria 101140
29 Ga0070658_10166418 3300005327 Bacteria 1851
30 Ga0070658_10234638 3300005327 Bacteria 1554
31 Ga0070658_10290223 3300005327 Bacteria 1394
32 Ga0070676_10015301 3300005328 Bacteria 4231
33 Ga0070680_100019054 3300005336 Bacteria 5433
34 Ga0068868_100101616 3300005338 Bacteria 2327
35 Ga0070660_100046805 3300005339 Bacteria 3317
36 Ga0070660_100133728 3300005339 Bacteria 1986
37 Ga0070689_100609380 3300005340 Bacteria 946
38 Ga0070673_100103439 3300005364 Bacteria 2350
39 Ga0070673_102011362 3300005364 Unclassified 548
40 Ga0070659_100002766 3300005366 Bacteria 12487
41 Ga0070659_100009288 3300005366 Bacteria 7220
42 Ga0070659_100435418 3300005366 Bacteria 1110
43 Ga0070667_101214530 3300005367 Bacteria 706
44 Ga0070663_100007042 3300005455 Bacteria 6815
45 Ga0070678_100179802 3300005456 Bacteria 1730
46 Ga0070678_100214102 3300005456 Bacteria 1598
47 Ga0070662_100000186 3300005457 Bacteria 36051
48 Ga0070662_100117258 3300005457 Bacteria 2036
49 Ga0070681_10011702 3300005458 Bacteria 8692
50 Ga0070698_101387595 3300005471 Bacteria 653
51 Ga0070679_100045254 3300005530 Bacteria 4386
52 Ga0070679_100481493 3300005530 Bacteria 1185
53 Ga0070684_100073584 3300005535 Bacteria 3011
54 Ga0068853_100010772 3300005539 Bacteria 7407
55 Ga0068853_100073967 3300005539 Bacteria 2972
56 Ga0068853_100266251 3300005539 Bacteria 1577
57 Ga0070665_100000017 3300005548 Bacteria 448013
58 Ga0068855_100000097 3300005563 Bacteria 106474
59 Ga0068855_100004838 3300005563 Bacteria 16436
60 Ga0068855_100010260 3300005563 Bacteria 11297
61 Ga0068855_100180536 3300005563 Bacteria 2386
62 Ga0068855_100395865 3300005563 Bacteria 1515
63 Ga0068855_100565927 3300005563 Bacteria 1229
64 Ga0068855_100648299 3300005563 Unclassified 1134
65 Ga0068855_100898374 3300005563 Unclassified 936
66 Ga0068855_101023678 3300005563 Bacteria 867
67 Ga0068855_101270168 3300005563 Bacteria 763
68 Ga0070664_101186683 3300005564 Bacteria 720
69 Ga0068857_100018843 3300005577 Bacteria 6057
70 Ga0068857_100166817 3300005577 Bacteria 2000
71 Ga0068857_100452795 3300005577 Bacteria 1200
72 Ga0068854_100584884 3300005578 Bacteria 951
73 Ga0068856_100000189 3300005614 Bacteria 64684
74 Ga0068856_100002033 3300005614 Bacteria 21029
75 Ga0068856_100235576 3300005614 Bacteria 1846
76 Ga0068856_100697705 3300005614 Bacteria 1035
77 Ga0068856_101410028 3300005614 Bacteria 711
78 Ga0068852_100004339 3300005616 Bacteria 10011
79 Ga0068852_100296641 3300005616 Bacteria 1563
80 Ga0068852_100725054 3300005616 Unclassified 1005
81 Ga0068859_100043365 3300005617 Bacteria 4520
82 Ga0068864_102291825 3300005618 Unclassified 546
83 Ga0068861_100979094 3300005719 Bacteria 806
84 Ga0068860_100007247 3300005843 Bacteria 11088
85 Ga0068862_100342734 3300005844 Bacteria 1384
86 Ga0070716_100522109 3300006173 Unclassified 880
87 Ga0075366_10000677 3300006195 Bacteria 16110
88 Ga0075366_10027376 3300006195 Bacteria 3344
89 Ga0068871_100480975 3300006358 Bacteria 1117
90 Ga0068865_100001165 3300006881 Bacteria 15280
91 Ga0097620_100043370 3300006931 Bacteria 4520
92 Ga0105240_10000321 3300009093 Bacteria 90931
93 Ga0105240_10009251 3300009093 Bacteria 13972
94 Ga0105240_10028247 3300009093 Bacteria 7329
95 Ga0105240_10041945 3300009093 Bacteria 5835
96 Ga0105240_10266898 3300009093 Bacteria 1972
97 Ga0105240_10330718 3300009093 Bacteria 1734
98 Ga0105240_10469361 3300009093 Bacteria 1405
99 Ga0105240_10657839 3300009093 Bacteria 1148
100 Ga0105240_12452363 3300009093 Unclassified 540
101 Ga0105245_10804973 3300009098 Unclassified 978
102 Ga0105243_10078741 3300009148 Bacteria 2684
103 Ga0105241_10001000 3300009174 Bacteria 21430
104 Ga0105241_10069375 3300009174 Bacteria 2733
105 Ga0105241_10143974 3300009174 Bacteria 1944
106 Ga0105241_10147392 3300009174 Bacteria 1922
107 Ga0105241_10341711 3300009174 Unclassified 1297
108 Ga0105242_10213428 3300009176 Bacteria 1721
109 Ga0105237_10000273 3300009545 Bacteria 72474
110 Ga0105237_10003787 3300009545 Bacteria 17785
111 Ga0105237_10004463 3300009545 Bacteria 16172
112 Ga0105237_10012487 3300009545 Bacteria 8949
113 Ga0105237_10032439 3300009545 Bacteria 5288
