metagRoot

F450091

General Info

Members	Datasets	Scaffolds	Average Seq Length
468	276	431	278

Family's Representative Sequence

Representative Sequence	3300044901\|Ga0466960_0013469\|Ga0466960_0013469_1660_2592
Length	310
Sequence	MHPTDAVHRQHRGLFDPAAGRETTDPIDSGILVPMRIDFTKMHGLGNDFIVFDAPAGATLPSPEQWRQLSARHTGIGFDQALVLERPRRADTAVFYRIFNADGGEVEQCGNGARCIAAFLHRRGQASEGAITMDSPAGLIRARIQGPEVVSVDMGVPNFDPRSLPFDASSEASVYQLEVAGTTVEIGAVSMGNPHAVLTVASADAAPVDRLGPAIEAHRRFPNRVNVGFMEIIDRSHIKLRVFERGTGETLACGTGACAAVAVGRHHGRLDAEVHVKVRGGELRVNWGGPGEHIWLTGPAEVSFEGRVEI

Samples

	Sample ID	Description	Type	Environment
1	2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1	Metagenome	Rhizosphere
2	2526164512	Azovibrio restrictus DSM 23866	Isolate	Unclassified
3	2548877040	Paenibacillus sonchi X19-5	Isolate	Rhizosphere
4	2571042143	Paenibacillus graminis RSA19	Isolate	Unclassified
5	2576861424	Paenibacillus sabinae T27	Isolate	Rhizosphere
6	2579778775	Paenibacillus durus P3L-5	Isolate	Unclassified
7	2600255286	Paenibacillus sp. NFR01	Isolate	Rhizoplane
8	2619619294	Paenibacillus durus ATCC 35681	Isolate	Unclassified
9	2643221543	Paenibacillus sp. Root52	Isolate	Unclassified
10	2728368933	Paenibacillus jilunlii DSM 23019	Isolate	Rhizosphere
11	2738543010	Bacillus sp. YR335	Isolate	Unclassified
12	2821111986	Paenibacillus illinoisensis 582	Isolate	Unclassified
13	2864733723	Paenibacillus sp. JGP012	Isolate	Rhizosphere
14	2881636855	Paenibacillus sp. 7197	Isolate	Rhizosphere
15	2885526491	Paenibacillus sp. LK1	Isolate	Rhizosphere
16	2889042446	Paenibacillus sp. 37	Isolate	Rhizosphere
17	2904162308	Paenibacillus sp. AD87	Isolate	Unclassified
18	2904490793	Paenibacillus sp. 1295	Isolate	Rhizosphere
19	2907202186	Paenibacillus sp. HJL G12	Isolate	Unclassified
20	2916178963	Pseudoalteromonas rhizosphaerae RA15	Isolate	Rhizosphere
21	2919160200	Paenibacillus sp. 2003	Isolate	Unclassified
22	2925326138	Paenibacillus hemerocallicola KCTC 33185	Isolate	Unclassified
23	2929206907	Paenibacillus sp. R-74146 Hybrid assembly	Isolate	Unclassified
24	2931384279	Paenibacillus sp. DR312	Isolate	Rhizosphere
25	2938649242	Paenibacillus helianthi P26E	Isolate	Rhizosphere
26	2939679117	Paenibacillus sp. 4624	Isolate	Rhizosphere
27	2945991243	Paenibacillus sp. B21a W2I17	Isolate	Rhizosphere
28	2946053406	Paenibacillus sp. W4I10	Isolate	Rhizosphere
29	2968558590	Paenibacillus sp. P3E	Isolate	Rhizosphere
30	2971403814	Paenibacillus tritici LMG 29502	Isolate	Unclassified
31	2971511577	Paenibacillus apii 7124	Isolate	Rhizosphere
32	2980176882	Paenibacillus apii 7028	Isolate	Rhizosphere
33	2988225383	Paenibacillus sp. P46E	Isolate	Rhizosphere
34	2989392574	Methylomonas rhizoryzae GJ1	Isolate	Unclassified
35	2996632988	Paenibacillus sp. P32E	Isolate	Rhizosphere
36	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
37	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
38	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
39	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
40	3300004800	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
41	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
42	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
43	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
44	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
45	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
46	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
47	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
48	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
49	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
50	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
51	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
52	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
53	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
54	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
55	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
56	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
57	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
58	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
59	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
60	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
61	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
62	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
63	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
64	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
65	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
66	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
67	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
68	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
69	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
70	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
71	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
72	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
73	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
74	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
75	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
76	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
77	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
78	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
79	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
80	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
81	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
82	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
83	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
84	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
85	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
86	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
87	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
88	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
89	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
90	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
91	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
92	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
93	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
94	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
95	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
96	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
97	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
98	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
99	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
100	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
101	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
102	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
103	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
104	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
105	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
106	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
107	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
108	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
109	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
110	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
111	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
112	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
113	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
114	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
115	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
116	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
117	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
162	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
166	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
167	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
168	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
169	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
170	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
171	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
172	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
173	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
174	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
175	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
176	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
177	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
178	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
179	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
180	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
181	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
182	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
183	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
184	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
185	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
186	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
187	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
188	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
189	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
190	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
191	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
192	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
193	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
194	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
195	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
196	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
197	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
198	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
199	3300033528	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
200	3300033529	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
201	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
202	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
203	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
204	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
205	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
206	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
207	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
208	3300038742	Seagrass microbial communities from Seahorse Key, FL, USA - SH0818	Metagenome	Unclassified
209	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
210	3300039110	Seagrass microbial communities from Seahorse Key, FL, USA - SV0319	Metagenome	Unclassified
211	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
212	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
213	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
214	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
215	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
216	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
217	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
218	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
219	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
220	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
221	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
222	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
223	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
224	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
225	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
226	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
227	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
228	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
229	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
230	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
231	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
232	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
233	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
234	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
235	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
236	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
237	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
238	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
239	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
240	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
241	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
242	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
243	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
244	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
245	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
246	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
247	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
248	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
249	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
250	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
251	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
252	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
253	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
254	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
255	3300049161	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
256	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
257	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
258	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
259	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
260	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
261	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
262	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
263	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
264	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
265	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
266	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
267	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
268	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
269	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
270	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
271	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
272	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
273	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
274	8002317523	Cohnella sp. GbtcB17	Isolate	Unclassified
275	8054465665	Paenibacillus sonchi IIRRBNF1	Isolate	Rhizosphere
276	8057977335	Paenibacillus oenotherae DT7-4	Isolate	Unclassified

Type Distribution

Type	Percentage (%)
Metagenomes	90.38
Metatranscriptomes	1.71
Isolates	7.91

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	3.42
Nodule	0
Rhizoplane	1.71
Rhizosphere	80.56
Stem	0
Stem Tuber	0
Unclassified	14.32

