F450059

General Info

Members Datasets Scaffolds Average Seq Length
468 251 936 171

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100190138|Ga0307408_1001901381
Length 176
Sequence MAQPYVGEIRMFAGNFPPVGWKFCDGQLLPISENETLFQLIGTTYGGDGQSTFALPNLQSRVPIHMGTFGGITYQISEMAGTESVTLTTQQIPIHTHPHGCSDGNQAANSADPTNGVANKSDLSQFNSAGYDNVSQMGTPPLSSDPTGGSQPHENCQPFLCINYIISLFGLFPSPT

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
177 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
178 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
179 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
180 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
181 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
182 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
183 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
184 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
192 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
193 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
194 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
195 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
196 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
197 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
198 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
199 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
200 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
201 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
202 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
203 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
204 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
205 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
206 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
207 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
208 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
209 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
210 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
211 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
212 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
213 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
214 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
215 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
216 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
217 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
218 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
219 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
220 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
221 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
222 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
223 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
235 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300060246 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.1
Metatranscriptomes 10.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.28
Nodule 0
Rhizoplane 0.43
Rhizosphere 97.44
Stem 0
Stem Tuber 0
Unclassified 12.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100190138 3300031548 Bacteria 1653
2 MRS1b_contig_9387706 2162886011 Bacteria 1370
3 CNAas_1000839 3300000532 Bacteria 2907
4 rootL2_10219126 3300003322 Bacteria 2599
5 Ga0058859_11389759 3300004798 Bacteria 645
6 Ga0058863_11418228 3300004799 Bacteria 2209
7 Ga0058861_10094560 3300004800 Bacteria 2028
8 Ga0058860_11806974 3300004801 Bacteria 791
9 Ga0058862_11746648 3300004803 Bacteria 2008
10 Ga0065704_10003045 3300005289 Bacteria 5699
11 Ga0065704_10088223 3300005289 Bacteria 2957
12 Ga0065715_10100678 3300005293 Bacteria 3280
13 Ga0065715_10138819 3300005293 Bacteria 1886
14 Ga0065715_10211202 3300005293 Bacteria 1313
15 Ga0065715_10320738 3300005293 Bacteria 1002
16 Ga0065707_10002730 3300005295 Bacteria 5561
17 Ga0065707_10038470 3300005295 Bacteria 882
18 Ga0065707_10113046 3300005295 Bacteria 2341
19 Ga0070658_10019135 3300005327 Bacteria 5485
20 Ga0070676_10061669 3300005328 Bacteria 2229