114 Ga0105237_10073968 3300009545 Bacteria 3399
115 Ga0105237_10099788 3300009545 Bacteria 2895
116 Ga0105237_10227143 3300009545 Bacteria 1867
117 Ga0105237_10467363 3300009545 Bacteria 1267
118 Ga0105237_10468588 3300009545 Bacteria 1266
119 Ga0105237_11397165 3300009545 Bacteria 706
120 Ga0105238_10038734 3300009551 Bacteria 4840
121 Ga0105238_10039673 3300009551 Bacteria 4774
122 Ga0105238_10183376 3300009551 Bacteria 2070
123 Ga0105249_10007947 3300009553 Bacteria 9247
124 Ga0105239_10000014 3300010375 Bacteria 325391
125 Ga0105239_10000017 3300010375 Bacteria 290760
126 Ga0105239_10000821 3300010375 Bacteria 44186
127 Ga0105239_10004179 3300010375 Bacteria 17344
128 Ga0105239_10009748 3300010375 Bacteria 10799
129 Ga0105239_10083740 3300010375 Bacteria 3513
130 Ga0105239_10089486 3300010375 Bacteria 3394
131 Ga0105239_10103179 3300010375 Unclassified 3156
132 Ga0105239_10149651 3300010375 Bacteria 2605
133 Ga0105239_10161839 3300010375 Bacteria 2501
134 Ga0105239_10540398 3300010375 Unclassified 1327
135 Ga0105239_10730321 3300010375 Bacteria 1133
136 Ga0105246_10040797 3300011119 Bacteria 3135
137 Ga0157373_10003628 3300013100 Bacteria 11658
138 Ga0157373_10047399 3300013100 Bacteria 3065
139 Ga0157371_10000297 3300013102 Bacteria 65919
140 Ga0157371_10001621 3300013102 Bacteria 23010
141 Ga0157371_10003113 3300013102 Bacteria 15341
142 Ga0157371_10207871 3300013102 Bacteria 1404
143 Ga0157370_10018511 3300013104 Bacteria 7002
144 Ga0157370_10018680 3300013104 Bacteria 6970
145 Ga0157370_10047250 3300013104 Bacteria 4127
146 Ga0157370_10047550 3300013104 Bacteria 4112
147 Ga0157370_10561113 3300013104 Bacteria 1046
148 Ga0157370_10871194 3300013104 Bacteria 818
149 Ga0157369_10000772 3300013105 Bacteria 41301
150 Ga0157369_10055076 3300013105 Bacteria 4293
151 Ga0157369_10074716 3300013105 Bacteria 3635
152 Ga0157369_10096572 3300013105 Bacteria 3152
153 Ga0157369_10476202 3300013105 Bacteria 1292
154 Ga0157374_10000825 3300013296 Bacteria 27116
155 Ga0157374_10037163 3300013296 Bacteria 4467
156 Ga0157374_10127344 3300013296 Bacteria 2462
157 Ga0157374_10164065 3300013296 Bacteria 2165
158 Ga0157374_10378086 3300013296 Bacteria 1411
159 Ga0157374_10445675 3300013296 Bacteria 1296
160 Ga0157374_11358691 3300013296 Bacteria 733
161 Ga0157378_10034988 3300013297 Bacteria 4442
162 Ga0157378_10035761 3300013297 Bacteria 4395
163 Ga0163162_10072237 3300013306 Bacteria 3505
164 Ga0163162_10081280 3300013306 Bacteria 3311
165 Ga0163162_10801839 3300013306 Bacteria 1059
166 Ga0157372_10000009 3300013307 Bacteria 302051
167 Ga0157372_10002480 3300013307 Bacteria 19998
168 Ga0157372_10011278 3300013307 Bacteria 9508
169 Ga0157372_10097258 3300013307 Bacteria 3357
170 Ga0157372_10126973 3300013307 Bacteria 2933
171 Ga0157372_11784156 3300013307 Unclassified 708
172 Ga0157375_10159557 3300013308 Bacteria 2396
173 Ga0157375_10403132 3300013308 Bacteria 1534
174 Ga0182008_10301541 3300014497 Bacteria 838
175 Ga0157377_10273974 3300014745 Bacteria 1103
176 Ga0182007_10032142 3300015262 Bacteria 1784
177 Ga0163161_10087213 3300017792 Bacteria 2305
178 Ga0163161_10244723 3300017792 Bacteria 1396
179 Ga0213873_10132035 3300021358 Unclassified 740
180 Ga0213872_10072327 3300021361 Bacteria 1553
181 Ga0207427_100066 3300025231 Bacteria 165770
182 Ga0209437_100010 3300025233 Bacteria 838447
183 Ga0209437_100030 3300025233 Bacteria 532466
184 Ga0209026_1000246 3300025250 Bacteria 69164
185 Ga0209026_1009476 3300025250 Bacteria 1910
186 Ga0209233_1000017 3300025261 Bacteria 898076
187 Ga0209233_1000829 3300025261 Bacteria 13693
188 Ga0209455_1004736 3300025272 Bacteria 4368
189 Ga0207647_10000036 3300025904 Bacteria 98204
190 Ga0207647_10003216 3300025904 Bacteria 12256
191 Ga0207645_10000767 3300025907 Bacteria 26724
192 Ga0207705_10000032 3300025909 Bacteria 224376
193 Ga0207705_10188698 3300025909 Bacteria 1558
194 Ga0207705_10225853 3300025909 Bacteria 1423
195 Ga0207705_10505920 3300025909 Bacteria 938
196 Ga0207705_11037813 3300025909 Bacteria 633
197 Ga0207654_10045709 3300025911 Bacteria 2493
198 Ga0207654_10060455 3300025911 Bacteria 2213
199 Ga0207654_10062111 3300025911 Bacteria 2187