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MBSR1b_contig_1360200	2162886012	Bacteria	2940
2	JGI25406J46586_10006643	3300003203	Bacteria	5314
3	rootL2_10213719	3300003322	Bacteria	3610
4	rootH1_10084961	3300003323	Bacteria	8038
5	Ga0055538_1001252	3300003751	Bacteria	5222
6	Ga0058861_11892893	3300004800	Unclassified	1397
7	Ga0065712_10070877	3300005290	Bacteria	5637
8	Ga0065715_10093989	3300005293	Bacteria	4480
9	Ga0065707_10145500	3300005295	Bacteria	1719
10	Ga0070676_10136384	3300005328	Bacteria	1557
11	Ga0070683_100026109	3300005329	Bacteria	5254
12	Ga0070683_100093969	3300005329	Bacteria	2818
13	Ga0070670_100009884	3300005331	Bacteria	8147
14	Ga0070670_100046983	3300005331	Bacteria	3714
15	Ga0070670_100080631	3300005331	Bacteria	2797
16	Ga0070670_100314574	3300005331	Bacteria	1371
17	Ga0068869_100114500	3300005334	Bacteria	2055
18	Ga0068869_100161304	3300005334	Bacteria	1745
19	Ga0070666_10221024	3300005335	Bacteria	1336
20	Ga0070680_100516458	3300005336	Bacteria	1022
21	Ga0070682_100128462	3300005337	Bacteria	1712
22	Ga0070689_100011595	3300005340	Bacteria	6318
23	Ga0070689_100064979	3300005340	Bacteria	2841
24	Ga0070689_100069341	3300005340	Bacteria	2751
25	Ga0070687_100023159	3300005343	Bacteria	2948
26	Ga0070661_100001052	3300005344	Bacteria	19527
27	Ga0070661_100197461	3300005344	Bacteria	1536
28	Ga0070692_10271835	3300005345	Bacteria	1023
29	Ga0070669_100072465	3300005353	Bacteria	2550
30	Ga0070669_100127147	3300005353	Bacteria	1951
31	Ga0070675_100001328	3300005354	Bacteria	18093
32	Ga0070675_100047102	3300005354	Bacteria	3532
33	Ga0070675_100094728	3300005354	Bacteria	2506
34	Ga0070671_100003911	3300005355	Bacteria	11717
35	Ga0070671_100102682	3300005355	Bacteria	2399
36	Ga0070674_100184231	3300005356	Bacteria	1601
37	Ga0070673_100010444	3300005364	Bacteria	6287
38	Ga0070673_100030950	3300005364	Bacteria	4012
39	Ga0070673_100094472	3300005364	Bacteria	2451
40	Ga0070688_100004700	3300005365	Bacteria	7129
41	Ga0070659_100064796	3300005366	Bacteria	2893
42	Ga0070659_100382139	3300005366	Bacteria	1186
43	Ga0070713_100128908	3300005436	Bacteria	2228
44	Ga0070701_10037342	3300005438	Bacteria	2452
45	Ga0070705_100031680	3300005440	Bacteria	2930
46	Ga0070705_100079501	3300005440	Bacteria	2009
47	Ga0070700_100100987	3300005441	Bacteria	1900
48	Ga0070700_100177435	3300005441	Bacteria	1480
49	Ga0070694_100169426	3300005444	Bacteria	1607
50	Ga0068867_100006267	3300005459	Bacteria	8412
51	Ga0070679_100204366	3300005530	Unclassified	1940
52	Ga0070684_100000450	3300005535	Bacteria	28151
53	Ga0070672_100088413	3300005543	Bacteria	2495
54	Ga0070672_100152975	3300005543	Bacteria	1909
55	Ga0070686_100001533	3300005544	Bacteria	12984
56	Ga0070665_100108373	3300005548	Bacteria	2780
57	Ga0070665_100121788	3300005548	Unclassified	2610
58	Ga0068855_100005810	3300005563	Bacteria	15056
59	Ga0070664_100001964	3300005564	Bacteria	16503
60	Ga0070664_100021629	3300005564	Bacteria	5303
61	Ga0068857_100130164	3300005577	Bacteria	2269
62	Ga0068859_100006805	3300005617	Bacteria	11615
63	Ga0068859_100076755	3300005617	Bacteria	3381
64	Ga0068864_100000569	3300005618	Bacteria	31341
65	Ga0068864_100008552	3300005618	Bacteria	8447
66	Ga0068864_100580710	3300005618	Bacteria	1086
67	Ga0068866_10007597	3300005718	Bacteria	4544
68	Ga0068866_10079325	3300005718	Bacteria	1759
69	Ga0068861_100008431	3300005719	Bacteria	7097
70	Ga0068861_100105057	3300005719	Bacteria	2254
71	Ga0068863_100001625	3300005841	Bacteria	22204
72	Ga0068863_100027751	3300005841	Bacteria	5403
73	Ga0068863_100072630	3300005841	Bacteria	3255
74	Ga0068863_100128937	3300005841	Bacteria	2414
75	Ga0068858_100011034	3300005842	Bacteria	8540
76	Ga0068858_100014730	3300005842	Bacteria	7361
77	Ga0068858_100083481	3300005842	Bacteria	2971
78	Ga0068862_100072974	3300005844	Bacteria	2965
79	Ga0068862_100295651	3300005844	Bacteria	1488
80	Ga0081455_10000494	3300005937	Bacteria	51140
81	Ga0081539_10000055	3300005985	Bacteria	257359
82	Ga0097621_100007646	3300006237	Bacteria	7746
83	Ga0097621_100092501	3300006237	Bacteria	2533
84	Ga0097621_100133339	3300006237	Bacteria	2116
85	Ga0068871_100003130	3300006358	Bacteria	11355
86	Ga0068871_100074140	3300006358	Bacteria	2807
87	Ga0075428_100003259	3300006844	Bacteria	17773
88	Ga0075428_100006185	3300006844	Bacteria	13316
89	Ga0075430_100011842	3300006846	Bacteria	7422
90	Ga0075430_100411499	3300006846	Bacteria	1116
91	Ga0075430_100428551	3300006846	Bacteria	1092
92	Ga0075431_100000121	3300006847	Bacteria	50989
93	Ga0075429_100002068	3300006880	Bacteria	16737
94	Ga0075429_100035642	3300006880	Bacteria	4327
95	Ga0068865_100020909	3300006881	Bacteria	4250
96	Ga0097620_100006805	3300006931	Bacteria	11615
97	Ga0097620_100076751	3300006931	Bacteria	3381
98	Ga0105244_10019243	3300009036	Bacteria	3819
99	Ga0105244_10050356	3300009036	Bacteria	2125
100	Ga0105250_10000004	3300009092	Bacteria	438653
101	Ga0105240_10000634	3300009093	Bacteria	64881
102	Ga0105240_10131125	3300009093	Bacteria	3007
103	Ga0105240_10188108	3300009093	Bacteria	2430
104	Ga0111539_10000695	3300009094	Bacteria	43547
105	Ga0111539_10021812	3300009094	Bacteria	7875
106	Ga0111539_10124354	3300009094	Bacteria	3023
107	Ga0111539_10157017	3300009094	Bacteria	2662
108	Ga0105245_10483849	3300009098	Bacteria	1251
109	Ga0114129_10000366	3300009147	Bacteria	52352
110	Ga0114129_10057982	3300009147	Bacteria	5418
111	Ga0105242_10336020	3300009176	Bacteria	1391
112	Ga0105248_10007675	3300009177	Bacteria	11855
113	Ga0105248_10549283	3300009177	Bacteria	1303
114	Ga0105238_10055583	3300009551	Bacteria	3973
115	Ga0105249_10119095	3300009553	Bacteria	2507
116	Ga0105249_10270960	3300009553	Unclassified	1691
117	Ga0105239_10850536	3300010375	Bacteria	1046
118	Ga0105239_10975496	3300010375	Bacteria	974
119	Ga0105246_10030805	3300011119	Bacteria	3546
120	Ga0157378_10042773	3300013297	Bacteria	4021
121	Ga0157378_10636103	3300013297	Bacteria	1081
122	Ga0163162_10071109	3300013306	Bacteria	3532
123	Ga0163162_10098528	3300013306	Bacteria	3013
124	Ga0157372_10037696	3300013307	Bacteria	5333
125	Ga0157372_10228196	3300013307	Bacteria	2158
126	Ga0157375_10064482	3300013308	Bacteria	3647
127	Ga0157375_10122124	3300013308	Bacteria	2716
128	Ga0163163_10003280	3300014325	Bacteria	13721
129	Ga0163163_10041601	3300014325	Bacteria	4495
130	Ga0163163_10168285	3300014325	Bacteria	2238
131	Ga0157380_10183682	3300014326	Bacteria	1840
132	Ga0157377_10004824	3300014745	Bacteria	6265
133	Ga0157379_10000729	3300014968	Bacteria	26640
134	Ga0163161_10079227	3300017792	Bacteria	2415
135	Ga0209784_100184	3300025224	Bacteria	50021
136	Ga0209566_100054	3300025225	Bacteria	221422
137	Ga0209437_104121	3300025233	Bacteria	2577
138	Ga0207696_1000056	3300025711	Bacteria	251959
139	Ga0207655_1034699	3300025728	Bacteria	2264
140	Ga0207642_10012487	3300025899	Bacteria	3067
141	Ga0207688_10007238	3300025901	Bacteria	6036
142	Ga0207643_10032665	3300025908	Bacteria	2908
143	Ga0207643_10055142	3300025908	Bacteria	2260
144	Ga0207705_10138469	3300025909	Bacteria	1816
145	Ga0207654_10268542	3300025911	Bacteria	1150
146	Ga0207707_10147261	3300025912	Bacteria	2059
147	Ga0207707_10261896	3300025912	Bacteria	1500
148	Ga0207695_10007694	3300025913	Bacteria	13643
149	Ga0207695_10093691	3300025913	Bacteria	3012
150	Ga0207660_10047272	3300025917	Bacteria	3041
151	Ga0207662_10003037	3300025918	Bacteria	8566
152	Ga0207649_10002291	3300025920	Bacteria	10765
153	Ga0207649_10159056	3300025920	Bacteria	1564
154	Ga0207652_10252317	3300025921	Bacteria	1591
155	Ga0207681_10050583	3300025923	Bacteria	2812
156	Ga0207694_10194578	3300025924	Bacteria	1648
157	Ga0207650_10089505	3300025925	Bacteria	2349
158	Ga0207659_10001788	3300025926	Bacteria	12706
159	Ga0207659_10100464	3300025926	Bacteria	2180
160	Ga0207700_10192884	3300025928	Bacteria	1713
161	Ga0207644_10002229	3300025931	Bacteria	12583
162	Ga0207686_10211638	3300025934	Bacteria	1394
163	Ga0207704_10037998	3300025938	Bacteria	2787
164	Ga0207691_10058434	3300025940	Bacteria	3508
165	Ga0207691_10079368	3300025940	Bacteria	2954
166	Ga0207691_10474225	3300025940	Bacteria	1064
167	Ga0207711_10003647	3300025941	Bacteria	13317
168	Ga0207689_10009142	3300025942	Bacteria	8576
