F450069

General Info

Members Datasets Scaffolds Average Seq Length
468 233 936 286

Family's Representative Sequence

Representative Sequence 3300035119|Ga0373956_0008300|Ga0373956_0008300_587_1567
Length 326
Sequence MASIEHPLFLPSVSIAWIFLQLPRLDSCRRTTIGLLEKSQTMKLCRFQERNEVHVGLVIDEDSSVLDLTPAGVQQMQSLLESDDLTTQLDQFSKQNLPRFSLDQIKLRAPVEQQEVWAAGVTYLRSKTARMQESDFSATAYDKVYAAERPELFFKAVAGKVVATSDAVGIRRDARWNVPEPELALVLNSKGRIVGYTIGNDMSSRDIEGENLLYLPQAKIYDRSCALGPWIAIDADETAARNWTIRLAIERNGTRVFSGETSVGRIKRRFEELTGFLSRCQTFPHGAVLLTGTGVVPPEDFTLQERDVVQIEISGIGSLVNPVVAV

Samples

Sample ID Description Type Environment
1 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
119 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
120 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
121 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
122 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
125 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
143 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
144 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
145 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
146 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
147 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
148 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
149 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
150 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
151 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
152 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
153 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
154 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
155 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
178 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
229 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
231 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 1.28
Rhizosphere 98.08
Stem 0
Stem Tuber 0
Unclassified 3.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373956_0008300 3300035119 Bacteria 4203
2 JGI25406J46586_10017621 3300003203 Bacteria 2949
3 rootH1_10103113 3300003323 Bacteria 4913
4 rootH1_10229124 3300003323 Bacteria 2441
5 Ga0065704_10103283 3300005289 Bacteria 2176
6 Ga0065712_10083251 3300005290 Bacteria 2852
7 Ga0065712_10101012 3300005290 Bacteria 2041
8 Ga0065715_10102343 3300005293 Bacteria 3116
9 Ga0065707_10000566 3300005295 Bacteria 26530
10 Ga0070683_100355930 3300005329 Bacteria 1394
11 Ga0070670_100006936 3300005331 Bacteria 9604
12 Ga0070670_100024018 3300005331 Bacteria 5244
13 Ga0070670_100050238 3300005331 Bacteria 3584
14 Ga0070666_10203696 3300005335 Unclassified 1392
15 Ga0070689_100004999 3300005340 Bacteria 9005
16 Ga0070689_100006775 3300005340 Bacteria 7968
17 Ga0070689_100043007 3300005340 Bacteria 3470
18 Ga0070689_100103916 3300005340 Bacteria 2252
19 Ga0070689_100254899 3300005340 Bacteria 1449
20 Ga0070689_100366450 3300005340 Bacteria 1212
21 Ga0070687_100314933 3300005343 Bacteria 998
22 Ga0070669_100156624 3300005353 Bacteria 1767
23 Ga0070669_100167397 3300005353 Bacteria 1712
24 Ga0070675_100003322 3300005354 Bacteria 12198
25 Ga0070675_100022270 3300005354 Bacteria 5062
26 Ga0070675_100040424 3300005354 Bacteria 3807
27 Ga0070675_100047210 3300005354 Bacteria 3528
28 Ga0070675_100093893 3300005354 Bacteria 2516
29 Ga0070675_100422814 3300005354 Bacteria 1192
30 Ga0070674_100055979 3300005356 Bacteria 2734
31 Ga0070673_100119596 3300005364 Bacteria 2195
32 Ga0070673_100311936 3300005364 Bacteria 1388
33 Ga0070688_100013743 3300005365 Bacteria 4574
34 Ga0070688_100146620 3300005365 Bacteria 1609
35 Ga0070688_100267913 3300005365 Bacteria 1222
36 Ga0070688_100270347 3300005365 Bacteria 1217
37 Ga0070688_100291144 3300005365 Bacteria 1177
38 Ga0070659_100238551 3300005366 Bacteria 1504
39 Ga0070667_100049691 3300005367 Bacteria 3533
40 Ga0070667_100332821 3300005367 Bacteria 1372
41 Ga0070714_100633031 3300005435 Bacteria 1029
42 Ga0070705_100006155 3300005440 Bacteria 5876
43 Ga0070708_100008770 3300005445 Bacteria 8129
44 Ga0070678_100119238 3300005456 Bacteria 2078
45 Ga0070698_100037653 3300005471 Bacteria 4986
46 Ga0070699_100004746 3300005518 Bacteria 12014
47 Ga0070679_100088968 3300005530 Bacteria 3075
48 Ga0070672_100015338 3300005543 Bacteria 5453
49 Ga0070672_100135064 3300005543 Bacteria 2031
50 Ga0070686_100002734 3300005544 Bacteria 9708
51 Ga0070686_100015964 3300005544 Bacteria 4361
52 Ga0070686_100019867 3300005544 Unclassified 3968
53 Ga0070686_100090090 3300005544 Bacteria 2050
54 Ga0070686_100266056 3300005544 Bacteria 1259
55 Ga0070695_100242887 3300005545 Bacteria 1307
56 Ga0070665_100009549 3300005548 Bacteria 9811