200 Ga0207654_10068977 3300025911 Bacteria 2093
201 Ga0207654_10092051 3300025911 Bacteria 1851
202 Ga0207707_10008912 3300025912 Bacteria 8712
203 Ga0207695_10000197 3300025913 Bacteria 168837
204 Ga0207695_10002602 3300025913 Bacteria 26455
205 Ga0207695_10030986 3300025913 Bacteria 5878
206 Ga0207695_10091252 3300025913 Unclassified 3061
207 Ga0207695_10108796 3300025913 Bacteria 2755
208 Ga0207695_10146507 3300025913 Bacteria 2305
209 Ga0207695_10170790 3300025913 Bacteria 2100
210 Ga0207695_10377984 3300025913 Bacteria 1302
211 Ga0207695_11254341 3300025913 Bacteria 621
212 Ga0207671_10002335 3300025914 Bacteria 20461
213 Ga0207671_10003413 3300025914 Bacteria 15880
214 Ga0207671_10003709 3300025914 Bacteria 15048
215 Ga0207671_10004896 3300025914 Bacteria 12580
216 Ga0207671_10008207 3300025914 Bacteria 8896
217 Ga0207671_10056958 3300025914 Bacteria 2896
218 Ga0207671_10084372 3300025914 Bacteria 2386
219 Ga0207671_10137925 3300025914 Bacteria 1877
220 Ga0207671_10173670 3300025914 Bacteria 1674
221 Ga0207660_10014016 3300025917 Bacteria 5261
222 Ga0207657_10062996 3300025919 Bacteria 3173
223 Ga0207657_10181030 3300025919 Bacteria 1704
224 Ga0207649_10959303 3300025920 Bacteria 672
225 Ga0207652_10015719 3300025921 Bacteria 6165
226 Ga0207652_11074401 3300025921 Bacteria 705
227 Ga0207694_10016665 3300025924 Bacteria 5553
228 Ga0207694_10136571 3300025924 Bacteria 1970
229 Ga0207694_10330619 3300025924 Bacteria 1259
230 Ga0207659_10555139 3300025926 Bacteria 976
231 Ga0207687_10538383 3300025927 Unclassified 978
232 Ga0207644_10040413 3300025931 Bacteria 3296
233 Ga0207690_10000216 3300025932 Bacteria 43848
234 Ga0207690_10123456 3300025932 Bacteria 1885
235 Ga0207690_10173588 3300025932 Bacteria 1617
236 Ga0207706_10000125 3300025933 Bacteria 83075
237 Ga0207706_10210380 3300025933 Bacteria 1705
238 Ga0207709_10000026 3300025935 Bacteria 354467
239 Ga0207709_10407892 3300025935 Bacteria 1040
240 Ga0207669_10314701 3300025937 Bacteria 1195
241 Ga0207704_10000043 3300025938 Bacteria 88714
242 Ga0207691_10210766 3300025940 Bacteria 1688
243 Ga0207661_10047813 3300025944 Bacteria 3398
244 Ga0207667_10001087 3300025949 Bacteria 34483
245 Ga0207667_10004753 3300025949 Bacteria 16611
246 Ga0207667_10058932 3300025949 Bacteria 4025
247 Ga0207667_10119173 3300025949 Bacteria 2720
248 Ga0207667_10124037 3300025949 Bacteria 2661
249 Ga0207667_10299638 3300025949 Bacteria 1642
250 Ga0207667_10450641 3300025949 Bacteria 1308
251 Ga0207667_10558693 3300025949 Bacteria 1157
252 Ga0207667_11095618 3300025949 Bacteria 780
253 Ga0207667_11674585 3300025949 Bacteria 603
254 Ga0207651_10455432 3300025960 Bacteria 1098
255 Ga0207712_10008200 3300025961 Bacteria 6603
256 Ga0207640_11090846 3300025981 Bacteria 706
257 Ga0207658_10641075 3300025986 Bacteria 957
258 Ga0207677_10074751 3300026023 Bacteria 2406
259 Ga0207639_10009142 3300026041 Bacteria 6830
260 Ga0207639_10096013 3300026041 Bacteria 2384
261 Ga0207639_10884580 3300026041 Bacteria 834
262 Ga0207678_10017806 3300026067 Bacteria 6238
263 Ga0207702_10000393 3300026078 Bacteria 49888
264 Ga0207702_10025453 3300026078 Bacteria 4911
265 Ga0207702_10366132 3300026078 Bacteria 1383
266 Ga0207702_10632393 3300026078 Bacteria 1052
267 Ga0207702_11207252 3300026078 Bacteria 750
268 Ga0207676_11726257 3300026095 Unclassified 624
269 Ga0207674_10033030 3300026116 Bacteria 5422
270 Ga0207674_10190473 3300026116 Bacteria 2001
271 Ga0207674_11064849 3300026116 Bacteria 778
272 Ga0207683_10223354 3300026121 Bacteria 1716
273 Ga0207683_10245967 3300026121 Bacteria 1632
274 Ga0207698_10004007 3300026142 Bacteria 8935
275 Ga0207698_10600818 3300026142 Bacteria 1085
276 Ga0207698_11419988 3300026142 Unclassified 709
277 Ga0268266_10000037 3300028379 Bacteria 342368
278 Ga0268265_10079875 3300028380 Bacteria 2578
279 Ga0268264_10041355 3300028381 Bacteria 3812
280 Ga0265334_10159030 3300028573 Bacteria 795
281 Ga0307517_10001881 3300028786 Bacteria 34355
282 Ga0307515_10000790 3300028794 Bacteria 72891
283 Ga0307515_10001565 3300028794 Bacteria 51101
284 Ga0307515_10062818 3300028794 Bacteria 5235
285 Ga0307515_10093363 3300028794 Bacteria 3732