21 Ga0070676_10067674 3300005328 Bacteria 2136
22 Ga0070676_10075972 3300005328 Bacteria 2027
23 Ga0070683_101045849 3300005329 Bacteria 784
24 Ga0070690_100101699 3300005330 Bacteria 1906
25 Ga0070690_100207744 3300005330 Bacteria 1365
26 Ga0070670_100479433 3300005331 Bacteria 1105
27 Ga0070670_100568822 3300005331 Bacteria 1012
28 Ga0070677_10000079 3300005333 Bacteria 30894
29 Ga0068869_100046249 3300005334 Bacteria 3137
30 Ga0068869_100642470 3300005334 Unclassified 900
31 Ga0070666_10511748 3300005335 Unclassified 871
32 Ga0070680_100000437 3300005336 Bacteria 28394
33 Ga0070680_100299618 3300005336 Unclassified 1363
34 Ga0070682_100003873 3300005337 Bacteria 8303
35 Ga0070682_100452424 3300005337 Bacteria 984
36 Ga0068868_100233221 3300005338 Bacteria 1544
37 Ga0068868_100386941 3300005338 Bacteria 1204
38 Ga0068868_100766384 3300005338 Viruses 868
39 Ga0070689_100248105 3300005340 Unclassified 1468
40 Ga0070687_100000723 3300005343 Bacteria 10990
41 Ga0070687_100083582 3300005343 Bacteria 1748
42 Ga0070687_100397964 3300005343 Bacteria 902
43 Ga0070687_100594587 3300005343 Bacteria 759
44 Ga0070661_100922126 3300005344 Bacteria 722
45 Ga0070661_100969326 3300005344 Unclassified 704
46 Ga0070692_10005032 3300005345 Bacteria 5589
47 Ga0070692_10051537 3300005345 Bacteria 2141
48 Ga0070692_10082354 3300005345 Bacteria 1735
49 Ga0070692_10086460 3300005345 Bacteria 1697
50 Ga0070669_100313453 3300005353 Viruses 1265
51 Ga0070675_100313625 3300005354 Bacteria 1384
52 Ga0070671_100217127 3300005355 Bacteria 1622
53 Ga0070673_100080603 3300005364 Unclassified 2638
54 Ga0070673_100349442 3300005364 Viruses 1312
55 Ga0070703_10008816 3300005406 Bacteria 2840
56 Ga0070703_10223202 3300005406 Bacteria 751
57 Ga0070701_10096653 3300005438 Bacteria 1629
58 Ga0070705_100012212 3300005440 Unclassified 4360
59 Ga0070705_100314882 3300005440 Viruses 1127
60 Ga0070700_100000913 3300005441 Bacteria 14589
61 Ga0070700_100013797 3300005441 Bacteria 4545
62 Ga0070700_100019146 3300005441 Unclassified 3947
63 Ga0070700_100257593 3300005441 Viruses 1255
64 Ga0070700_100375161 3300005441 Bacteria 1062
65 Ga0070700_100492397 3300005441 Bacteria 941
66 Ga0070694_100001863 3300005444 Bacteria 12489
67 Ga0070694_100007175 3300005444 Bacteria 6786
68 Ga0070694_100010258 3300005444 Bacteria 5771
69 Ga0070694_100014537 3300005444 Bacteria 4927
70 Ga0070694_100040275 3300005444 Bacteria 3114
71 Ga0070694_100058119 3300005444 Bacteria 2631
72 Ga0070708_100506994 3300005445 Bacteria 1138
73 Ga0070662_100025708 3300005457 Unclassified 4069
74 Ga0070662_100178424 3300005457 Bacteria 1673
75 Ga0070681_10000158 3300005458 Bacteria 52016
76 Ga0070681_10010318 3300005458 Bacteria 9221
77 Ga0068867_100232020 3300005459 Bacteria 1492
78 Ga0068867_100335338 3300005459 Bacteria 1257
79 Ga0068867_101469429 3300005459 Unclassified 634
80 Ga0070685_10000405 3300005466 Bacteria 25890
81 Ga0070706_100211062 3300005467 Bacteria 1813
82 Ga0070706_101065113 3300005467 Unclassified 745
83 Ga0070707_100067922 3300005468 Bacteria 3430
84 Ga0070698_100028269 3300005471 Bacteria 5827
85 Ga0070698_100050963 3300005471 Bacteria 4218
86 Ga0070698_100802352 3300005471 Viruses 885
87 Ga0070679_100000173 3300005530 Bacteria 51987
88 Ga0070697_100039041 3300005536 Bacteria 3838
89 Ga0070697_100203094 3300005536 Bacteria 1685
90 Ga0068853_100006081 3300005539 Bacteria 9555
91 Ga0068853_101177213 3300005539 Unclassified 740
92 Ga0070686_100000004 3300005544 Bacteria 262514
93 Ga0070686_100010649 3300005544 Bacteria 5195
94 Ga0070695_100038159 3300005545 Bacteria 3029
95 Ga0070695_100038948 3300005545 Bacteria 3003
96 Ga0070695_100122700 3300005545 Bacteria 1780
97 Ga0070695_100155836 3300005545 Viruses 1598
98 Ga0070695_100229163 3300005545 Viruses 1342
99 Ga0070696_100031999 3300005546 Bacteria 3607
100 Ga0070696_100033027 3300005546 Bacteria 3554
101 Ga0070696_100527338 3300005546 Bacteria 943
102 Ga0070696_100682968 3300005546 Unclassified 835