57 Ga0070665_100018633 3300005548 Bacteria 6957
58 Ga0070665_100183126 3300005548 Unclassified 2095
59 Ga0070704_100018609 3300005549 Bacteria 4447
60 Ga0070704_100186966 3300005549 Bacteria 1662
61 Ga0070704_100411910 3300005549 Bacteria 1156
62 Ga0070664_100027323 3300005564 Bacteria 4741
63 Ga0068857_100075590 3300005577 Bacteria 3003
64 Ga0068857_100171055 3300005577 Bacteria 1975
65 Ga0068857_100261705 3300005577 Bacteria 1588
66 Ga0068856_100000277 3300005614 Bacteria 55855
67 Ga0068859_100040223 3300005617 Bacteria 4693
68 Ga0068859_100068361 3300005617 Bacteria 3587
69 Ga0068859_100102260 3300005617 Bacteria 2923
70 Ga0068859_100253473 3300005617 Bacteria 1850
71 Ga0068859_100257588 3300005617 Unclassified 1835
72 Ga0068859_100286362 3300005617 Bacteria 1740
73 Ga0068859_100436999 3300005617 Bacteria 1405
74 Ga0068864_100003382 3300005618 Bacteria 13193
75 Ga0068864_100049555 3300005618 Bacteria 3614
76 Ga0068864_100069462 3300005618 Bacteria 3063
77 Ga0068864_100079229 3300005618 Bacteria 2876
78 Ga0068864_100128852 3300005618 Bacteria 2271
79 Ga0068864_100153406 3300005618 Bacteria 2089
80 Ga0068866_10087387 3300005718 Bacteria 1689
81 Ga0068861_100155709 3300005719 Bacteria 1879
82 Ga0068863_100052381 3300005841 Bacteria 3868
83 Ga0068863_100089851 3300005841 Bacteria 2913
84 Ga0068863_100312269 3300005841 Bacteria 1526
85 Ga0068863_100395081 3300005841 Bacteria 1352
86 Ga0068863_100447895 3300005841 Bacteria 1267
87 Ga0068858_100372021 3300005842 Bacteria 1371
88 Ga0068860_100170887 3300005843 Bacteria 2100
89 Ga0068860_100233498 3300005843 Bacteria 1788
90 Ga0068860_100462381 3300005843 Bacteria 1263
91 Ga0068862_100016005 3300005844 Bacteria 6236
92 Ga0068862_100139941 3300005844 Bacteria 2147
93 Ga0081539_10000065 3300005985 Bacteria 246571
94 Ga0081539_10036995 3300005985 Bacteria 2912
95 Ga0097621_100033686 3300006237 Bacteria 4081
96 Ga0097621_100036823 3300006237 Bacteria 3916
97 Ga0068871_100003278 3300006358 Bacteria 11106
98 Ga0068871_100010948 3300006358 Bacteria 6644
99 Ga0075428_100000007 3300006844 Bacteria 273226
100 Ga0075428_100119735 3300006844 Bacteria 2866
101 Ga0075428_100413900 3300006844 Bacteria 1444
102 Ga0075430_100117306 3300006846 Bacteria 2219
103 Ga0075431_100004116 3300006847 Bacteria 14201
104 Ga0075431_100011670 3300006847 Bacteria 8864
105 Ga0075431_100212348 3300006847 Bacteria 1976
106 Ga0075433_10186938 3300006852 Bacteria 1843
107 Ga0075433_10563693 3300006852 Bacteria 1001
108 Ga0075434_100003344 3300006871 Bacteria 14354
109 Ga0075434_100088302 3300006871 Bacteria 3101
110 Ga0075434_100144367 3300006871 Bacteria 2400
111 Ga0075434_100279637 3300006871 Bacteria 1688
112 Ga0075429_100260733 3300006880 Bacteria 1517
113 Ga0075429_100448937 3300006880 Unclassified 1130
114 Ga0068865_100068528 3300006881 Bacteria 2508
115 Ga0068865_100086166 3300006881 Bacteria 2267
116 Ga0068865_100322741 3300006881 Bacteria 1243
117 Ga0075436_100063660 3300006914 Unclassified 2549
118 Ga0097620_100040219 3300006931 Bacteria 4693
119 Ga0097620_100068361 3300006931 Bacteria 3587
120 Ga0097620_100102262 3300006931 Bacteria 2923
121 Ga0097620_100253475 3300006931 Bacteria 1850
122 Ga0097620_100257603 3300006931 Unclassified 1835
123 Ga0097620_100286353 3300006931 Bacteria 1740
124 Ga0097620_100437006 3300006931 Bacteria 1405
125 Ga0075435_100016850 3300007076 Bacteria 5517
126 Ga0075435_100021275 3300007076 Bacteria 4986
127 Ga0075435_100037382 3300007076 Bacteria 3865
128 Ga0075435_100050622 3300007076 Bacteria 3343
129 Ga0105240_10196839 3300009093 Bacteria 2365
130 Ga0111539_10000009 3300009094 Bacteria 375223
131 Ga0111539_10002637 3300009094 Bacteria 23763
132 Ga0111539_10006628 3300009094 Bacteria 14917
133 Ga0111539_10009292 3300009094 Bacteria 12415
134 Ga0111539_10012660 3300009094 Bacteria 10568
135 Ga0111539_10053167 3300009094 Unclassified 4821
136 Ga0111539_10537332 3300009094 Bacteria 1362
137 Ga0111539_10674241 3300009094 Bacteria 1204
138 Ga0105245_10524892 3300009098 Bacteria 1203
139 Ga0105247_10058027 3300009101 Bacteria 2394
140 Ga0105247_10118377 3300009101 Bacteria 1713
141 Ga0114129_10051653 3300009147 Bacteria 5771
142 Ga0114129_10446732 3300009147 Bacteria 1696
143 Ga0114129_10564210 3300009147 Bacteria 1479
144 Ga0114129_10810647 3300009147 Bacteria 1193
145 Ga0105243_10150126 3300009148 Bacteria 1998
146 Ga0105243_10263930 3300009148 Bacteria 1543
147 Ga0105242_10118520 3300009176 Bacteria 2268
148 Ga0105242_10139478 3300009176 Bacteria 2102
149 Ga0105242_10312366 3300009176 Bacteria 1439
150 Ga0105242_10499104 3300009176 Bacteria 1157
151 Ga0105248_10018300 3300009177 Bacteria 7735