169	Ga0207689_10063995	3300025942	Bacteria	3026
170	Ga0207689_10097091	3300025942	Bacteria	2420
171	Ga0207689_10165581	3300025942	Bacteria	1821
172	Ga0207667_10006775	3300025949	Bacteria	13837
173	Ga0207712_10287397	3300025961	Bacteria	1344
174	Ga0207712_10393468	3300025961	Bacteria	1163
175	Ga0207668_10007813	3300025972	Bacteria	6363
176	Ga0207640_10413191	3300025981	Bacteria	1102
177	Ga0207658_10009061	3300025986	Bacteria	6750
178	Ga0207658_10405567	3300025986	Bacteria	1199
179	Ga0207703_10019699	3300026035	Bacteria	5274
180	Ga0207703_10026739	3300026035	Bacteria	4545
181	Ga0207678_10139547	3300026067	Bacteria	2068
182	Ga0207708_10003483	3300026075	Bacteria	11606
183	Ga0207708_10119810	3300026075	Bacteria	2050
184	Ga0207708_10135332	3300026075	Bacteria	1930
185	Ga0207641_10004671	3300026088	Bacteria	11815
186	Ga0207641_10006938	3300026088	Bacteria	9479
187	Ga0207648_10000935	3300026089	Bacteria	32936
188	Ga0207648_10022877	3300026089	Bacteria	5607
189	Ga0207676_10026083	3300026095	Bacteria	4342
190	Ga0207676_10057880	3300026095	Bacteria	3054
191	Ga0207674_10006902	3300026116	Bacteria	13309
192	Ga0207675_100015332	3300026118	Bacteria	7151
193	Ga0207675_100081710	3300026118	Bacteria	3030
194	Ga0207675_100298497	3300026118	Bacteria	1569
195	Ga0207683_10008069	3300026121	Bacteria	9004
196	Ga0207683_10053851	3300026121	Bacteria	3528
197	Ga0209996_1005594	3300027395	Bacteria	1611
198	Ga0210000_1000829	3300027462	Bacteria	4286
199	Ga0209999_1000416	3300027543	Bacteria	6574
200	Ga0209982_1012027	3300027552	Bacteria	1297
201	Ga0209970_1002794	3300027614	Bacteria	2952
202	Ga0209971_1004264	3300027682	Bacteria	3397
203	Ga0207428_10028194	3300027907	Bacteria	4667
204	Ga0207428_10048499	3300027907	Bacteria	3407
205	Ga0207428_10055587	3300027907	Bacteria	3147
206	Ga0207428_10114160	3300027907	Bacteria	2076
207	Ga0268266_10016580	3300028379	Bacteria	6295
208	Ga0268266_10061574	3300028379	Bacteria	3237
209	Ga0268265_10013117	3300028380	Bacteria	5628
210	Ga0268265_10066383	3300028380	Bacteria	2789
211	Ga0268265_10120789	3300028380	Bacteria	2158
212	Ga0268265_10133374	3300028380	Bacteria	2068
213	Ga0268264_10537654	3300028381	Bacteria	1144
214	Ga0265319_1005624	3300028563	Bacteria	5963
215	Ga0307515_10135691	3300028794	Bacteria	2678
216	Ga0265338_10007770	3300028800	Bacteria	13193
217	Ga0265324_10082712	3300029957	Bacteria	1092
218	Ga0307511_10000065	3300030521	Bacteria	88859
219	Ga0265332_10001772	3300031238	Bacteria	11647
220	Ga0265332_10061161	3300031238	Bacteria	1610
221	Ga0265328_10005098	3300031239	Bacteria	5655
222	Ga0265328_10016223	3300031239	Bacteria	2901
223	Ga0265329_10049182	3300031242	Bacteria	1344
224	Ga0265331_10032346	3300031250	Bacteria	2592
225	Ga0265327_10026495	3300031251	Bacteria	3355
226	Ga0265327_10045065	3300031251	Unclassified	2347
227	Ga0265327_10106501	3300031251	Bacteria	1345
228	Ga0265316_10235081	3300031344	Bacteria	1348
229	Ga0307513_10124873	3300031456	Bacteria	2532
230	Ga0307509_10000032	3300031507	Bacteria	202919
231	Ga0307509_10000978	3300031507	Bacteria	48968
232	Ga0307509_10101550	3300031507	Bacteria	2911
233	Ga0307509_10246917	3300031507	Bacteria	1572
234	Ga0307408_100118513	3300031548	Bacteria	2047
235	Ga0307408_100178683	3300031548	Bacteria	1700
236	Ga0265313_10002857	3300031595	Bacteria	14491
237	Ga0316575_10028795	3300031665	Bacteria	2166
238	Ga0316579_10021556	3300031691	Bacteria	2872
239	Ga0316579_10046173	3300031691	Bacteria	2032
240	Ga0265314_10012290	3300031711	Bacteria	6996
241	Ga0265342_10037517	3300031712	Bacteria	2954
242	Ga0316576_10009883	3300031727	Bacteria	6176
243	Ga0316576_10117407	3300031727	Bacteria	1996
244	Ga0316576_10117993	3300031727	Bacteria	1991
245	Ga0316576_10353938	3300031727	Bacteria	1092
246	Ga0316578_10043662	3300031728	Bacteria	2604
247	Ga0316578_10053920	3300031728	Bacteria	2357
248	Ga0316578_10068084	3300031728	Bacteria	2105
249	Ga0316578_10074530	3300031728	Bacteria	2012
250	Ga0316578_10255256	3300031728	Bacteria	1051
251	Ga0307405_10296494	3300031731	Bacteria	1224
252	Ga0307413_10011947	3300031824	Bacteria	4297
253	Ga0307413_10014872	3300031824	Bacteria	3969
254	Ga0307410_10029948	3300031852	Bacteria	3473
255	Ga0307410_10030947	3300031852	Bacteria	3427
256	Ga0307410_10126731	3300031852	Bacteria	1870
257	Ga0307406_10011328	3300031901	Bacteria	5058
258	Ga0307407_10054533	3300031903	Bacteria	2306
259	Ga0307412_10271881	3300031911	Bacteria	1326
260	Ga0307409_100013352	3300031995	Bacteria	5282
261	Ga0307409_100032115	3300031995	Bacteria	3801
262	Ga0307411_10002813	3300032005	Bacteria	7843
263	Ga0307411_10107823	3300032005	Bacteria	1986
264	Ga0316583_10034684	3300032133	Bacteria	1790
265	Ga0316583_10058159	3300032133	Bacteria	1357
266	Ga0316585_10028838	3300032137	Bacteria	1737
267	Ga0316585_10054035	3300032137	Bacteria	1291
268	Ga0316580_10015702	3300032139	Bacteria	2317
269	Ga0316593_10016099	3300032168	Bacteria	2261
270	Ga0307507_10038372	3300033179	Bacteria	4858
271	Ga0316588_1001030	3300033528	Bacteria	4370
272	Ga0316588_1004173	3300033528	Bacteria	2709
273	Ga0316587_1003236	3300033529	Bacteria	2266
274	Ga0316596_1003399	3300033541	Bacteria	3484
275	Ga0316596_1050224	3300033541	Bacteria	1103
276	Ga0373952_0001712	3300035092	Bacteria	3990
277	Ga0316574_0005596	3300035398	Bacteria	6713
278	Ga0316574_0048884	3300035398	Bacteria	2628
279	Ga0316574_0049235	3300035398	Bacteria	2620
280	Ga0316574_0100052	3300035398	Bacteria	1855
281	Ga0316574_0130973	3300035398	Bacteria	1614
282	Ga0316582_0000613	3300036647	Bacteria	13870
283	Ga0316582_0035439	3300036647	Bacteria	3081
284	Ga0316582_0065619	3300036647	Bacteria	2337
285	Ga0316582_0152875	3300036647	Bacteria	1561
286	Ga0316582_0160767	3300036647	Bacteria	1521
287	Ga0316584_0003100	3300036712	Bacteria	10726
288	Ga0316584_0005549	3300036712	Bacteria	8484
289	Ga0316584_0019963	3300036712	Bacteria	4851
290	Ga0316584_0020580	3300036712	Bacteria	4786
291	Ga0316584_0051037	3300036712	Bacteria	3093
292	Ga0316584_0110683	3300036712	Bacteria	2055
293	Ga0316584_0166893	3300036712	Bacteria	1634
294	Ga0395899_0008785	3300037312	Bacteria	7775
295	Ga0316581_0039263	3300037588	Bacteria	1440
296	Ga0400486_14879	3300038742	Bacteria	17024
297	Ga0400486_21531	3300038742	Bacteria	15002
298	Ga0400483_011190	3300039062	Bacteria	182340
299	Ga0400483_027611	3300039062	Bacteria	8038
300	Ga0400483_063264	3300039062	Bacteria	12293
301	Ga0400483_173168	3300039062	Bacteria	6871
302	Ga0400483_219863	3300039062	Bacteria	173210
303	Ga0400483_222691	3300039062	Bacteria	32176
304	Ga0400483_227911	3300039062	Bacteria	9073
305	Ga0400483_249256	3300039062	Bacteria	2455
306	Ga0400487_20182	3300039110	Bacteria	11624
307	Ga0436360_0688356	3300039438	Bacteria	1906
308	Ga0436363_1273526	3300039450	Bacteria	6844
309	Ga0436362_0042786	3300039453	Bacteria	1326
310	Ga0439465_0087339	3300041413	Bacteria	1064
311	Ga0451845_0010870	3300041501	Bacteria	2733
312	Ga0451853_1271237	3300041512	Bacteria	2714
313	Ga0439448_0062499	3300042005	Bacteria	1232
314	Ga0450906_020303	3300042145	Bacteria	1189
315	Ga0451577_0000022	3300042876	Bacteria	437063
316	Ga0451577_0000096	3300042876	Bacteria	195129
317	Ga0451577_0013045	3300042876	Bacteria	7797
318	Ga0451577_0017513	3300042876	Bacteria	6619
319	Ga0451577_0047431	3300042876	Bacteria	3841
320	Ga0451577_0073347	3300042876	Bacteria	3054
321	Ga0451577_0077435	3300042876	Bacteria	2965
322	Ga0451577_0106475	3300042876	Bacteria	2507
323	Ga0451577_0170303	3300042876	Bacteria	1962
324	Ga0453683_0000010	3300044673	Bacteria	470890
325	Ga0453683_0000358	3300044673	Bacteria	55077
326	Ga0453683_0060663	3300044673	Bacteria	2365
327	Ga0453683_0063713	3300044673	Bacteria	2304
328	Ga0453684_0000547	3300044712	Bacteria	142253
329	Ga0453684_0000607	3300044712	Bacteria	131953
330	Ga0453684_0000826	3300044712	Bacteria	104663
331	Ga0453684_0003018	3300044712	Bacteria	39143
332	Ga0453684_0010827	3300044712	Bacteria	15457
333	Ga0453684_0045361	3300044712	Bacteria	5865
334	Ga0453684_0069662	3300044712	Bacteria	4459
335	Ga0453684_0086744	3300044712	Bacteria	3882
336	Ga0453684_0196975	3300044712	Bacteria	2351
337	Ga0453684_0324030	3300044712	Bacteria	1744
338	Ga0453684_0428771	3300044712	Unclassified	1476