286 Ga0265338_10010649 3300028800 Bacteria 10749
287 Ga0265338_10295679 3300028800 Bacteria 1179
288 Ga0265338_10658627 3300028800 Bacteria 725
289 Ga0316177_1221497 3300030731 Bacteria 4277
290 Ga0316176_1014596 3300030732 Bacteria 15075
291 Ga0314311_1061985 3300030733 Bacteria 1092
292 Ga0316183_1016718 3300030742 Bacteria 50913
293 Ga0316181_1091070 3300030744 Bacteria 11978
294 Ga0316182_1143412 3300030745 Bacteria 1060
295 Ga0316182_1148669 3300030745 Bacteria 3273
296 Ga0307408_100000445 3300031548 Bacteria 36377
297 Ga0307408_100000628 3300031548 Bacteria 29832
298 Ga0307408_100001834 3300031548 Bacteria 15479
299 Ga0307408_100959556 3300031548 Bacteria 786
300 Ga0307405_10223170 3300031731 Bacteria 1384
301 Ga0307413_10069699 3300031824 Bacteria 2208
302 Ga0307413_11478628 3300031824 Unclassified 600
303 Ga0307406_11689248 3300031901 Bacteria 561
304 Ga0307412_10001942 3300031911 Bacteria 11437
305 Ga0307412_10034482 3300031911 Bacteria 3225
306 Ga0307412_10296828 3300031911 Bacteria 1275
307 Ga0307416_100341540 3300032002 Bacteria 1510
308 Ga0307414_10115606 3300032004 Unclassified 2052
309 Ga0307414_10292399 3300032004 Bacteria 1374
310 Ga0307414_10955645 3300032004 Unclassified 787
311 Ga0307414_11205996 3300032004 Bacteria 701
312 Ga0307411_10066871 3300032005 Bacteria 2416
313 Ga0307507_10000143 3300033179 Bacteria 124248
314 Ga0307510_10000149 3300033180 Bacteria 58176
315 Ga0373926_0084527 3300035083 Bacteria 1176
316 Ga0395899_0000017 3300037312 Bacteria 440179
317 Ga0395899_0001519 3300037312 Bacteria 19624
318 Ga0395899_0003831 3300037312 Bacteria 11870
319 Ga0395899_0068096 3300037312 Bacteria 2611
320 Ga0395900_0000523 3300037418 Bacteria 54244
321 Ga0395900_0005417 3300037418 Bacteria 13369
322 Ga0395900_0005978 3300037418 Bacteria 12706
323 Ga0395898_0003563 3300037466 Bacteria 17360
324 Ga0395898_0075703 3300037466 Bacteria 3251
325 Ga0395905_0006175 3300037471 Bacteria 12096
326 Ga0395905_0007055 3300037471 Bacteria 11229
327 Ga0395905_0660716 3300037471 Unclassified 947
328 Ga0395901_0007492 3300038443 Bacteria 11024
329 Ga0395901_0013621 3300038443 Bacteria 8268
330 Ga0400487_29127 3300039110 Bacteria 1569
331 Ga0436365_0578888 3300039437 Unclassified 571
332 Ga0436360_0974628 3300039438 Unclassified 581
333 Ga0436361_0660841 3300039447 Unclassified 1124
334 Ga0436361_0994528 3300039447 Bacteria 2208
335 Ga0436362_0029708 3300039453 Unclassified 740
336 Ga0451806_696018 3300041462 Bacteria 563
337 Ga0451855_1570847 3300041511 Bacteria 606
338 Ga0439462_0113379 3300042015 Bacteria 751
339 Ga0451577_0030435 3300042876 Bacteria 4879
340 Ga0451577_0061378 3300042876 Bacteria 3352
341 Ga0451577_1270198 3300042876 Bacteria 655
342 Ga0451577_1564281 3300042876 Unclassified 582
343 Ga0466972_0000016 3300044658 Bacteria 208802
344 Ga0453683_0000021 3300044673 Bacteria 284502
345 Ga0453683_0000240 3300044673 Bacteria 72911
346 Ga0453683_0010244 3300044673 Bacteria 6217
347 Ga0453683_0123297 3300044673 Bacteria 1631
348 Ga0453683_0162853 3300044673 Bacteria 1411
349 Ga0453683_0455895 3300044673 Bacteria 827
350 Ga0453683_0491368 3300044673 Bacteria 796
351 Ga0453683_0556537 3300044673 Bacteria 746
352 Ga0453683_0729531 3300044673 Bacteria 650
353 Ga0453683_0872485 3300044673 Unclassified 594
354 Ga0466966_0004498 3300044684 Bacteria 9198
355 Ga0466966_0365483 3300044684 Bacteria 867
356 Ga0466961_0003281 3300044693 Bacteria 10080
357 Ga0453684_0000110 3300044712 Bacteria 360542
358 Ga0453684_0000616 3300044712 Bacteria 130153
359 Ga0453684_0001099 3300044712 Bacteria 85094
360 Ga0453684_0021036 3300044712 Bacteria 9781
361 Ga0453684_0022368 3300044712 Bacteria 9382
362 Ga0453684_0119613 3300044712 Bacteria 3183
363 Ga0453684_0121736 3300044712 Bacteria 3149
364 Ga0453684_0178000 3300044712 Bacteria 2499
365 Ga0453684_0336063 3300044712 Bacteria 1707
366 Ga0453684_1743819 3300044712 Unclassified 635
367 Ga0466968_0084881 3300044735 Unclassified 1396
368 Ga0466968_0480156 3300044735 Bacteria 617
369 Ga0466970_0001074 3300044765 Bacteria 13245
370 Ga0466957_0224632 3300044842 Unclassified 1241
371 Ga0466959_0471786 3300045049 Unclassified 850