152 Ga0105248_10060221 3300009177 Bacteria 4262
153 Ga0105248_10223290 3300009177 Bacteria 2121
154 Ga0105248_10291183 3300009177 Bacteria 1838
155 Ga0105249_10356218 3300009553 Bacteria 1484
156 Ga0157369_10587370 3300013105 Bacteria 1150
157 Ga0157374_10189870 3300013296 Bacteria 2009
158 Ga0157374_10250209 3300013296 Bacteria 1744
159 Ga0157374_10326720 3300013296 Bacteria 1521
160 Ga0157378_10171329 3300013297 Bacteria 2036
161 Ga0163162_10072584 3300013306 Bacteria 3497
162 Ga0163162_10539712 3300013306 Bacteria 1295
163 Ga0157375_10000168 3300013308 Bacteria 61672
164 Ga0157375_10008222 3300013308 Bacteria 9132
165 Ga0157375_10018182 3300013308 Bacteria 6370
166 Ga0157375_10024147 3300013308 Bacteria 5622
167 Ga0157375_10390853 3300013308 Unclassified 1558
168 Ga0163163_10000106 3300014325 Bacteria 88327
169 Ga0163163_10011980 3300014325 Bacteria 7890
170 Ga0163163_10013983 3300014325 Bacteria 7365
171 Ga0163163_10017104 3300014325 Bacteria 6754
172 Ga0163163_10035514 3300014325 Bacteria 4836
173 Ga0157380_10064959 3300014326 Bacteria 2931
174 Ga0157380_10202986 3300014326 Bacteria 1760
175 Ga0157380_10387070 3300014326 Bacteria 1322
176 Ga0157380_10435314 3300014326 Bacteria 1255
177 Ga0157380_10471306 3300014326 Bacteria 1212
178 Ga0157377_10023663 3300014745 Bacteria 3259
179 Ga0157377_10101993 3300014745 Bacteria 1711
180 Ga0157379_10001821 3300014968 Bacteria 17601
181 Ga0157379_10165150 3300014968 Bacteria 1998
182 Ga0157379_10219000 3300014968 Bacteria 1725
183 Ga0157376_10019977 3300014969 Bacteria 5173
184 Ga0157376_10062919 3300014969 Bacteria 3124
185 Ga0157376_10236384 3300014969 Unclassified 1700
186 Ga0157376_10401540 3300014969 Bacteria 1326
187 Ga0157376_10429517 3300014969 Bacteria 1284
188 Ga0163161_10308261 3300017792 Bacteria 1248
189 Ga0207682_10034605 3300025893 Bacteria 2037
190 Ga0207710_10010466 3300025900 Bacteria 3907
191 Ga0207680_10024695 3300025903 Bacteria 3303
192 Ga0207680_10050359 3300025903 Unclassified 2484
193 Ga0207680_10286018 3300025903 Bacteria 1147
194 Ga0207680_10354909 3300025903 Bacteria 1030
195 Ga0207645_10050200 3300025907 Bacteria 2664
196 Ga0207705_10216840 3300025909 Bacteria 1452
197 Ga0207695_10259931 3300025913 Unclassified 1634
198 Ga0207663_10005913 3300025916 Bacteria 6210
199 Ga0207662_10166160 3300025918 Bacteria 1413
200 Ga0207652_10057910 3300025921 Bacteria 3338
201 Ga0207681_10182966 3300025923 Bacteria 1598
202 Ga0207681_10186693 3300025923 Bacteria 1583
203 Ga0207650_10064845 3300025925 Bacteria 2735
204 Ga0207650_10124824 3300025925 Bacteria 2008
205 Ga0207650_10376331 3300025925 Bacteria 1172
206 Ga0207659_10000151 3300025926 Bacteria 41086
207 Ga0207659_10003119 3300025926 Bacteria 9904
208 Ga0207659_10009817 3300025926 Bacteria 5992
209 Ga0207659_10017468 3300025926 Bacteria 4688
210 Ga0207659_10045581 3300025926 Bacteria 3092
211 Ga0207659_10150277 3300025926 Bacteria 1818
212 Ga0207659_10195879 3300025926 Bacteria 1610
213 Ga0207687_10184060 3300025927 Bacteria 1620
214 Ga0207644_10103881 3300025931 Bacteria 2139
215 Ga0207644_10283069 3300025931 Bacteria 1332
216 Ga0207706_10013038 3300025933 Bacteria 7565
217 Ga0207706_10037808 3300025933 Bacteria 4284
218 Ga0207706_10201597 3300025933 Bacteria 1745
219 Ga0207706_10479601 3300025933 Bacteria 1075
220 Ga0207709_10147197 3300025935 Bacteria 1627
221 Ga0207709_10215227 3300025935 Bacteria 1382
222 Ga0207670_10001901 3300025936 Bacteria 10915
223 Ga0207670_10004312 3300025936 Bacteria 7638
224 Ga0207670_10082030 3300025936 Bacteria 2259
225 Ga0207670_10130229 3300025936 Bacteria 1842
226 Ga0207669_10012552 3300025937 Bacteria 4171
227 Ga0207704_10100338 3300025938 Bacteria 1928
228 Ga0207691_10002690 3300025940 Bacteria 17383
229 Ga0207691_10030807 3300025940 Bacteria 5010
230 Ga0207691_10042697 3300025940 Bacteria 4179
231 Ga0207691_10081115 3300025940 Bacteria 2917
232 Ga0207691_10191365 3300025940 Bacteria 1784
233 Ga0207711_10011375 3300025941 Bacteria 7396
234 Ga0207711_10070762 3300025941 Bacteria 3026
235 Ga0207711_10258331 3300025941 Bacteria 1600
236 Ga0207689_10158433 3300025942 Bacteria 1866
237 Ga0207679_10007336 3300025945 Bacteria 6989
238 Ga0207679_10018815 3300025945 Bacteria 4633
239 Ga0207679_10135026 3300025945 Bacteria 1985
240 Ga0207679_10199978 3300025945 Bacteria 1668
241 Ga0207679_10231514 3300025945 Bacteria 1560
242 Ga0207667_10005858 3300025949 Bacteria 14968
243 Ga0207667_10105450 3300025949 Bacteria 2908
244 Ga0207651_10105353 3300025960 Bacteria 2103
245 Ga0207651_10528363 3300025960 Bacteria 1023
246 Ga0207668_10066429 3300025972 Bacteria 2557
247 Ga0207640_10095639 3300025981 Bacteria 2069