339	Ga0466960_0013469	3300044901	Bacteria	3476
340	Ga0466959_0019553	3300045049	Bacteria	4980
341	Ga0466959_0095360	3300045049	Bacteria	2134
342	Ga0451576_0000044	3300045051	Bacteria	334467
343	Ga0451576_0000200	3300045051	Bacteria	150230
344	Ga0451576_0016220	3300045051	Bacteria	8228
345	Ga0451576_0037251	3300045051	Bacteria	5152
346	Ga0451576_0154343	3300045051	Bacteria	2394
347	Ga0451576_0167442	3300045051	Bacteria	2293
348	Ga0495603_0060349	3300046455	Bacteria	2241
349	Ga0495650_0008767	3300046471	Bacteria	5852
350	Ga0495594_0311367	3300046499	Bacteria	897
351	Ga0495644_0009021	3300046523	Bacteria	3837
352	Ga0495621_0045302	3300046539	Bacteria	1558
353	Ga0495668_0174944	3300046616	Bacteria	1176
354	Ga0495668_0269868	3300046616	Bacteria	932
355	Ga0495634_0106626	3300046642	Bacteria	1806
356	Ga0495647_0001571	3300046681	Bacteria	7052
357	Ga0495613_0067483	3300046689	Unclassified	2611
358	Ga0495660_0146608	3300046810	Bacteria	1169
359	Ga0495672_0074233	3300047320	Bacteria	1916
360	Ga0495681_0020918	3300047470	Bacteria	3537
361	Ga0496103_0004035	3300048906	Bacteria	8921
362	Ga0496104_0551766	3300048907	Bacteria	1063
363	Ga0496108_0014429	3300048911	Bacteria	6451
364	Ga0496109_0273386	3300048912	Bacteria	1592
365	Ga0496111_0076245	3300048914	Bacteria	2444
366	Ga0496112_0165562	3300048915	Bacteria	2177
367	Ga0496115_0311099	3300048918	Bacteria	1290
368	Ga0496116_0000008	3300048919	Bacteria	726753
369	Ga0496116_0001769	3300048919	Bacteria	23548
370	Ga0496116_0013964	3300048919	Bacteria	6435
371	Ga0496116_0062764	3300048919	Bacteria	2398
372	Ga0496116_0064114	3300048919	Unclassified	2363
373	Ga0496117_0000041	3300048920	Bacteria	317207
374	Ga0496117_0036212	3300048920	Bacteria	3696
375	Ga0496118_0007015	3300048921	Bacteria	12134
376	Ga0496119_0000166	3300048922	Bacteria	92117
377	Ga0496119_0047159	3300048922	Bacteria	2683
378	Ga0496120_0000406	3300048923	Bacteria	69216
379	Ga0496121_0000012	3300048924	Bacteria	653131
380	Ga0496121_0007314	3300048924	Bacteria	13352
381	Ga0496121_0080186	3300048924	Bacteria	2589
382	Ga0496122_0040384	3300048925	Bacteria	3709
383	Ga0496122_0043604	3300048925	Bacteria	3512
384	Ga0496122_0074790	3300048925	Bacteria	2394
385	Ga0496122_0106294	3300048925	Bacteria	1858
386	Ga0496123_0091570	3300048926	Bacteria	1803
387	Ga0496123_0106733	3300048926	Bacteria	1613
388	Ga0496124_0000720	3300048927	Bacteria	54197
389	Ga0496124_0000748	3300048927	Bacteria	53309
390	Ga0496125_0015664	3300048928	Bacteria	7316
391	Ga0496125_0290508	3300048928	Bacteria	1007
392	Ga0496126_0002746	3300048929	Bacteria	23247
393	Ga0496126_0002903	3300048929	Bacteria	22326
394	Ga0496126_0015051	3300048929	Bacteria	7796
395	Ga0501305_007586	3300049161	Bacteria	1381
396	Ga0501033_0112182	3300049570	Bacteria	1984
397	Ga0501037_0002243	3300049573	Bacteria	13973
398	Ga0501047_0016003	3300049581	Bacteria	7151
399	Ga0501047_0044300	3300049581	Bacteria	4299
400	Ga0501047_0048433	3300049581	Bacteria	4104
401	Ga0501070_0046273	3300049586	Bacteria	3618
402	Ga0501080_0052637	3300049742	Bacteria	3789
403	Ga0501044_0065972	3300049823	Bacteria	3691
404	nmdc:mga05p37_45003_c1	3300050507	Bacteria	5430
405	nmdc:mga05p37_66842_c1	3300050507	Bacteria	4422
406	nmdc:mga09592_10130_c1	3300050508	Bacteria	7669
407	nmdc:mga09592_8752_c1	3300050508	Bacteria	8237
408	nmdc:mga0qj67_11001_c1	3300050509	Bacteria	6774
409	nmdc:mga0qj67_18250_c1	3300050509	Bacteria	5346
410	nmdc:mga0qj67_419433_c1	3300050509	Bacteria	1079
411	nmdc:mga0qj67_67675_c1	3300050509	Bacteria	2845
412	nmdc:mga06r32_1365_c1	3300050510	Bacteria	22070
413	nmdc:mga06r32_3_c1	3300050510	Bacteria	164616
414	nmdc:mga06r32_723_c1	3300050510	Bacteria	28939
415	nmdc:mga08y16_163725_c1	3300050511	Bacteria	2311
416	nmdc:mga08y16_169214_c1	3300050511	Bacteria	2270
417	nmdc:mga08y16_23221_c1	3300050511	Bacteria	6548
418	nmdc:mga08y16_31807_c1	3300050511	Bacteria	5549
419	nmdc:mga08y16_579458_c1	3300050511	Bacteria	1133
420	Ga0500646_0003039	3300053090	Bacteria	4310
421	Ga0500583_0137672	3300053092	Bacteria	1212
422	Ga0500614_062740	3300053123	Bacteria	1003
423	Ga0500568_0012019	3300053139	Bacteria	3992
424	Ga0500568_0029972	3300053139	Bacteria	2254
425	Ga0500568_0030856	3300053139	Bacteria	2216
426	Ga0500568_0121396	3300053139	Bacteria	973
427	Ga0500588_0005806	3300053146	Bacteria	2761
428	Ga0500616_0000096	3300053153	Bacteria	179125
429	Ga0500616_0049825	3300053153	Bacteria	2214
430	Ga0500622_0010849	3300053156	Bacteria	4978
431	Ga0500622_0075620	3300053156	Bacteria	1694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300046642	Ga0495634_0106626	Ga0495634_0106626_23_709	205
2	3300031238	Ga0265332_10061161	Ga0265332_100611612	249
3	3300031239	Ga0265328_10005098	Ga0265328_100050984	249
4	3300031242	Ga0265329_10049182	Ga0265329_100491822	249
5	3300039062	Ga0400483_063264	Ga0400483_063264_11121_11951	250
6	3300039062	Ga0400483_222691	Ga0400483_222691_26471_27301	250
7	3300053090	Ga0500646_0003039	Ga0500646_0003039_1931_2803	250
8	3300053139	Ga0500568_0029972	Ga0500568_0029972_453_1325	250
9	3300044673	Ga0453683_0060663	Ga0453683_0060663_1325_2158	253
10	3300048928	Ga0496125_0290508	Ga0496125_0290508_177_995	253
11	iso_pu_bacteria	8002317523	8002322308	253
12	iso_pu_bacteria	8057977335	8057980336	253
13	iso_pu_bacteria	2643221543	2643738149	254
14	iso_pu_bacteria	2821111986	2821114547	254
15	iso_pu_bacteria	2864733723	2864737560	254
16	iso_pu_bacteria	2885526491	2885527509	254
17	iso_pu_bacteria	2904162308	2904163331	254
18	iso_pu_bacteria	2919160200	2919162687	254
19	iso_pu_bacteria	2939679117	2939679830	254
20	iso_pu_bacteria	2945991243	2945997622	254
21	iso_pu_bacteria	2946053406	2946053839	254
22	3300048919	Ga0496116_0000008	Ga0496116_0000008_386140_386937	255
23	3300048924	Ga0496121_0000012	Ga0496121_0000012_328818_329615	255
24	iso_pu_bacteria	2548877040	2550904887	255
25	iso_pu_bacteria	2571042143	2571528342	255
26	iso_pu_bacteria	2576861424	2578336761	255
27	iso_pu_bacteria	2579778775	2580932146	255
28	iso_pu_bacteria	2600255286	2601638626	255
29	iso_pu_bacteria	2619619294	2621274971	255
30	iso_pu_bacteria	2728368933	2728532524	255
31	iso_pu_bacteria	2881636855	2881637981	255
32	iso_pu_bacteria	2907202186	2907205673	255
33	iso_pu_bacteria	2925326138	2925332548	255
34	iso_pu_bacteria	2929206907	2929210442	255
35	iso_pu_bacteria	2938649242	2938649782	255
36	iso_pu_bacteria	2968558590	2968561261	255
37	iso_pu_bacteria	2971403814	2971405766	255
38	iso_pu_bacteria	2971511577	2971515585	255
39	iso_pu_bacteria	2980176882	2980180088	255
40	iso_pu_bacteria	2988225383	2988229347	255
41	iso_pu_bacteria	2996632988	2996639059	255
42	iso_pu_bacteria	8054465665	8054467956	255
43	3300025225	Ga0209566_100054	Ga0209566_100054123	257
44	3300031251	Ga0265327_10045065	Ga0265327_100450652	257
45	3300048919	Ga0496116_0001769	Ga0496116_0001769_740_1570	257
46	3300048920	Ga0496117_0036212	Ga0496117_0036212_1462_2292	257
47	3300048922	Ga0496119_0000166	Ga0496119_0000166_46470_47300	257
48	3300048923	Ga0496120_0000406	Ga0496120_0000406_46002_46832	257
49	3300048925	Ga0496122_0043604	Ga0496122_0043604_1107_1937	257
50	3300048925	Ga0496122_0106294	Ga0496122_0106294_916_1746	257
51	3300048927	Ga0496124_0000748	Ga0496124_0000748_10436_11266	257
52	3300048929	Ga0496126_0002746	Ga0496126_0002746_13480_14310	257
53	3300048929	Ga0496126_0002903	Ga0496126_0002903_17773_18603	257
54	3300009036	Ga0105244_10019243	Ga0105244_100192432	258
55	3300011119	Ga0105246_10030805	Ga0105246_100308052	258
56	3300042876	Ga0451577_0017513	Ga0451577_0017513_2268_3098	258
57	3300042876	Ga0451577_0047431	Ga0451577_0047431_234_1073	258
58	3300042876	Ga0451577_0077435	Ga0451577_0077435_2082_2921	258
59	3300042876	Ga0451577_0106475	Ga0451577_0106475_41_871	258
60	3300042876	Ga0451577_0170303	Ga0451577_0170303_14_844	258
61	3300044673	Ga0453683_0000010	Ga0453683_0000010_57840_58679	258
62	3300044673	Ga0453683_0063713	Ga0453683_0063713_268_1098	258
63	3300044712	Ga0453684_0003018	Ga0453684_0003018_2188_3018	258
64	3300044712	Ga0453684_0045361	Ga0453684_0045361_2103_2942	258
65	3300044712	Ga0453684_0086744	Ga0453684_0086744_2103_2942	258
66	3300044712	Ga0453684_0428771	Ga0453684_0428771_84_914	258