372 Ga0451576_0000039 3300045051 Bacteria 360162
373 Ga0451576_0000252 3300045051 Bacteria 132040
374 Ga0451576_0004871 3300045051 Bacteria 17168
375 Ga0451576_0039672 3300045051 Bacteria 4984
376 Ga0466958_0138920 3300045836 Bacteria 1529
377 Ga0495592_0434975 3300046454 Bacteria 825
378 Ga0495641_0121808 3300046461 Bacteria 1164
379 Ga0495651_0059579 3300046462 Bacteria 2927
380 Ga0495650_0019154 3300046471 Bacteria 3380
381 Ga0495605_0079851 3300046474 Bacteria 1532
382 Ga0495585_0000057 3300046492 Bacteria 113069
383 Ga0495585_0000648 3300046492 Bacteria 31937
384 Ga0495585_0185511 3300046492 Bacteria 1067
385 Ga0495596_0025532 3300046500 Bacteria 2388
386 Ga0495583_0097416 3300046506 Bacteria 1259
387 Ga0495606_0007717 3300046507 Bacteria 9530
388 Ga0495606_0026272 3300046507 Bacteria 4152
389 Ga0495606_0064593 3300046507 Bacteria 2328
390 Ga0495606_0178541 3300046507 Bacteria 1226
391 Ga0495610_0005897 3300046512 Bacteria 8583
392 Ga0495610_0125360 3300046512 Bacteria 1120
393 Ga0495616_0003284 3300046513 Bacteria 10400
394 Ga0495616_0006705 3300046513 Bacteria 6948
395 Ga0495618_0311297 3300046514 Bacteria 977
396 Ga0495631_0016934 3300046518 Bacteria 3458
397 Ga0495644_0021868 3300046523 Bacteria 2438
398 Ga0495648_0005462 3300046524 Bacteria 10551
399 Ga0495648_0018322 3300046524 Bacteria 4963
400 Ga0495648_0075846 3300046524 Bacteria 1932
401 Ga0495642_0192505 3300046528 Bacteria 888
402 Ga0495652_0090697 3300046529 Bacteria 2500
403 Ga0495652_0466530 3300046529 Bacteria 881
404 Ga0495609_0021764 3300046538 Bacteria 2957
405 Ga0495633_0000275 3300046558 Bacteria 60032
406 Ga0495633_0004626 3300046558 Bacteria 8669
407 Ga0495668_0000017 3300046616 Bacteria 434025
408 Ga0495625_0000007 3300046660 Bacteria 565749
409 Ga0495625_0000901 3300046660 Bacteria 39985
410 Ga0495625_0001789 3300046660 Bacteria 24694
411 Ga0495625_0033207 3300046660 Bacteria 3819
412 Ga0495625_0054811 3300046660 Bacteria 2846
413 Ga0495625_0308200 3300046660 Bacteria 1011
414 Ga0495661_0004589 3300046665 Bacteria 9940
415 Ga0495661_0008200 3300046665 Bacteria 7236
416 Ga0495661_0427619 3300046665 Bacteria 640
417 Ga0495671_0201095 3300046692 Bacteria 966
418 Ga0495649_0000007 3300046694 Bacteria 518037
419 Ga0495660_0069618 3300046810 Bacteria 1870
420 Ga0495660_0229944 3300046810 Bacteria 869
421 Ga0495683_0018342 3300047323 Bacteria 3619
422 Ga0495683_0224280 3300047323 Bacteria 836
423 Ga0495687_007395 3300047443 Bacteria 6471
424 Ga0495677_0017891 3300047445 Unclassified 2569
425 Ga0495679_185267 3300047446 Bacteria 551
426 Ga0495673_0114139 3300047469 Bacteria 1076
427 Ga0495686_0000490 3300047472 Bacteria 58423
428 Ga0495686_0000729 3300047472 Bacteria 44005
429 Ga0495686_0004691 3300047472 Bacteria 11088
430 Ga0495686_0017335 3300047472 Bacteria 4856
431 Ga0495686_0135730 3300047472 Bacteria 1455
432 Ga0495686_0314040 3300047472 Bacteria 861
433 Ga0495614_0003480 3300048089 Bacteria 7048
434 Ga0496115_0173946 3300048918 Bacteria 1780
435 Ga0496117_0007456 3300048920 Bacteria 10680
436 Ga0496118_0051861 3300048921 Bacteria 3135
437 Ga0496122_0003438 3300048925 Bacteria 20821
438 Ga0496123_0020394 3300048926 Bacteria 5186
439 Ga0496124_0196615 3300048927 Bacteria 1538
440 Ga0495678_003805 3300049459 Bacteria 9099
441 Ga0501033_0045046 3300049570 Unclassified 3284
442 Ga0501034_0010395 3300049571 Bacteria 9698
443 Ga0501038_0731783 3300049574 Bacteria 739
444 Ga0501223_001696 3300049663 Bacteria 5042
445 Ga0501240_000352 3300049673 Bacteria 3635
446 Ga0501044_0030948 3300049823 Bacteria 5635
447 Ga0501044_0662441 3300049823 Bacteria 932
448 nmdc:mga0k408_151_c2 3300050493 Bacteria 30883
449 nmdc:mga0k408_23015_c1 3300050493 Bacteria 3511
450 nmdc:mga0k408_63_c1 3300050493 Bacteria 52809
451 nmdc:mga07m45_507485_c1 3300050496 Bacteria 698
452 Ga0500635_0000719 3300053080 Bacteria 8328
453 Ga0500635_0084263 3300053080 Bacteria 1147
454 Ga0500618_000033 3300053125 Bacteria 121886
455 Ga0500622_0000417 3300053156 Bacteria 40427
456 Ga0500624_000447 3300053157 Bacteria 12407
457 2842905003 2842903701 Bacteria 6986368
458 2887380077 2887375801 Bacteria 5334027