248 Ga0207658_10043290 3300025986 Bacteria 3272
249 Ga0207658_10383769 3300025986 Bacteria 1231
250 Ga0207658_10467030 3300025986 Bacteria 1119
251 Ga0207703_10102677 3300026035 Bacteria 2426
252 Ga0207703_10163485 3300026035 Bacteria 1951
253 Ga0207639_10105775 3300026041 Bacteria 2283
254 Ga0207708_10167245 3300026075 Bacteria 1739
255 Ga0207702_10015283 3300026078 Bacteria 6363
256 Ga0207641_10012173 3300026088 Bacteria 7061
257 Ga0207641_10117059 3300026088 Bacteria 2372
258 Ga0207641_10240739 3300026088 Bacteria 1686
259 Ga0207641_10372715 3300026088 Bacteria 1365
260 Ga0207641_10514690 3300026088 Bacteria 1163
261 Ga0207641_10795011 3300026088 Bacteria 936
262 Ga0207648_10082721 3300026089 Bacteria 2800
263 Ga0207676_10117466 3300026095 Bacteria 2237
264 Ga0207676_10197274 3300026095 Bacteria 1776
265 Ga0207676_10226838 3300026095 Bacteria 1667
266 Ga0207674_10081046 3300026116 Bacteria 3248
267 Ga0207674_10097827 3300026116 Bacteria 2918
268 Ga0207675_100101906 3300026118 Bacteria 2705
269 Ga0207675_100104568 3300026118 Bacteria 2669
270 Ga0207683_10312180 3300026121 Bacteria 1439
271 Ga0207428_10000022 3300027907 Bacteria 273333
272 Ga0207428_10009997 3300027907 Bacteria 8491
273 Ga0207428_10027726 3300027907 Bacteria 4713
274 Ga0207428_10087057 3300027907 Bacteria 2431
275 Ga0268266_10001936 3300028379 Bacteria 23280
276 Ga0268266_10008403 3300028379 Bacteria 9178
277 Ga0268266_10237839 3300028379 Bacteria 1679
278 Ga0268265_10184090 3300028380 Bacteria 1797
279 Ga0268265_10298763 3300028380 Bacteria 1449
280 Ga0268265_10778865 3300028380 Bacteria 930
281 Ga0268264_10032883 3300028381 Bacteria 4257
282 Ga0268264_10105104 3300028381 Bacteria 2462
283 Ga0268264_10356398 3300028381 Bacteria 1394
284 Ga0265337_1003911 3300028556 Bacteria 6309
285 Ga0265319_1014933 3300028563 Bacteria 3027
286 Ga0265319_1033103 3300028563 Bacteria 1787
287 Ga0265319_1050064 3300028563 Bacteria 1381
288 Ga0265334_10029440 3300028573 Bacteria 2202
289 Ga0265334_10066961 3300028573 Unclassified 1343
290 Ga0265318_10004217 3300028577 Bacteria 7019
291 Ga0265336_10019645 3300028666 Bacteria 2178
292 Ga0265338_10000494 3300028800 Bacteria 70344
293 Ga0265338_10007295 3300028800 Bacteria 13791
294 Ga0265338_10007778 3300028800 Bacteria 13185
295 Ga0265338_10009875 3300028800 Bacteria 11300
296 Ga0265338_10010381 3300028800 Bacteria 10928
297 Ga0265338_10015835 3300028800 Bacteria 8255
298 Ga0265338_10019551 3300028800 Bacteria 7177
299 Ga0265338_10056806 3300028800 Bacteria 3467
300 Ga0265338_10063503 3300028800 Bacteria 3219
301 Ga0265338_10067262 3300028800 Bacteria 3095
302 Ga0265338_10210133 3300028800 Bacteria 1461
303 Ga0265324_10027838 3300029957 Bacteria 1995
304 Ga0265328_10015605 3300031239 Bacteria 2971
305 Ga0265320_10000023 3300031240 Bacteria 171409
306 Ga0265320_10001641 3300031240 Bacteria 15974
307 Ga0265320_10011656 3300031240 Bacteria 5164
308 Ga0265325_10001381 3300031241 Bacteria 17137
309 Ga0265329_10001105 3300031242 Bacteria 13266
310 Ga0265340_10003544 3300031247 Bacteria 8784
311 Ga0265339_10002623 3300031249 Bacteria 12824
312 Ga0265331_10001226 3300031250 Bacteria 19273
313 Ga0265327_10000188 3300031251 Bacteria 130649
314 Ga0265327_10055952 3300031251 Bacteria 2035
315 Ga0265316_10041507 3300031344 Bacteria 3682
316 Ga0307408_100117961 3300031548 Bacteria 2051
317 Ga0307408_100442379 3300031548 Bacteria 1126
318 Ga0265313_10003551 3300031595 Bacteria 12548
319 Ga0265314_10000320 3300031711 Bacteria 67641
320 Ga0265314_10001029 3300031711 Bacteria 32544
321 Ga0265314_10238183 3300031711 Bacteria 1052
322 Ga0265342_10055916 3300031712 Bacteria 2341
323 Ga0307412_10006945 3300031911 Bacteria 6425
324 Ga0307409_100532526 3300031995 Bacteria 1150
325 Ga0307416_100865495 3300032002 Bacteria 1002
326 Ga0307414_10000156 3300032004 Bacteria 45193
327 Ga0373950_0016803 3300034818 Bacteria 1254
328 Ga0373958_0000513 3300034819 Bacteria 4805
329 Ga0373938_0000497 3300034957 Bacteria 6341
330 Ga0373929_0000168 3300035085 Bacteria 11502
331 Ga0373940_0002083 3300035088 Bacteria 3804
332 Ga0373949_0000323 3300035090 Bacteria 16930
333 Ga0373952_0000849 3300035092 Bacteria 5549
334 Ga0373932_0000150 3300035112 Bacteria 19959
335 Ga0373939_0000084 3300035114 Bacteria 29929
336 Ga0373941_0000528 3300035115 Bacteria 7660
337 Ga0373953_0042307 3300035117 Bacteria 1815
338 Ga0373960_0000037 3300035121 Bacteria 17306
339 Ga0373946_0074990 3300035171 Bacteria 1469
340 Ga0373942_0001176 3300035207 Bacteria 6911
341 Ga0373924_0045914 3300035410 Bacteria 1798
342 Ga0373931_0000303 3300035691 Bacteria 20692
343 Ga0373931_0034435 3300035691 Unclassified 2629