67	3300045051	Ga0451576_0167442	Ga0451576_0167442_1098_1937	258
68	3300046455	Ga0495603_0060349	Ga0495603_0060349_94_906	258
69	3300046681	Ga0495647_0001571	Ga0495647_0001571_336_1148	258
70	3300048919	Ga0496116_0013964	Ga0496116_0013964_2763_3596	258
71	3300048924	Ga0496121_0080186	Ga0496121_0080186_1030_1863	258
72	3300048925	Ga0496122_0074790	Ga0496122_0074790_1511_2344	258
73	3300048926	Ga0496123_0106733	Ga0496123_0106733_679_1512	258
74	3300005563	Ga0068855_100005810	Ga0068855_1000058102	259
75	3300025233	Ga0209437_104121	Ga0209437_1041212	259
76	3300025913	Ga0207695_10007694	Ga0207695_100076949	259
77	3300025949	Ga0207667_10006775	Ga0207667_100067758	259
78	3300031731	Ga0307405_10296494	Ga0307405_102964941	259
79	3300031852	Ga0307410_10030947	Ga0307410_100309473	259
80	3300031852	Ga0307410_10126731	Ga0307410_101267312	259
81	3300042876	Ga0451577_0000022	Ga0451577_0000022_164570_165403	259
82	3300044673	Ga0453683_0000358	Ga0453683_0000358_26001_26834	259
83	3300044712	Ga0453684_0000607	Ga0453684_0000607_69247_70080	259
84	3300045051	Ga0451576_0000044	Ga0451576_0000044_61974_62807	259
85	3300046499	Ga0495594_0311367	Ga0495594_0311367_62_877	259
86	3300046689	Ga0495613_0067483	Ga0495613_0067483_345_1202	259
87	3300046810	Ga0495660_0146608	Ga0495660_0146608_282_1118	259
88	iso_pu_bacteria	2738543010	2739233163	259
89	3300003751	Ga0055538_1001252	Ga0055538_10012522	260
90	3300025224	Ga0209784_100184	Ga0209784_1001843	260
91	3300005548	Ga0070665_100108373	Ga0070665_1001083732	261
92	3300028379	Ga0268266_10061574	Ga0268266_100615743	261
93	3300037312	Ga0395899_0008785	Ga0395899_0008785_2587_3435	261
94	3300048919	Ga0496116_0062764	Ga0496116_0062764_261_1106	261
95	3300048925	Ga0496122_0040384	Ga0496122_0040384_979_1824	261
96	3300048926	Ga0496123_0091570	Ga0496123_0091570_427_1272	261
97	3300048928	Ga0496125_0015664	Ga0496125_0015664_4259_5104	261
98	iso_pu_bacteria	2526164512	2526212788	262
99	iso_pu_bacteria	2916178963	2916181907	262
100	iso_pu_bacteria	2989392574	2989392724	262
101	3300005331	Ga0070670_100314574	Ga0070670_1003145741	263
102	3300006846	Ga0075430_100411499	Ga0075430_1004114992	263
103	3300025931	Ga0207644_10002229	Ga0207644_100022297	263
104	3300049161	Ga0501305_007586	Ga0501305_007586_500_1360	263
105	3300005329	Ga0070683_100026109	Ga0070683_1000261096	264
106	3300005436	Ga0070713_100128908	Ga0070713_1001289082	264
107	3300005530	Ga0070679_100204366	Ga0070679_1002043661	264
108	3300009036	Ga0105244_10050356	Ga0105244_100503562	264
109	3300009177	Ga0105248_10549283	Ga0105248_105492832	264
110	3300025728	Ga0207655_1034699	Ga0207655_10346993	264
111	3300025928	Ga0207700_10192884	Ga0207700_101928842	264
112	3300044712	Ga0453684_0000547	Ga0453684_0000547_64558_65427	264
113	iso_pu_bacteria	2889042446	2889046701	264
114	iso_pu_bacteria	2904490793	2904493522	264
115	iso_pu_bacteria	2931384279	2931390149	264
116	3300005366	Ga0070659_100382139	Ga0070659_1003821391	265
117	3300009092	Ga0105250_10000004	Ga0105250_1000000420	265
118	3300009094	Ga0111539_10124354	Ga0111539_101243543	265
119	3300014968	Ga0157379_10000729	Ga0157379_1000072911	265
120	3300025711	Ga0207696_1000056	Ga0207696_100005620	265
121	3300025924	Ga0207694_10194578	Ga0207694_101945782	265
122	3300027907	Ga0207428_10055587	Ga0207428_100555872	265
123	3300039062	Ga0400483_027611	Ga0400483_027611_2951_3778	265
124	3300039062	Ga0400483_173168	Ga0400483_173168_3476_4303	265
125	3300041501	Ga0451845_0010870	Ga0451845_0010870_1875_2696	265
126	3300041512	Ga0451853_1271237	Ga0451853_1271237_70_891	265
127	3300044712	Ga0453684_0324030	Ga0453684_0324030_199_1026	265
128	3300046523	Ga0495644_0009021	Ga0495644_0009021_1421_2254	265
129	3300046539	Ga0495621_0045302	Ga0495621_0045302_340_1173	265
130	3300047470	Ga0495681_0020918	Ga0495681_0020918_47_880	265
131	3300050511	nmdc:mga08y16_169214_c1	nmdc:mga08y16_169214_c1_976_1803	265
132	3300003203	JGI25406J46586_10006643	JGI25406J46586_100066435	266
133	3300004800	Ga0058861_11892893	Ga0058861_118928932	266
134	3300005331	Ga0070670_100009884	Ga0070670_1000098846	266
135	3300005331	Ga0070670_100080631	Ga0070670_1000806311	266
136	3300005337	Ga0070682_100128462	Ga0070682_1001284622	266
137	3300005340	Ga0070689_100064979	Ga0070689_1000649792	266
138	3300005344	Ga0070661_100197461	Ga0070661_1001974612	266
139	3300005354	Ga0070675_100094728	Ga0070675_1000947283	266
140	3300005364	Ga0070673_100094472	Ga0070673_1000944722	266
141	3300005438	Ga0070701_10037342	Ga0070701_100373424	266
142	3300005441	Ga0070700_100177435	Ga0070700_1001774352	266
143	3300005548	Ga0070665_100121788	Ga0070665_1001217883	266
144	3300005564	Ga0070664_100021629	Ga0070664_1000216291	266
145	3300005618	Ga0068864_100008552	Ga0068864_1000085525	266
146	3300005618	Ga0068864_100580710	Ga0068864_1005807102	266
147	3300005841	Ga0068863_100027751	Ga0068863_1000277513	266
148	3300005937	Ga0081455_10000494	Ga0081455_1000049442	266
149	3300005985	Ga0081539_10000055	Ga0081539_1000005573	266
150	3300006237	Ga0097621_100092501	Ga0097621_1000925013	266
151	3300009093	Ga0105240_10000634	Ga0105240_1000063419	266
152	3300009093	Ga0105240_10131125	Ga0105240_101311253	266
153	3300009093	Ga0105240_10188108	Ga0105240_101881083	266
154	3300009176	Ga0105242_10336020	Ga0105242_103360202	266
155	3300009551	Ga0105238_10055583	Ga0105238_100555833	266
156	3300010375	Ga0105239_10850536	Ga0105239_108505361	266
157	3300014325	Ga0163163_10041601	Ga0163163_100416012	266
158	3300014325	Ga0163163_10168285	Ga0163163_101682852	266
159	3300025908	Ga0207643_10032665	Ga0207643_100326654	266
160	3300025913	Ga0207695_10093691	Ga0207695_100936912	266
161	3300025920	Ga0207649_10159056	Ga0207649_101590562	266
162	3300025925	Ga0207650_10089505	Ga0207650_100895053	266
163	3300025926	Ga0207659_10100464	Ga0207659_101004642	266
164	3300025940	Ga0207691_10474225	Ga0207691_104742251	266
165	3300025942	Ga0207689_10063995	Ga0207689_100639951	266
166	3300025986	Ga0207658_10405567	Ga0207658_104055672	266
167	3300026088	Ga0207641_10006938	Ga0207641_100069386	266
168	3300026095	Ga0207676_10057880	Ga0207676_100578804	266
169	3300026118	Ga0207675_100298497	Ga0207675_1002984971	266
170	3300027395	Ga0209996_1005594	Ga0209996_10055942	266
171	3300027462	Ga0210000_1000829	Ga0210000_10008294	266
172	3300027543	Ga0209999_1000416	Ga0209999_10004168	266
173	3300027552	Ga0209982_1012027	Ga0209982_10120272	266
174	3300027614	Ga0209970_1002794	Ga0209970_10027944	266
175	3300027682	Ga0209971_1004264	Ga0209971_10042643	266
176	3300028379	Ga0268266_10016580	Ga0268266_100165804	266
177	3300028380	Ga0268265_10133374	Ga0268265_101333743	266
178	3300028563	Ga0265319_1005624	Ga0265319_10056245	266
179	3300028794	Ga0307515_10135691	Ga0307515_101356913	266
180	3300028800	Ga0265338_10007770	Ga0265338_1000777015	266
181	3300029957	Ga0265324_10082712	Ga0265324_100827122	266
182	3300030521	Ga0307511_10000065	Ga0307511_1000006589	266
183	3300031238	Ga0265332_10001772	Ga0265332_1000177214	266
184	3300031239	Ga0265328_10016223	Ga0265328_100162233	266
185	3300031250	Ga0265331_10032346	Ga0265331_100323463	266
186	3300031251	Ga0265327_10026495	Ga0265327_100264952	266
187	3300031251	Ga0265327_10106501	Ga0265327_101065011	266
188	3300031344	Ga0265316_10235081	Ga0265316_102350812	266
189	3300031507	Ga0307509_10000032	Ga0307509_1000003298	266
190	3300031507	Ga0307509_10101550	Ga0307509_101015503	266
191	3300031507	Ga0307509_10246917	Ga0307509_102469171	266
192	3300031595	Ga0265313_10002857	Ga0265313_1000285717	266
193	3300031665	Ga0316575_10028795	Ga0316575_100287952	266
194	3300031691	Ga0316579_10046173	Ga0316579_100461732	266
195	3300031711	Ga0265314_10012290	Ga0265314_100122902	266
196	3300031712	Ga0265342_10037517	Ga0265342_100375173	266
197	3300031727	Ga0316576_10117407	Ga0316576_101174072	266
198	3300031727	Ga0316576_10117993	Ga0316576_101179932	266
199	3300031727	Ga0316576_10353938	Ga0316576_103539381	266
200	3300031728	Ga0316578_10043662	Ga0316578_100436622	266
201	3300031728	Ga0316578_10053920	Ga0316578_100539202	266
202	3300031728	Ga0316578_10074530	Ga0316578_100745302	266
203	3300031728	Ga0316578_10255256	Ga0316578_102552562	266
204	3300031824	Ga0307413_10011947	Ga0307413_100119472	266