459 2890740262 2890737413 Bacteria 4269751
460 2896346560 2896344016 Bacteria 3811746
461 2898713735 2898713307 Bacteria 4110805
462 2904782701 2904780799 Bacteria 5840761
463 2919180311 2919177583 Bacteria 5641607
464 2919439771 2919437846 Bacteria 6199444
465 2932087104 2932082852 Bacteria 6563563
466 2977234520 2977232053 Bacteria 5485925
467 3003233989 3003233435 Bacteria 4458031
468 8055591245 8055588893 Bacteria 3619545
469 Ga0495606_0061425
470 SwRhRL2b_contig_2461763
471 JGI24736J21556_1003173
472 JGI24739J22299_10010223
473 JGI24737J22298_10001803
474 JGI24737J22298_10021871
475 JGI24735J21928_10000084
476 JGI24735J21928_10039963
477 JGI24735J21928_10092979
478 JGI24744J21845_10002386
479 JGI25162J39368_1000097
480 JGI25162J39368_1001654
481 JGI25164J39214_1006838
482 JGI25165J46597_1000733
483 rootH1_10048299
484 rootH1_10112531
485 rootH2_10009716
486 rootH2_10033863
487 rootH2_10044604
488 rootH2_10059924
489 rootH1_10025651
490 rootH1_10033417
491 rootH1_10120143
492 rootH1_10131146
493 Ga0065714_10084558
494 Ga0065704_10001986
495 Ga0065704_10145283
496 Ga0070658_10000069
497 Ga0070658_10166418
498 Ga0070658_10234638
499 Ga0070658_10290223
500 Ga0070676_10015301
501 Ga0070680_100019054
502 Ga0068868_100101616
503 Ga0070660_100046805
504 Ga0070660_100133728
505 Ga0070689_100609380
506 Ga0070673_100103439
507 Ga0070673_102011362
508 Ga0070659_100002766
509 Ga0070659_100009288
510 Ga0070659_100435418
511 Ga0070667_101214530
512 Ga0070663_100007042
513 Ga0070678_100179802
514 Ga0070678_100214102
515 Ga0070662_100000186
516 Ga0070662_100117258
517 Ga0070681_10011702
518 Ga0070698_101387595
519 Ga0070679_100045254
520 Ga0070679_100481493
521 Ga0070684_100073584
522 Ga0068853_100010772
523 Ga0068853_100073967
524 Ga0068853_100266251
525 Ga0070665_100000017
526 Ga0068855_100000097
527 Ga0068855_100004838
528 Ga0068855_100010260
529 Ga0068855_100180536
530 Ga0068855_100395865
531 Ga0068855_100565927
532 Ga0068855_100648299
533 Ga0068855_100898374
534 Ga0068855_101023678
535 Ga0068855_101270168
536 Ga0070664_101186683
537 Ga0068857_100018843
538 Ga0068857_100166817
539 Ga0068857_100452795
540 Ga0068854_100584884
541 Ga0068856_100000189
542 Ga0068856_100002033
543 Ga0068856_100235576
544 Ga0068856_100697705
545 Ga0068856_101410028
546 Ga0068852_100004339
547 Ga0068852_100296641
548 Ga0068852_100725054
549 Ga0068859_100043365
550 Ga0068864_102291825
551 Ga0068861_100979094
552 Ga0068860_100007247
553 Ga0068862_100342734
554 Ga0070716_100522109
555 Ga0075366_10000677
556 Ga0075366_10027376
557 Ga0068871_100480975
558 Ga0068865_100001165
559 Ga0097620_100043370
560 Ga0105240_10000321
561 Ga0105240_10009251
562 Ga0105240_10028247
563 Ga0105240_10041945
564 Ga0105240_10266898
565 Ga0105240_10330718
566 Ga0105240_10469361
567 Ga0105240_10657839
568 Ga0105240_12452363
569 Ga0105245_10804973
570 Ga0105243_10078741
571 Ga0105241_10001000
572 Ga0105241_10069375
573 Ga0105241_10143974
574 Ga0105241_10147392
575 Ga0105241_10341711
576 Ga0105242_10213428
577 Ga0105237_10000273
578 Ga0105237_10003787
579 Ga0105237_10004463
580 Ga0105237_10012487
581 Ga0105237_10032439
582 Ga0105237_10073968
583 Ga0105237_10099788
584 Ga0105237_10227143
585 Ga0105237_10467363
586 Ga0105237_10468588
587 Ga0105237_11397165
588 Ga0105238_10038734
589 Ga0105238_10039673
590 Ga0105238_10183376
591 Ga0105249_10007947
592 Ga0105239_10000014
593 Ga0105239_10000017
594 Ga0105239_10000821
595 Ga0105239_10004179
596 Ga0105239_10009748
597 Ga0105239_10083740
598 Ga0105239_10089486
599 Ga0105239_10103179
600 Ga0105239_10149651
601 Ga0105239_10161839
602 Ga0105239_10540398
603 Ga0105239_10730321
604 Ga0105246_10040797
605 Ga0157373_10003628
606 Ga0157373_10047399
607 Ga0157371_10000297
608 Ga0157371_10001621
609 Ga0157371_10003113
610 Ga0157371_10207871
611 Ga0157370_10018511
612 Ga0157370_10018680
613 Ga0157370_10047250
614 Ga0157370_10047550
615 Ga0157370_10561113
616 Ga0157370_10871194
617 Ga0157369_10000772
618 Ga0157369_10055076
619 Ga0157369_10074716
620 Ga0157369_10096572
621 Ga0157369_10476202
622 Ga0157374_10000825
623 Ga0157374_10037163
624 Ga0157374_10127344
625 Ga0157374_10164065
626 Ga0157374_10378086