344 Ga0373927_0163519 3300035695 Bacteria 1458
345 Ga0373947_0116893 3300035725 Bacteria 1691
346 Ga0373937_0010216 3300036401 Bacteria 8190
347 Ga0373937_0111958 3300036401 Bacteria 2539
348 Ga0373925_0003465 3300037068 Bacteria 12199
349 Ga0395900_0217382 3300037418 Bacteria 1928
350 Ga0395905_0014522 3300037471 Bacteria 7514
351 Ga0450923_011396 3300042125 Bacteria 1597
352 Ga0451577_0000710 3300042876 Bacteria 52071
353 Ga0451577_0469705 3300042876 Bacteria 1142
354 Ga0466969_0044516 3300044656 Bacteria 2207
355 Ga0453683_0115221 3300044673 Bacteria 1691
356 Ga0453683_0247437 3300044673 Bacteria 1136
357 Ga0466961_0011156 3300044693 Bacteria 5745
358 Ga0453684_0002154 3300044712 Bacteria 49298
359 Ga0453684_0025165 3300044712 Bacteria 8653
360 Ga0453684_0091035 3300044712 Bacteria 3767
361 Ga0466959_0148105 3300045049 Bacteria 1656
362 Ga0451576_0008997 3300045051 Bacteria 11635
363 Ga0451576_0035940 3300045051 Bacteria 5254
364 Ga0451576_0068840 3300045051 Bacteria 3683
365 Ga0451576_0141150 3300045051 Bacteria 2512
366 Ga0451576_0812584 3300045051 Bacteria 982
367 Ga0466967_0019325 3300045976 Bacteria 5475
368 Ga0495592_0000108 3300046454 Bacteria 74029
369 Ga0495592_0045001 3300046454 Bacteria 3295
370 Ga0495629_0123965 3300046459 Bacteria 1800
371 Ga0495629_0152550 3300046459 Bacteria 1606
372 Ga0495641_0012213 3300046461 Bacteria 4821
373 Ga0495580_0376572 3300046472 Bacteria 959
374 Ga0495664_0033932 3300046477 Bacteria 3000
375 Ga0495618_0001454 3300046514 Bacteria 15891
376 Ga0495618_0017628 3300046514 Bacteria 4380
377 Ga0495628_0000042 3300046516 Bacteria 102062
378 Ga0495628_0086863 3300046516 Bacteria 2425
379 Ga0495630_0001636 3300046517 Bacteria 15580
380 Ga0495630_0141373 3300046517 Bacteria 1830
381 Ga0495666_0015518 3300046526 Bacteria 3792
382 Ga0495666_0095103 3300046526 Bacteria 1405
383 Ga0495652_0045391 3300046529 Bacteria 3779
384 Ga0495640_0011213 3300046533 Bacteria 6899
385 Ga0495640_0050959 3300046533 Bacteria 2849
386 Ga0495586_0100519 3300046535 Bacteria 1604
387 Ga0495645_0237309 3300046543 Bacteria 1218
388 Ga0495667_0000690 3300046559 Bacteria 21599
389 Ga0495634_0032865 3300046642 Bacteria 3566
390 Ga0495657_0027247 3300046675 Bacteria 4035
391 Ga0495599_0000547 3300046678 Bacteria 21507
392 Ga0495599_0068824 3300046678 Bacteria 2210
393 Ga0495658_0002697 3300046683 Bacteria 8942
394 Ga0495658_0005970 3300046683 Bacteria 5980
395 Ga0495613_0017955 3300046689 Bacteria 5272
396 Ga0495613_0264046 3300046689 Bacteria 1198
397 Ga0495613_0282039 3300046689 Bacteria 1153
398 Ga0495581_0151467 3300047315 Bacteria 1354
399 Ga0495674_0001102 3300047319 Bacteria 25946
400 Ga0495674_0011834 3300047319 Bacteria 8225
401 Ga0495676_0125568 3300047321 Bacteria 1860
402 Ga0495680_0037323 3300047322 Bacteria 3892
403 Ga0495675_0060648 3300047444 Bacteria 2397
404 Ga0495675_0157509 3300047444 Bacteria 1400
405 Ga0495684_0041453 3300047471 Bacteria 3529
406 Ga0495684_0226746 3300047471 Unclassified 1368
407 Ga0495686_0168409 3300047472 Bacteria 1275
408 Ga0496105_0087496 3300048908 Bacteria 2574
409 Ga0496108_0236687 3300048911 Bacteria 1588
410 Ga0496109_0672218 3300048912 Bacteria 973
411 Ga0496112_0017474 3300048915 Bacteria 6739
412 Ga0496114_0140405 3300048917 Bacteria 2091
413 Ga0496115_0021415 3300048918 Bacteria 4995
414 Ga0501031_0140418 3300049568 Bacteria 1579
415 Ga0501036_0197437 3300049572 Bacteria 1692
416 Ga0501041_0058091 3300049577 Bacteria 2366
417 Ga0501046_0021279 3300049580 Bacteria 5354
418 Ga0501047_0002311 3300049581 Bacteria 18235
419 Ga0501071_0069380 3300049587 Bacteria 2567
420 Ga0501071_0086452 3300049587 Bacteria 2300
421 Ga0501072_0226856 3300049588 Bacteria 1488
422 Ga0501074_0130574 3300049590 Bacteria 1797
423 Ga0501075_0006195 3300049591 Bacteria 8220
424 Ga0501075_0178528 3300049591 Bacteria 1620
425 Ga0501076_0097722 3300049592 Bacteria 2365
426 Ga0501076_0234469 3300049592 Bacteria 1500
427 Ga0501081_0050655 3300049743 Bacteria 2860
428 Ga0501081_0091757 3300049743 Bacteria 2137
429 Ga0501035_0029479 3300049822 Bacteria 5004
430 Ga0501035_0431135 3300049822 Bacteria 1093
431 Ga0501045_0012794 3300049824 Bacteria 5913
432 Ga0501045_0298300 3300049824 Bacteria 1199
433 nmdc:mga05p37_106633_c1 3300050507 Bacteria 3447
434 nmdc:mga05p37_256036_c1 3300050507 Bacteria 2097
435 nmdc:mga05p37_521898_c1 3300050507 Bacteria 1358
436 nmdc:mga09592_11191_c1 3300050508 Bacteria 7300
437 nmdc:mga0qj67_224071_c1 3300050509 Unclassified 1526
438 nmdc:mga0qj67_4546_c1 3300050509 Bacteria 10053
439 nmdc:mga06r32_18015_c1 3300050510 Bacteria 6457
440 nmdc:mga06r32_3388_c1 3300050510 Bacteria 14254
441 nmdc:mga06r32_47548_c1 3300050510 Bacteria 4098