205	3300031824	Ga0307413_10014872	Ga0307413_100148726	266
206	3300031852	Ga0307410_10029948	Ga0307410_100299484	266
207	3300031901	Ga0307406_10011328	Ga0307406_100113283	266
208	3300031903	Ga0307407_10054533	Ga0307407_100545333	266
209	3300031995	Ga0307409_100013352	Ga0307409_1000133527	266
210	3300031995	Ga0307409_100032115	Ga0307409_1000321153	266
211	3300032005	Ga0307411_10002813	Ga0307411_100028137	266
212	3300032133	Ga0316583_10034684	Ga0316583_100346843	266
213	3300032133	Ga0316583_10058159	Ga0316583_100581592	266
214	3300032137	Ga0316585_10028838	Ga0316585_100288381	266
215	3300032137	Ga0316585_10054035	Ga0316585_100540352	266
216	3300032139	Ga0316580_10015702	Ga0316580_100157022	266
217	3300032168	Ga0316593_10016099	Ga0316593_100160992	266
218	3300033179	Ga0307507_10038372	Ga0307507_100383724	266
219	3300033528	Ga0316588_1001030	Ga0316588_10010302	266
220	3300033528	Ga0316588_1004173	Ga0316588_10041733	266
221	3300033529	Ga0316587_1003236	Ga0316587_10032362	266
222	3300033541	Ga0316596_1003399	Ga0316596_10033993	266
223	3300033541	Ga0316596_1050224	Ga0316596_10502242	266
224	3300035398	Ga0316574_0005596	Ga0316574_0005596_761_1591	266
225	3300035398	Ga0316574_0048884	Ga0316574_0048884_1138_1968	266
226	3300035398	Ga0316574_0049235	Ga0316574_0049235_1543_2373	266
227	3300035398	Ga0316574_0130973	Ga0316574_0130973_483_1322	266
228	3300036647	Ga0316582_0000613	Ga0316582_0000613_4431_5261	266
229	3300036647	Ga0316582_0035439	Ga0316582_0035439_1387_2217	266
230	3300036647	Ga0316582_0065619	Ga0316582_0065619_129_959	266
231	3300036647	Ga0316582_0152875	Ga0316582_0152875_374_1204	266
232	3300036647	Ga0316582_0160767	Ga0316582_0160767_646_1476	266
233	3300036712	Ga0316584_0003100	Ga0316584_0003100_5466_6296	266
234	3300036712	Ga0316584_0005549	Ga0316584_0005549_721_1551	266
235	3300036712	Ga0316584_0019963	Ga0316584_0019963_566_1396	266
236	3300036712	Ga0316584_0020580	Ga0316584_0020580_3264_4094	266
237	3300036712	Ga0316584_0051037	Ga0316584_0051037_740_1570	266
238	3300036712	Ga0316584_0110683	Ga0316584_0110683_808_1638	266
239	3300036712	Ga0316584_0166893	Ga0316584_0166893_335_1165	266
240	3300037588	Ga0316581_0039263	Ga0316581_0039263_425_1255	266
241	3300038742	Ga0400486_14879	Ga0400486_14879_3538_4368	266
242	3300039062	Ga0400483_011190	Ga0400483_011190_28410_29240	266
243	3300039062	Ga0400483_219863	Ga0400483_219863_19819_20649	266
244	3300039062	Ga0400483_227911	Ga0400483_227911_1848_2678	266
245	3300039062	Ga0400483_249256	Ga0400483_249256_255_1085	266
246	3300039438	Ga0436360_0688356	Ga0436360_0688356_102_926	266
247	3300039450	Ga0436363_1273526	Ga0436363_1273526_4485_5309	266
248	3300039453	Ga0436362_0042786	Ga0436362_0042786_402_1226	266
249	3300042876	Ga0451577_0013045	Ga0451577_0013045_1563_2393	266
250	3300042876	Ga0451577_0073347	Ga0451577_0073347_722_1552	266
251	3300044712	Ga0453684_0010827	Ga0453684_0010827_2200_3030	266
252	3300044712	Ga0453684_0069662	Ga0453684_0069662_1150_1995	266
253	3300044712	Ga0453684_0196975	Ga0453684_0196975_852_1682	266
254	3300045049	Ga0466959_0019553	Ga0466959_0019553_601_1431	266
255	3300045049	Ga0466959_0095360	Ga0466959_0095360_1074_1904	266
256	3300045051	Ga0451576_0000200	Ga0451576_0000200_32933_33763	266
257	3300045051	Ga0451576_0154343	Ga0451576_0154343_307_1152	266
258	3300046471	Ga0495650_0008767	Ga0495650_0008767_80_913	266
259	3300046616	Ga0495668_0269868	Ga0495668_0269868_38_868	266
260	3300047320	Ga0495672_0074233	Ga0495672_0074233_948_1772	266
261	3300048915	Ga0496112_0165562	Ga0496112_0165562_543_1382	266
262	3300048918	Ga0496115_0311099	Ga0496115_0311099_356_1186	266
263	3300048920	Ga0496117_0000041	Ga0496117_0000041_266095_266931	266
264	3300048929	Ga0496126_0015051	Ga0496126_0015051_2414_3244	266
265	3300049570	Ga0501033_0112182	Ga0501033_0112182_706_1557	266
266	3300049573	Ga0501037_0002243	Ga0501037_0002243_9463_10293	266
267	3300049581	Ga0501047_0016003	Ga0501047_0016003_4429_5280	266
268	3300049581	Ga0501047_0044300	Ga0501047_0044300_2823_3674	266
269	3300049581	Ga0501047_0048433	Ga0501047_0048433_1958_2788	266
270	3300049586	Ga0501070_0046273	Ga0501070_0046273_676_1506	266
271	3300049742	Ga0501080_0052637	Ga0501080_0052637_169_1020	266
272	3300049823	Ga0501044_0065972	Ga0501044_0065972_1222_2073	266
273	3300053092	Ga0500583_0137672	Ga0500583_0137672_200_1027	266
274	3300053123	Ga0500614_062740	Ga0500614_062740_60_893	266
275	3300053139	Ga0500568_0012019	Ga0500568_0012019_2418_3266	266
276	3300053139	Ga0500568_0030856	Ga0500568_0030856_1262_2086	266
277	3300053139	Ga0500568_0121396	Ga0500568_0121396_113_937	266
278	3300053146	Ga0500588_0005806	Ga0500588_0005806_791_1621	266
279	3300053153	Ga0500616_0000096	Ga0500616_0000096_88423_89253	266
280	3300053153	Ga0500616_0049825	Ga0500616_0049825_589_1437	266
281	3300053156	Ga0500622_0010849	Ga0500622_0010849_44_868	266
282	3300053156	Ga0500622_0075620	Ga0500622_0075620_44_868	266
283	3300005328	Ga0070676_10136384	Ga0070676_101363841	267
284	3300005340	Ga0070689_100069341	Ga0070689_1000693412	267
285	3300005353	Ga0070669_100072465	Ga0070669_1000724652	267
286	3300005354	Ga0070675_100047102	Ga0070675_1000471023	267
287	3300005364	Ga0070673_100030950	Ga0070673_1000309505	267
288	3300005440	Ga0070705_100079501	Ga0070705_1000795012	267
289	3300005543	Ga0070672_100088413	Ga0070672_1000884132	267
290	3300005617	Ga0068859_100076755	Ga0068859_1000767555	267
291	3300005718	Ga0068866_10079325	Ga0068866_100793252	267
292	3300005719	Ga0068861_100105057	Ga0068861_1001050572	267
293	3300005841	Ga0068863_100128937	Ga0068863_1001289373	267
294	3300005842	Ga0068858_100083481	Ga0068858_1000834813	267
295	3300006237	Ga0097621_100007646	Ga0097621_1000076463	267
296	3300006358	Ga0068871_100003130	Ga0068871_10000313011	267
297	3300006881	Ga0068865_100020909	Ga0068865_1000209093	267
298	3300006931	Ga0097620_100076751	Ga0097620_1000767515	267
299	3300013297	Ga0157378_10636103	Ga0157378_106361031	267
300	3300013306	Ga0163162_10098528	Ga0163162_100985282	267
301	3300013308	Ga0157375_10122124	Ga0157375_101221243	267
302	3300014326	Ga0157380_10183682	Ga0157380_101836822	267
303	3300017792	Ga0163161_10079227	Ga0163161_100792273	267
304	3300025908	Ga0207643_10055142	Ga0207643_100551421	267
305	3300025912	Ga0207707_10147261	Ga0207707_101472613	267
306	3300025938	Ga0207704_10037998	Ga0207704_100379982	267
307	3300025940	Ga0207691_10079368	Ga0207691_100793682	267
308	3300025942	Ga0207689_10097091	Ga0207689_100970913	267
309	3300025961	Ga0207712_10393468	Ga0207712_103934681	267
310	3300026075	Ga0207708_10119810	Ga0207708_101198102	267
311	3300026089	Ga0207648_10022877	Ga0207648_100228773	267
312	3300026118	Ga0207675_100081710	Ga0207675_1000817104	267
313	3300026121	Ga0207683_10053851	Ga0207683_100538512	267
314	3300028380	Ga0268265_10066383	Ga0268265_100663832	267
315	3300028381	Ga0268264_10537654	Ga0268264_105376542	267
316	3300031507	Ga0307509_10000978	Ga0307509_100009783	267
317	3300031727	Ga0316576_10009883	Ga0316576_100098835	267
318	3300031728	Ga0316578_10068084	Ga0316578_100680843	267
319	3300035398	Ga0316574_0100052	Ga0316574_0100052_744_1592	267
320	3300038742	Ga0400486_21531	Ga0400486_21531_1334_2167	267
321	3300039110	Ga0400487_20182	Ga0400487_20182_10681_11514	267
322	3300042876	Ga0451577_0000096	Ga0451577_0000096_192580_193413	267
323	3300044901	Ga0466960_0013469	Ga0466960_0013469_1660_2592	267
324	3300046616	Ga0495668_0174944	Ga0495668_0174944_64_900	267
325	3300035092	Ga0373952_0001712	Ga0373952_0001712_2058_2894	268
326	3300044712	Ga0453684_0000826	Ga0453684_0000826_4885_5736	268
327	3300045051	Ga0451576_0016220	Ga0451576_0016220_5241_6092	268
328	3300003322	rootL2_10213719	rootL2_102137192	269
329	3300003323	rootH1_10084961	rootH1_100849613	269
330	3300006844	Ga0075428_100006185	Ga0075428_1000061859	269
331	3300006846	Ga0075430_100428551	Ga0075430_1004285512	269
332	3300006847	Ga0075431_100000121	Ga0075431_10000012152	269
333	3300006880	Ga0075429_100035642	Ga0075429_1000356422	269
334	3300009094	Ga0111539_10000695	Ga0111539_1000069519	269
335	3300009147	Ga0114129_10057982	Ga0114129_100579825	269
336	3300027907	Ga0207428_10048499	Ga0207428_100484994	269