627 Ga0157374_10445675
628 Ga0157374_11358691
629 Ga0157378_10034988
630 Ga0157378_10035761
631 Ga0163162_10072237
632 Ga0163162_10081280
633 Ga0163162_10801839
634 Ga0157372_10000009
635 Ga0157372_10002480
636 Ga0157372_10011278
637 Ga0157372_10097258
638 Ga0157372_10126973
639 Ga0157372_11784156
640 Ga0157375_10159557
641 Ga0157375_10403132
642 Ga0182008_10301541
643 Ga0157377_10273974
644 Ga0182007_10032142
645 Ga0163161_10087213
646 Ga0163161_10244723
647 Ga0213873_10132035
648 Ga0213872_10072327
649 Ga0207427_100066
650 Ga0209437_100010
651 Ga0209437_100030
652 Ga0209026_1000246
653 Ga0209026_1009476
654 Ga0209233_1000017
655 Ga0209233_1000829
656 Ga0209455_1004736
657 Ga0207647_10000036
658 Ga0207647_10003216
659 Ga0207645_10000767
660 Ga0207705_10000032
661 Ga0207705_10188698
662 Ga0207705_10225853
663 Ga0207705_10505920
664 Ga0207705_11037813
665 Ga0207654_10045709
666 Ga0207654_10060455
667 Ga0207654_10062111
668 Ga0207654_10068977
669 Ga0207654_10092051
670 Ga0207707_10008912
671 Ga0207695_10000197
672 Ga0207695_10002602
673 Ga0207695_10030986
674 Ga0207695_10091252
675 Ga0207695_10108796
676 Ga0207695_10146507
677 Ga0207695_10170790
678 Ga0207695_10377984
679 Ga0207695_11254341
680 Ga0207671_10002335
681 Ga0207671_10003413
682 Ga0207671_10003709
683 Ga0207671_10004896
684 Ga0207671_10008207
685 Ga0207671_10056958
686 Ga0207671_10084372
687 Ga0207671_10137925
688 Ga0207671_10173670
689 Ga0207660_10014016
690 Ga0207657_10062996
691 Ga0207657_10181030
692 Ga0207649_10959303
693 Ga0207652_10015719
694 Ga0207652_11074401
695 Ga0207694_10016665
696 Ga0207694_10136571
697 Ga0207694_10330619
698 Ga0207659_10555139
699 Ga0207687_10538383
700 Ga0207644_10040413
701 Ga0207690_10000216
702 Ga0207690_10123456
703 Ga0207690_10173588
704 Ga0207706_10000125
705 Ga0207706_10210380
706 Ga0207709_10000026
707 Ga0207709_10407892
708 Ga0207669_10314701
709 Ga0207704_10000043
710 Ga0207691_10210766
711 Ga0207661_10047813
712 Ga0207667_10001087
713 Ga0207667_10004753
714 Ga0207667_10058932
715 Ga0207667_10119173
716 Ga0207667_10124037
717 Ga0207667_10299638
718 Ga0207667_10450641
719 Ga0207667_10558693
720 Ga0207667_11095618
721 Ga0207667_11674585
722 Ga0207651_10455432
723 Ga0207712_10008200
724 Ga0207640_11090846
725 Ga0207658_10641075
726 Ga0207677_10074751
727 Ga0207639_10009142
728 Ga0207639_10096013
729 Ga0207639_10884580
730 Ga0207678_10017806
731 Ga0207702_10000393
732 Ga0207702_10025453
733 Ga0207702_10366132
734 Ga0207702_10632393
735 Ga0207702_11207252
736 Ga0207676_11726257
737 Ga0207674_10033030
738 Ga0207674_10190473
739 Ga0207674_11064849
740 Ga0207683_10223354
741 Ga0207683_10245967
742 Ga0207698_10004007
743 Ga0207698_10600818
744 Ga0207698_11419988
745 Ga0268266_10000037
746 Ga0268265_10079875
747 Ga0268264_10041355
748 Ga0265334_10159030
749 Ga0307517_10001881
750 Ga0307515_10000790
751 Ga0307515_10001565
752 Ga0307515_10062818
753 Ga0307515_10093363
754 Ga0265338_10010649
755 Ga0265338_10295679
756 Ga0265338_10658627
757 Ga0316177_1221497
758 Ga0316176_1014596
759 Ga0314311_1061985
760 Ga0316183_1016718
761 Ga0316181_1091070
762 Ga0316182_1143412
763 Ga0316182_1148669
764 Ga0307408_100000445
765 Ga0307408_100000628
766 Ga0307408_100001834
767 Ga0307408_100959556
768 Ga0307405_10223170
769 Ga0307413_10069699
770 Ga0307413_11478628
771 Ga0307406_11689248
772 Ga0307412_10001942
773 Ga0307412_10034482
774 Ga0307412_10296828
775 Ga0307416_100341540
776 Ga0307414_10115606
777 Ga0307414_10292399
778 Ga0307414_10955645
779 Ga0307414_11205996
780 Ga0307411_10066871
781 Ga0307507_10000143
782 Ga0307510_10000149
783 Ga0373926_0084527
784 Ga0395899_0000017
785 Ga0395899_0001519
786 Ga0395899_0003831
787 Ga0395899_0068096
788 Ga0395900_0000523
789 Ga0395900_0005417
790 Ga0395900_0005978
791 Ga0395898_0003563
792 Ga0395898_0075703
793 Ga0395905_0006175
794 Ga0395905_0007055
795 Ga0395905_0660716
796 Ga0395901_0007492
797 Ga0395901_0013621
798 Ga0400487_29127
799 Ga0436365_0578888
800 Ga0436360_0974628
801 Ga0436361_0660841
802 Ga0436361_0994528
803 Ga0436362_0029708
804 Ga0451806_696018
805 Ga0451855_1570847
806 Ga0439462_0113379
807 Ga0451577_0030435
808 Ga0451577_0061378