442 nmdc:mga06r32_71628_c1 3300050510 Bacteria 3354
443 nmdc:mga08y16_21_c1 3300050511 Bacteria 254790
444 nmdc:mga08y16_2205_c1 3300050511 Bacteria 19973
445 nmdc:mga08y16_42390_c1 3300050511 Unclassified 4767
446 nmdc:mga08y16_5333_c1 3300050511 Bacteria 13454
447 nmdc:mga08y16_6468_c1 3300050511 Bacteria 12295
448 nmdc:mga08y16_7580_c1 3300050511 Bacteria 11363
449 nmdc:mga0n895_123914_c1 3300050512 Bacteria 2607
450 nmdc:mga0n895_159116_c1 3300050512 Bacteria 2290
451 nmdc:mga0n895_46067_c1 3300050512 Bacteria 4259
452 nmdc:mga0rr50_1562_c1 3300050513 Bacteria 12631
453 nmdc:mga0rr50_18663_c1 3300050513 Bacteria 4664
454 nmdc:mga0rr50_4849_c1 3300050513 Bacteria 7954
455 nmdc:mga0rr50_522705_c1 3300050513 Bacteria 1010
456 nmdc:mga0a205_305897_c1 3300050515 Bacteria 1462
457 nmdc:mga0a205_41668_c1 3300050515 Bacteria 4423
458 nmdc:mga0a205_591924_c1 3300050515 Bacteria 963
459 nmdc:mga0a205_77649_c1 3300050515 Bacteria 1418
460 Ga0500650_0008823 3300053098 Bacteria 4012
461 Ga0501084_0038192 3300054114 Bacteria 4014
462 Ga0590071_004069 3300059421 Bacteria 3569
463 Ga0590074_004064 3300059423 Bacteria 2418
464 Ga0590075_003213 3300059424 Bacteria 3890
465 Ga0590077_000829 3300059426 Bacteria 7985
466 Ga0501082_0116158 3300060353 Bacteria 2317
467 Ga0530510_0058882 3300061734 Bacteria 2778
468 Ga0530510_0103635 3300061734 Bacteria 2081
469 Ga0373956_0008300
470 JGI25406J46586_10017621
471 rootH1_10103113
472 rootH1_10229124
473 Ga0065704_10103283
474 Ga0065712_10083251
475 Ga0065712_10101012
476 Ga0065715_10102343
477 Ga0065707_10000566
478 Ga0070683_100355930
479 Ga0070670_100006936
480 Ga0070670_100024018
481 Ga0070670_100050238
482 Ga0070666_10203696
483 Ga0070689_100004999
484 Ga0070689_100006775
485 Ga0070689_100043007
486 Ga0070689_100103916
487 Ga0070689_100254899
488 Ga0070689_100366450
489 Ga0070687_100314933
490 Ga0070669_100156624
491 Ga0070669_100167397
492 Ga0070675_100003322
493 Ga0070675_100022270
494 Ga0070675_100040424
495 Ga0070675_100047210
496 Ga0070675_100093893
497 Ga0070675_100422814
498 Ga0070674_100055979
499 Ga0070673_100119596
500 Ga0070673_100311936
501 Ga0070688_100013743
502 Ga0070688_100146620
503 Ga0070688_100267913
504 Ga0070688_100270347
505 Ga0070688_100291144
506 Ga0070659_100238551
507 Ga0070667_100049691
508 Ga0070667_100332821
509 Ga0070714_100633031
510 Ga0070705_100006155
511 Ga0070708_100008770
512 Ga0070678_100119238
513 Ga0070698_100037653
514 Ga0070699_100004746
515 Ga0070679_100088968
516 Ga0070672_100015338
517 Ga0070672_100135064
518 Ga0070686_100002734
519 Ga0070686_100015964
520 Ga0070686_100019867
521 Ga0070686_100090090
522 Ga0070686_100266056
523 Ga0070695_100242887
524 Ga0070665_100009549
525 Ga0070665_100018633
526 Ga0070665_100183126
527 Ga0070704_100018609
528 Ga0070704_100186966
529 Ga0070704_100411910
530 Ga0070664_100027323
531 Ga0068857_100075590
532 Ga0068857_100171055
533 Ga0068857_100261705
534 Ga0068856_100000277
535 Ga0068859_100040223
536 Ga0068859_100068361
537 Ga0068859_100102260
538 Ga0068859_100253473
539 Ga0068859_100257588
540 Ga0068859_100286362
541 Ga0068859_100436999
542 Ga0068864_100003382
543 Ga0068864_100049555
544 Ga0068864_100069462
545 Ga0068864_100079229
546 Ga0068864_100128852
547 Ga0068864_100153406
548 Ga0068866_10087387
549 Ga0068861_100155709
550 Ga0068863_100052381
551 Ga0068863_100089851
552 Ga0068863_100312269
553 Ga0068863_100395081
554 Ga0068863_100447895
555 Ga0068858_100372021
556 Ga0068860_100170887
557 Ga0068860_100233498
558 Ga0068860_100462381
559 Ga0068862_100016005
560 Ga0068862_100139941
561 Ga0081539_10000065
562 Ga0081539_10036995
563 Ga0097621_100033686
564 Ga0097621_100036823
565 Ga0068871_100003278
566 Ga0068871_100010948
567 Ga0075428_100000007
568 Ga0075428_100119735
569 Ga0075428_100413900
570 Ga0075430_100117306
571 Ga0075431_100004116
572 Ga0075431_100011670
573 Ga0075431_100212348
574 Ga0075433_10186938
575 Ga0075433_10563693
576 Ga0075434_100003344
577 Ga0075434_100088302
578 Ga0075434_100144367
579 Ga0075434_100279637
580 Ga0075429_100260733
581 Ga0075429_100448937
582 Ga0068865_100068528
583 Ga0068865_100086166
584 Ga0068865_100322741
585 Ga0075436_100063660
586 Ga0097620_100040219
587 Ga0097620_100068361
588 Ga0097620_100102262
589 Ga0097620_100253475
590 Ga0097620_100257603
591 Ga0097620_100286353
592 Ga0097620_100437006
593 Ga0075435_100016850
594 Ga0075435_100021275
595 Ga0075435_100037382
596 Ga0075435_100050622
597 Ga0105240_10196839
598 Ga0111539_10000009
599 Ga0111539_10002637
600 Ga0111539_10006628
601 Ga0111539_10009292
602 Ga0111539_10012660
603 Ga0111539_10053167
604 Ga0111539_10537332
605 Ga0111539_10674241