337	3300031456	Ga0307513_10124873	Ga0307513_101248732	269
338	3300031548	Ga0307408_100118513	Ga0307408_1001185132	269
339	3300032005	Ga0307411_10107823	Ga0307411_101078232	269
340	3300042005	Ga0439448_0062499	Ga0439448_0062499_164_997	269
341	3300050507	nmdc:mga05p37_45003_c1	nmdc:mga05p37_45003_c1_2539_3387	269
342	3300050508	nmdc:mga09592_10130_c1	nmdc:mga09592_10130_c1_6130_6978	269
343	3300050509	nmdc:mga0qj67_67675_c1	nmdc:mga0qj67_67675_c1_1879_2727	269
344	3300050510	nmdc:mga06r32_3_c1	nmdc:mga06r32_3_c1_145205_146053	269
345	3300050511	nmdc:mga08y16_31807_c1	nmdc:mga08y16_31807_c1_2626_3474	269
346	3300031691	Ga0316579_10021556	Ga0316579_100215562	270
347	3300031911	Ga0307412_10271881	Ga0307412_102718812	270
348	3300050509	nmdc:mga0qj67_419433_c1	nmdc:mga0qj67_419433_c1_61_906	270
349	3300005334	Ga0068869_100161304	Ga0068869_1001613041	271
350	3300005353	Ga0070669_100127147	Ga0070669_1001271472	271
351	3300005441	Ga0070700_100100987	Ga0070700_1001009872	271
352	3300005444	Ga0070694_100169426	Ga0070694_1001694262	271
353	3300013307	Ga0157372_10037696	Ga0157372_100376966	271
354	3300013307	Ga0157372_10228196	Ga0157372_102281962	271
355	3300025917	Ga0207660_10047272	Ga0207660_100472722	271
356	3300025921	Ga0207652_10252317	Ga0207652_102523171	271
357	3300025923	Ga0207681_10050583	Ga0207681_100505833	271
358	3300025942	Ga0207689_10165581	Ga0207689_101655811	271
359	3300025972	Ga0207668_10007813	Ga0207668_100078136	271
360	3300026075	Ga0207708_10135332	Ga0207708_101353322	271
361	3300027907	Ga0207428_10028194	Ga0207428_100281943	271
362	3300028380	Ga0268265_10013117	Ga0268265_100131174	271
363	3300041413	Ga0439465_0087339	Ga0439465_0087339_19_858	271
364	3300042145	Ga0450906_020303	Ga0450906_020303_183_1022	271
365	3300005295	Ga0065707_10145500	Ga0065707_101455002	272
366	3300005329	Ga0070683_100093969	Ga0070683_1000939691	272
367	3300005340	Ga0070689_100011595	Ga0070689_1000115955	272
368	3300005354	Ga0070675_100001328	Ga0070675_1000013289	272
369	3300005356	Ga0070674_100184231	Ga0070674_1001842312	272
370	3300005364	Ga0070673_100010444	Ga0070673_1000104444	272
371	3300005366	Ga0070659_100064796	Ga0070659_1000647964	272
372	3300005535	Ga0070684_100000450	Ga0070684_10000045015	272
373	3300005844	Ga0068862_100072974	Ga0068862_1000729743	272
374	3300006844	Ga0075428_100003259	Ga0075428_10000325917	272
375	3300006846	Ga0075430_100011842	Ga0075430_1000118426	272
376	3300006880	Ga0075429_100002068	Ga0075429_10000206817	272
377	3300009094	Ga0111539_10157017	Ga0111539_101570172	272
378	3300010375	Ga0105239_10975496	Ga0105239_109754962	272
379	3300025909	Ga0207705_10138469	Ga0207705_101384692	272
380	3300025912	Ga0207707_10261896	Ga0207707_102618962	272
381	3300025934	Ga0207686_10211638	Ga0207686_102116382	272
382	3300026067	Ga0207678_10139547	Ga0207678_101395473	272
383	3300027907	Ga0207428_10114160	Ga0207428_101141602	272
384	3300031548	Ga0307408_100178683	Ga0307408_1001786832	272
385	3300050511	nmdc:mga08y16_23221_c1	nmdc:mga08y16_23221_c1_816_1670	272
386	3300005355	Ga0070671_100003911	Ga0070671_1000039117	274
387	3300005841	Ga0068863_100072630	Ga0068863_1000726303	274
388	3300005842	Ga0068858_100014730	Ga0068858_1000147303	274
389	3300009177	Ga0105248_10007675	Ga0105248_100076757	274
390	3300009553	Ga0105249_10270960	Ga0105249_102709602	274
391	3300025941	Ga0207711_10003647	Ga0207711_1000364710	274
392	3300025961	Ga0207712_10287397	Ga0207712_102873972	274
393	3300026035	Ga0207703_10019699	Ga0207703_100196995	274
394	3300048906	Ga0496103_0004035	Ga0496103_0004035_2101_3015	274
395	3300048919	Ga0496116_0064114	Ga0496116_0064114_171_1085	274
396	3300048921	Ga0496118_0007015	Ga0496118_0007015_5308_6222	274
397	3300048922	Ga0496119_0047159	Ga0496119_0047159_1634_2548	274
398	3300048924	Ga0496121_0007314	Ga0496121_0007314_5416_6330	274
399	3300048927	Ga0496124_0000720	Ga0496124_0000720_47371_48285	274
400	3300050509	nmdc:mga0qj67_18250_c1	nmdc:mga0qj67_18250_c1_2552_3400	274
401	3300050510	nmdc:mga06r32_723_c1	nmdc:mga06r32_723_c1_9188_10036	274
402	3300005336	Ga0070680_100516458	Ga0070680_1005164581	275
403	3300005719	Ga0068861_100008431	Ga0068861_1000084318	275
404	3300009094	Ga0111539_10021812	Ga0111539_100218123	275
405	3300009553	Ga0105249_10119095	Ga0105249_101190953	275
406	3300025981	Ga0207640_10413191	Ga0207640_104131912	275
407	3300026118	Ga0207675_100015332	Ga0207675_1000153328	275
408	3300050511	nmdc:mga08y16_163725_c1	nmdc:mga08y16_163725_c1_922_1776	275
409	2162886012	MBSR1b_contig_1360200	MBSR1b_0868.00007370	276
410	3300005290	Ga0065712_10070877	Ga0065712_100708776	276
411	3300005293	Ga0065715_10093989	Ga0065715_100939892	276
412	3300005331	Ga0070670_100046983	Ga0070670_1000469833	276
413	3300005334	Ga0068869_100114500	Ga0068869_1001145002	276
414	3300005335	Ga0070666_10221024	Ga0070666_102210241	276
415	3300005343	Ga0070687_100023159	Ga0070687_1000231593	276
416	3300005344	Ga0070661_100001052	Ga0070661_10000105215	276
417	3300005345	Ga0070692_10271835	Ga0070692_102718351	276
418	3300005355	Ga0070671_100102682	Ga0070671_1001026822	276
419	3300005365	Ga0070688_100004700	Ga0070688_1000047006	276
420	3300005440	Ga0070705_100031680	Ga0070705_1000316802	276
421	3300005459	Ga0068867_100006267	Ga0068867_1000062675	276
422	3300005543	Ga0070672_100152975	Ga0070672_1001529753	276
423	3300005544	Ga0070686_100001533	Ga0070686_1000015333	276
424	3300005564	Ga0070664_100001964	Ga0070664_10000196420	276
425	3300005577	Ga0068857_100130164	Ga0068857_1001301643	276
426	3300005617	Ga0068859_100006805	Ga0068859_10000680511	276
427	3300005618	Ga0068864_100000569	Ga0068864_10000056926	276
428	3300005718	Ga0068866_10007597	Ga0068866_100075972	276
429	3300005841	Ga0068863_100001625	Ga0068863_10000162515	276
430	3300005842	Ga0068858_100011034	Ga0068858_10001103410	276
431	3300005844	Ga0068862_100295651	Ga0068862_1002956511	276
432	3300006237	Ga0097621_100133339	Ga0097621_1001333392	276
433	3300006358	Ga0068871_100074140	Ga0068871_1000741402	276
434	3300006931	Ga0097620_100006805	Ga0097620_1000068055	276
435	3300009098	Ga0105245_10483849	Ga0105245_104838492	276
436	3300009147	Ga0114129_10000366	Ga0114129_1000036630	276
437	3300013297	Ga0157378_10042773	Ga0157378_100427732	276
438	3300013306	Ga0163162_10071109	Ga0163162_100711091	276
439	3300013308	Ga0157375_10064482	Ga0157375_100644824	276
440	3300014325	Ga0163163_10003280	Ga0163163_100032809	276
441	3300014745	Ga0157377_10004824	Ga0157377_100048245	276
442	3300025899	Ga0207642_10012487	Ga0207642_100124873	276
443	3300025901	Ga0207688_10007238	Ga0207688_100072386	276
444	3300025911	Ga0207654_10268542	Ga0207654_102685422	276
445	3300025918	Ga0207662_10003037	Ga0207662_100030376	276
446	3300025920	Ga0207649_10002291	Ga0207649_100022917	276
447	3300025926	Ga0207659_10001788	Ga0207659_100017886	276
448	3300025940	Ga0207691_10058434	Ga0207691_100584343	276
449	3300025942	Ga0207689_10009142	Ga0207689_1000914210	276
450	3300025986	Ga0207658_10009061	Ga0207658_100090618	276
451	3300026035	Ga0207703_10026739	Ga0207703_100267395	276
452	3300026075	Ga0207708_10003483	Ga0207708_100034831	276
453	3300026088	Ga0207641_10004671	Ga0207641_100046716	276
454	3300026089	Ga0207648_10000935	Ga0207648_100009352	276
455	3300026095	Ga0207676_10026083	Ga0207676_100260832	276
456	3300026116	Ga0207674_10006902	Ga0207674_1000690212	276
457	3300026121	Ga0207683_10008069	Ga0207683_100080699	276
458	3300028380	Ga0268265_10120789	Ga0268265_101207893	276
459	3300045051	Ga0451576_0037251	Ga0451576_0037251_2917_3771	276
460	3300048907	Ga0496104_0551766	Ga0496104_0551766_143_997	276
461	3300048911	Ga0496108_0014429	Ga0496108_0014429_4634_5488	276
462	3300048912	Ga0496109_0273386	Ga0496109_0273386_502_1356	276
463	3300048914	Ga0496111_0076245	Ga0496111_0076245_1202_2056	276
464	3300050507	nmdc:mga05p37_66842_c1	nmdc:mga05p37_66842_c1_353_1213	276
465	3300050508	nmdc:mga09592_8752_c1	nmdc:mga09592_8752_c1_4087_4947	276
466	3300050509	nmdc:mga0qj67_11001_c1	nmdc:mga0qj67_11001_c1_4087_4947	276
467	3300050510	nmdc:mga06r32_1365_c1	nmdc:mga06r32_1365_c1_20858_21718	276
468	3300050511	nmdc:mga08y16_579458_c1	nmdc:mga08y16_579458_c1_48_902	276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01678