809 Ga0451577_1270198
810 Ga0451577_1564281
811 Ga0466972_0000016
812 Ga0453683_0000021
813 Ga0453683_0000240
814 Ga0453683_0010244
815 Ga0453683_0123297
816 Ga0453683_0162853
817 Ga0453683_0455895
818 Ga0453683_0491368
819 Ga0453683_0556537
820 Ga0453683_0729531
821 Ga0453683_0872485
822 Ga0466966_0004498
823 Ga0466966_0365483
824 Ga0466961_0003281
825 Ga0453684_0000110
826 Ga0453684_0000616
827 Ga0453684_0001099
828 Ga0453684_0021036
829 Ga0453684_0022368
830 Ga0453684_0119613
831 Ga0453684_0121736
832 Ga0453684_0178000
833 Ga0453684_0336063
834 Ga0453684_1743819
835 Ga0466968_0084881
836 Ga0466968_0480156
837 Ga0466970_0001074
838 Ga0466957_0224632
839 Ga0466959_0471786
840 Ga0451576_0000039
841 Ga0451576_0000252
842 Ga0451576_0004871
843 Ga0451576_0039672
844 Ga0466958_0138920
845 Ga0495592_0434975
846 Ga0495641_0121808
847 Ga0495651_0059579
848 Ga0495650_0019154
849 Ga0495605_0079851
850 Ga0495585_0000057
851 Ga0495585_0000648
852 Ga0495585_0185511
853 Ga0495596_0025532
854 Ga0495583_0097416
855 Ga0495606_0007717
856 Ga0495606_0026272
857 Ga0495606_0064593
858 Ga0495606_0178541
859 Ga0495610_0005897
860 Ga0495610_0125360
861 Ga0495616_0003284
862 Ga0495616_0006705
863 Ga0495618_0311297
864 Ga0495631_0016934
865 Ga0495644_0021868
866 Ga0495648_0005462
867 Ga0495648_0018322
868 Ga0495648_0075846
869 Ga0495642_0192505
870 Ga0495652_0090697
871 Ga0495652_0466530
872 Ga0495609_0021764
873 Ga0495633_0000275
874 Ga0495633_0004626
875 Ga0495668_0000017
876 Ga0495625_0000007
877 Ga0495625_0000901
878 Ga0495625_0001789
879 Ga0495625_0033207
880 Ga0495625_0054811
881 Ga0495625_0308200
882 Ga0495661_0004589
883 Ga0495661_0008200
884 Ga0495661_0427619
885 Ga0495671_0201095
886 Ga0495649_0000007
887 Ga0495660_0069618
888 Ga0495660_0229944
889 Ga0495683_0018342
890 Ga0495683_0224280
891 Ga0495687_007395
892 Ga0495677_0017891
893 Ga0495679_185267
894 Ga0495673_0114139
895 Ga0495686_0000490
896 Ga0495686_0000729
897 Ga0495686_0004691
898 Ga0495686_0017335
899 Ga0495686_0135730
900 Ga0495686_0314040
901 Ga0495614_0003480
902 Ga0496115_0173946
903 Ga0496117_0007456
904 Ga0496118_0051861
905 Ga0496122_0003438
906 Ga0496123_0020394
907 Ga0496124_0196615
908 Ga0495678_003805
909 Ga0501033_0045046
910 Ga0501034_0010395
911 Ga0501038_0731783
912 Ga0501223_001696
913 Ga0501240_000352
914 Ga0501044_0030948
915 Ga0501044_0662441
916 nmdc:mga0k408_151_c2
917 nmdc:mga0k408_23015_c1
918 nmdc:mga0k408_63_c1
919 nmdc:mga07m45_507485_c1
920 Ga0500635_0000719
921 Ga0500635_0084263
922 Ga0500618_000033
923 Ga0500622_0000417
924 Ga0500624_000447
925 2842905003
926 2887380077
927 2890740262
928 2896346560
929 2898713735
930 2904782701
931 2919180311
932 2919439771
933 2932087104
934 2977234520
935 3003233989
936 8055591245

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

34

177

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9503 1 144
2dbo-assembly1.cif.gz_A-2 crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus 0.948 1 147
3ko7-assembly3.cif.gz_F dtd from plasmodium falciparum in complex with d-lysine 0.947 1 148
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9457 1 145
3lmv-assembly2.cif.gz_C d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes 0.9411 1 148
ID Description Score Start End Superfamily
af_Q07648_1_150_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.953 1 147 3.50.80.10
af_O14274_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.953 1 148 3.50.80.10
2dboA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.948 1 147 3.50.80.10
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9457 1 145 3.50.80.10
af_O14274_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9407 1 148 3.50.80.10
ID Description Score Start End GO Terms
AF-A0A6L7EAZ0-F1-model_v4 deleted 1.003 1 78
AF-A0A6L7EAZ0-F1-model_v4 deleted 0.9899 1 78
AF-A0A562MVL7-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9728 2 152 GO:0000049
GO:0005737
GO:0016020
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A7X6QAS4-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.97 1 148 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A5Q5G703-F1-model_v4 deleted 0.9682 2 146

Map