606 Ga0105245_10524892
607 Ga0105247_10058027
608 Ga0105247_10118377
609 Ga0114129_10051653
610 Ga0114129_10446732
611 Ga0114129_10564210
612 Ga0114129_10810647
613 Ga0105243_10150126
614 Ga0105243_10263930
615 Ga0105242_10118520
616 Ga0105242_10139478
617 Ga0105242_10312366
618 Ga0105242_10499104
619 Ga0105248_10018300
620 Ga0105248_10060221
621 Ga0105248_10223290
622 Ga0105248_10291183
623 Ga0105249_10356218
624 Ga0157369_10587370
625 Ga0157374_10189870
626 Ga0157374_10250209
627 Ga0157374_10326720
628 Ga0157378_10171329
629 Ga0163162_10072584
630 Ga0163162_10539712
631 Ga0157375_10000168
632 Ga0157375_10008222
633 Ga0157375_10018182
634 Ga0157375_10024147
635 Ga0157375_10390853
636 Ga0163163_10000106
637 Ga0163163_10011980
638 Ga0163163_10013983
639 Ga0163163_10017104
640 Ga0163163_10035514
641 Ga0157380_10064959
642 Ga0157380_10202986
643 Ga0157380_10387070
644 Ga0157380_10435314
645 Ga0157380_10471306
646 Ga0157377_10023663
647 Ga0157377_10101993
648 Ga0157379_10001821
649 Ga0157379_10165150
650 Ga0157379_10219000
651 Ga0157376_10019977
652 Ga0157376_10062919
653 Ga0157376_10236384
654 Ga0157376_10401540
655 Ga0157376_10429517
656 Ga0163161_10308261
657 Ga0207682_10034605
658 Ga0207710_10010466
659 Ga0207680_10024695
660 Ga0207680_10050359
661 Ga0207680_10286018
662 Ga0207680_10354909
663 Ga0207645_10050200
664 Ga0207705_10216840
665 Ga0207695_10259931
666 Ga0207663_10005913
667 Ga0207662_10166160
668 Ga0207652_10057910
669 Ga0207681_10182966
670 Ga0207681_10186693
671 Ga0207650_10064845
672 Ga0207650_10124824
673 Ga0207650_10376331
674 Ga0207659_10000151
675 Ga0207659_10003119
676 Ga0207659_10009817
677 Ga0207659_10017468
678 Ga0207659_10045581
679 Ga0207659_10150277
680 Ga0207659_10195879
681 Ga0207687_10184060
682 Ga0207644_10103881
683 Ga0207644_10283069
684 Ga0207706_10013038
685 Ga0207706_10037808
686 Ga0207706_10201597
687 Ga0207706_10479601
688 Ga0207709_10147197
689 Ga0207709_10215227
690 Ga0207670_10001901
691 Ga0207670_10004312
692 Ga0207670_10082030
693 Ga0207670_10130229
694 Ga0207669_10012552
695 Ga0207704_10100338
696 Ga0207691_10002690
697 Ga0207691_10030807
698 Ga0207691_10042697
699 Ga0207691_10081115
700 Ga0207691_10191365
701 Ga0207711_10011375
702 Ga0207711_10070762
703 Ga0207711_10258331
704 Ga0207689_10158433
705 Ga0207679_10007336
706 Ga0207679_10018815
707 Ga0207679_10135026
708 Ga0207679_10199978
709 Ga0207679_10231514
710 Ga0207667_10005858
711 Ga0207667_10105450
712 Ga0207651_10105353
713 Ga0207651_10528363
714 Ga0207668_10066429
715 Ga0207640_10095639
716 Ga0207658_10043290
717 Ga0207658_10383769
718 Ga0207658_10467030
719 Ga0207703_10102677
720 Ga0207703_10163485
721 Ga0207639_10105775
722 Ga0207708_10167245
723 Ga0207702_10015283
724 Ga0207641_10012173
725 Ga0207641_10117059
726 Ga0207641_10240739
727 Ga0207641_10372715
728 Ga0207641_10514690
729 Ga0207641_10795011
730 Ga0207648_10082721
731 Ga0207676_10117466
732 Ga0207676_10197274
733 Ga0207676_10226838
734 Ga0207674_10081046
735 Ga0207674_10097827
736 Ga0207675_100101906
737 Ga0207675_100104568
738 Ga0207683_10312180
739 Ga0207428_10000022
740 Ga0207428_10009997
741 Ga0207428_10027726
742 Ga0207428_10087057
743 Ga0268266_10001936
744 Ga0268266_10008403
745 Ga0268266_10237839
746 Ga0268265_10184090
747 Ga0268265_10298763
748 Ga0268265_10778865
749 Ga0268264_10032883
750 Ga0268264_10105104
751 Ga0268264_10356398
752 Ga0265337_1003911
753 Ga0265319_1014933
754 Ga0265319_1033103
755 Ga0265319_1050064
756 Ga0265334_10029440
757 Ga0265334_10066961
758 Ga0265318_10004217
759 Ga0265336_10019645
760 Ga0265338_10000494
761 Ga0265338_10007295
762 Ga0265338_10007778
763 Ga0265338_10009875
764 Ga0265338_10010381
765 Ga0265338_10015835
766 Ga0265338_10019551
767 Ga0265338_10056806
768 Ga0265338_10063503
769 Ga0265338_10067262
770 Ga0265338_10210133
771 Ga0265324_10027838
772 Ga0265328_10015605
773 Ga0265320_10000023
774 Ga0265320_10001641
775 Ga0265320_10011656
776 Ga0265325_10001381
777 Ga0265329_10001105
778 Ga0265340_10003544
779 Ga0265339_10002623
780 Ga0265331_10001226
781 Ga0265327_10000188
782 Ga0265327_10055952
783 Ga0265316_10041507
784 Ga0307408_100117961
785 Ga0307408_100442379
786 Ga0265313_10003551
787 Ga0265314_10000320
788 Ga0265314_10001029
789 Ga0265314_10238183
790 Ga0265342_10055916
791 Ga0307412_10006945
792 Ga0307409_100532526
793 Ga0307416_100865495
794 Ga0307414_10000156
795 Ga0373950_0016803
796 Ga0373958_0000513
797 Ga0373938_0000497
798 Ga0373929_0000168
799 Ga0373940_0002083
800 Ga0373949_0000323
801 Ga0373952_0000849
802 Ga0373932_0000150
803 Ga0373939_0000084
804 Ga0373941_0000528
805 Ga0373953_0042307
806 Ga0373960_0000037
807 Ga0373946_0074990