DAP_epimerase

Diaminopimelate epimerase

187

303

0.96 PF01678

DAP_epimerase

Diaminopimelate epimerase

39

159

0.95 PF02567

PhzC-PhzF

Phenazine biosynthesis-like protein

38

286

0.8 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7vdy-assembly1.cif.gz_B	crystal structure of o-ureidoserine racemase	0.9302	6	267
1gqz-assembly1.cif.gz_A	refinement of haemophilus influenzae diaminopimelate epimerase at 1.7a	0.9149	8	266
3ejx-assembly5.cif.gz_D	crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap	0.908	3	267
2q9h-assembly1.cif.gz_A	crystal structure of the c73s mutant of diaminopimelate epimerase	0.9048	8	266
1bwz-assembly1.cif.gz_A	diaminopimelate epimerase from hemophilus influenzae	0.8992	8	266

ID	Description	Score	Start	End	Superfamily
2q9jA01	Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1	0.9033	8	115	3.10.310.10
af_P0A6K1_1_112_3.10.310.10	Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1	0.8993	9	115	3.10.310.10
3ejxA01	Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1	0.8969	5	116	3.10.310.10
af_I1NA10_49_204_3.10.310.10	Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1	0.8914	9	123	3.10.310.10
af_Q55GS8_377_492_3.10.310.10	Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1	0.8898	152	256	3.10.310.10

ID	Description	Score	Start	End	GO Terms
AF-A0A7X7SRT6-F1-model_v4	Diaminopimelate epimerase (EC 5.1.1.7)	0.9722	5	200	GO:0005829 GO:0008837 GO:0009089
AF-A0A7X7SRT6-F1-model_v4	Diaminopimelate epimerase (EC 5.1.1.7)	0.9674	5	200	GO:0005829 GO:0008837 GO:0009089
AF-A0A7Y2MXE6-F1-model_v4	Diaminopimelate epimerase (EC 5.1.1.7)	0.9528	5	209	GO:0005829 GO:0008837 GO:0009089
AF-A0A351SD15-F1-model_v4	Diaminopimelate epimerase (EC 5.1.1.7)	0.9508	82	270	GO:0005829 GO:0008837 GO:0009089
AF-A0A7R8WZ17-F1-model_v4	Uncharacterized protein	0.9488	105	249	GO:0005829 GO:0008837 GO:0009089

Feature Viewer

pLDDT	pTM	Quality
88.08	0.86	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F450091

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01678

DAP_epimerase

Diaminopimelate epimerase

187

303

0.96

PF01678

DAP_epimerase

Diaminopimelate epimerase

39

159

0.95

PF02567

PhzC-PhzF

Phenazine biosynthesis-like protein

38

286

0.8

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map