808 Ga0373942_0001176
809 Ga0373924_0045914
810 Ga0373931_0000303
811 Ga0373931_0034435
812 Ga0373927_0163519
813 Ga0373947_0116893
814 Ga0373937_0010216
815 Ga0373937_0111958
816 Ga0373925_0003465
817 Ga0395900_0217382
818 Ga0395905_0014522
819 Ga0450923_011396
820 Ga0451577_0000710
821 Ga0451577_0469705
822 Ga0466969_0044516
823 Ga0453683_0115221
824 Ga0453683_0247437
825 Ga0466961_0011156
826 Ga0453684_0002154
827 Ga0453684_0025165
828 Ga0453684_0091035
829 Ga0466959_0148105
830 Ga0451576_0008997
831 Ga0451576_0035940
832 Ga0451576_0068840
833 Ga0451576_0141150
834 Ga0451576_0812584
835 Ga0466967_0019325
836 Ga0495592_0000108
837 Ga0495592_0045001
838 Ga0495629_0123965
839 Ga0495629_0152550
840 Ga0495641_0012213
841 Ga0495580_0376572
842 Ga0495664_0033932
843 Ga0495618_0001454
844 Ga0495618_0017628
845 Ga0495628_0000042
846 Ga0495628_0086863
847 Ga0495630_0001636
848 Ga0495630_0141373
849 Ga0495666_0015518
850 Ga0495666_0095103
851 Ga0495652_0045391
852 Ga0495640_0011213
853 Ga0495640_0050959
854 Ga0495586_0100519
855 Ga0495645_0237309
856 Ga0495667_0000690
857 Ga0495634_0032865
858 Ga0495657_0027247
859 Ga0495599_0000547
860 Ga0495599_0068824
861 Ga0495658_0002697
862 Ga0495658_0005970
863 Ga0495613_0017955
864 Ga0495613_0264046
865 Ga0495613_0282039
866 Ga0495581_0151467
867 Ga0495674_0001102
868 Ga0495674_0011834
869 Ga0495676_0125568
870 Ga0495680_0037323
871 Ga0495675_0060648
872 Ga0495675_0157509
873 Ga0495684_0041453
874 Ga0495684_0226746
875 Ga0495686_0168409
876 Ga0496105_0087496
877 Ga0496108_0236687
878 Ga0496109_0672218
879 Ga0496112_0017474
880 Ga0496114_0140405
881 Ga0496115_0021415
882 Ga0501031_0140418
883 Ga0501036_0197437
884 Ga0501041_0058091
885 Ga0501046_0021279
886 Ga0501047_0002311
887 Ga0501071_0069380
888 Ga0501071_0086452
889 Ga0501072_0226856
890 Ga0501074_0130574
891 Ga0501075_0006195
892 Ga0501075_0178528
893 Ga0501076_0097722
894 Ga0501076_0234469
895 Ga0501081_0050655
896 Ga0501081_0091757
897 Ga0501035_0029479
898 Ga0501035_0431135
899 Ga0501045_0012794
900 Ga0501045_0298300
901 nmdc:mga05p37_106633_c1
902 nmdc:mga05p37_256036_c1
903 nmdc:mga05p37_521898_c1
904 nmdc:mga09592_11191_c1
905 nmdc:mga0qj67_224071_c1
906 nmdc:mga0qj67_4546_c1
907 nmdc:mga06r32_18015_c1
908 nmdc:mga06r32_3388_c1
909 nmdc:mga06r32_47548_c1
910 nmdc:mga06r32_71628_c1
911 nmdc:mga08y16_21_c1
912 nmdc:mga08y16_2205_c1
913 nmdc:mga08y16_42390_c1
914 nmdc:mga08y16_5333_c1
915 nmdc:mga08y16_6468_c1
916 nmdc:mga08y16_7580_c1
917 nmdc:mga0n895_123914_c1
918 nmdc:mga0n895_159116_c1
919 nmdc:mga0n895_46067_c1
920 nmdc:mga0rr50_1562_c1
921 nmdc:mga0rr50_18663_c1
922 nmdc:mga0rr50_4849_c1
923 nmdc:mga0rr50_522705_c1
924 nmdc:mga0a205_305897_c1
925 nmdc:mga0a205_41668_c1
926 nmdc:mga0a205_591924_c1
927 nmdc:mga0a205_77649_c1
928 Ga0500650_0008823
929 Ga0501084_0038192
930 Ga0590071_004069
931 Ga0590074_004064
932 Ga0590075_003213
933 Ga0590077_000829
934 Ga0501082_0116158
935 Ga0530510_0058882
936 Ga0530510_0103635

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

115

324

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wzo-assembly1.cif.gz_C crystal structure of the hpce from thermus thermophilus hb8 0.846 4 288
1wzo-assembly1.cif.gz_C crystal structure of the hpce from thermus thermophilus hb8 0.8427 4 288
2q19-assembly1.cif.gz_X 2-keto-3-deoxy-d-arabinonate dehydratase apo form 0.842 4 288
2q1d-assembly1.cif.gz_X 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2,5-dioxopentanoate 0.8394 4 288
1wzo-assembly1.cif.gz_A crystal structure of the hpce from thermus thermophilus hb8 0.8383 4 288
ID Description Score Start End Superfamily
2q18X02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9411 73 288 3.90.850.10
2q18X02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9282 73 288 3.90.850.10
4dbfB02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8429 75 288 3.90.850.10
4dbfB02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.831 75 288 3.90.850.10
1wzoC02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8309 75 288 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A846ZTE1-F1-model_v4 Fumarylacetoacetate hydrolase 0.987 106 286 GO:0016787
GO:0044281
AF-A0A349BVW8-F1-model_v4 Fumarylacetoacetase-like C-terminal domain-containing protein 0.9861 204 286 GO:0003824
AF-A0A2N5K5F2-F1-model_v4 Fumarylacetoacetase-like C-terminal domain-containing protein 0.9809 115 288 GO:0003824
GO:0044281
AF-A0A3B9G7U1-F1-model_v4 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase 0.9798 107 286 GO:0016853
GO:0044281
AF-A0A3L7WW04-F1-model_v4 Fumarylacetoacetase-like C-terminal domain-containing protein 0.9795 205 285 GO:0003824

Map