103 Ga0070693_100004428 3300005547 Bacteria 6640
104 Ga0070704_100025493 3300005549 Bacteria 3894
105 Ga0070704_100046762 3300005549 Bacteria 3021
106 Ga0070704_100053598 3300005549 Bacteria 2851
107 Ga0070704_100255592 3300005549 Bacteria 1441
108 Ga0068857_100164505 3300005577 Bacteria 2014
109 Ga0068857_100278707 3300005577 Bacteria 1537
110 Ga0068857_101087359 3300005577 Bacteria 772
111 Ga0068854_100330147 3300005578 Bacteria 1242
112 Ga0068854_100571194 3300005578 Bacteria 962
113 Ga0068856_101063236 3300005614 Unclassified 827
114 Ga0070702_100066019 3300005615 Bacteria 2120
115 Ga0068852_100049225 3300005616 Unclassified 3604
116 Ga0068852_100049641 3300005616 Bacteria 3590
117 Ga0068859_100021579 3300005617 Bacteria 6464
118 Ga0068859_100064193 3300005617 Bacteria 3704
119 Ga0068859_100068603 3300005617 Viruses 3580
120 Ga0068859_100096991 3300005617 Bacteria 3001
121 Ga0068859_100212513 3300005617 Bacteria 2021
122 Ga0068859_100331013 3300005617 Bacteria 1617
123 Ga0068864_100029006 3300005618 Unclassified 4681
124 Ga0068864_100049776 3300005618 Bacteria 3605
125 Ga0068864_100315949 3300005618 Bacteria 1466
126 Ga0068864_100401210 3300005618 Bacteria 1303
127 Ga0068861_100025177 3300005719 Bacteria 4312
128 Ga0068861_100195726 3300005719 Bacteria 1693
129 Ga0068861_100645464 3300005719 Unclassified 977
130 Ga0068861_100776652 3300005719 Bacteria 897
131 Ga0068851_10004808 3300005834 Bacteria 6113
132 Ga0068870_10028343 3300005840 Unclassified 2811
133 Ga0068870_10172627 3300005840 Bacteria 1291
134 Ga0068863_100044247 3300005841 Bacteria 4226
135 Ga0068863_100563273 3300005841 Bacteria 1126
136 Ga0068863_100612774 3300005841 Bacteria 1078
137 Ga0068858_100032748 3300005842 Bacteria 4827
138 Ga0068858_100226439 3300005842 Bacteria 1772
139 Ga0068860_100399085 3300005843 Viruses 1360
140 Ga0068860_100699754 3300005843 Viruses 1023
141 Ga0068860_101233492 3300005843 Bacteria 768
142 Ga0068862_100023316 3300005844 Bacteria 5184
143 Ga0068862_100062670 3300005844 Unclassified 3198
144 Ga0068862_100712500 3300005844 Bacteria 973
145 Ga0068862_100726607 3300005844 Viruses 964
146 Ga0075364_10002050 3300006051 Bacteria 11248
147 Ga0075367_10007908 3300006178 Bacteria 5478
148 Ga0075366_10148955 3300006195 Bacteria 1417
149 Ga0097621_100618836 3300006237 Bacteria 991
150 Ga0068871_100016489 3300006358 Bacteria 5566
151 Ga0075428_100014452 3300006844 Bacteria 8768
152 Ga0075430_100002299 3300006846 Bacteria 15851
153 Ga0075431_100011652 3300006847 Bacteria 8870
154 Ga0075433_10002899 3300006852 Bacteria 13140
155 Ga0075433_10046680 3300006852 Bacteria 3767
156 Ga0075434_100160673 3300006871 Bacteria 2266
157 Ga0075429_100008213 3300006880 Bacteria 9075
158 Ga0075429_100067193 3300006880 Bacteria 3120
159 Ga0075429_100401129 3300006880 Bacteria 1201
160 Ga0068865_100030480 3300006881 Bacteria 3588
161 Ga0068865_101336950 3300006881 Bacteria 638
162 Ga0097620_100021577 3300006931 Bacteria 6464
163 Ga0097620_100064191 3300006931 Bacteria 3704
164 Ga0097620_100068602 3300006931 Viruses 3580
165 Ga0097620_100096991 3300006931 Bacteria 3001
166 Ga0097620_100212504 3300006931 Bacteria 2021
167 Ga0097620_100330993 3300006931 Bacteria 1617
168 Ga0075435_101500868 3300007076 Unclassified 591
169 Ga0105251_10028257 3300009011 Bacteria 2835
170 Ga0111539_10020974 3300009094 Bacteria 8045
171 Ga0111539_10031416 3300009094 Bacteria 6451
172 Ga0111539_10080774 3300009094 Bacteria 3824
173 Ga0111539_10123206 3300009094 Bacteria 3038
174 Ga0111539_10655805 3300009094 Bacteria 1222
175 Ga0105245_11120300 3300009098 Bacteria 834
176 Ga0105245_11558700 3300009098 Viruses 712
177 Ga0114129_10007892 3300009147 Bacteria 15148
178 Ga0114129_10009058 3300009147 Bacteria 14188
179 Ga0114129_10034310 3300009147 Bacteria 7165
180 Ga0114129_10166798 3300009147 Unclassified 3005
181 Ga0105243_10003627 3300009148 Bacteria 12434
182 Ga0105243_10290682 3300009148 Bacteria 1476
183 Ga0105243_10352981 3300009148 Bacteria 1351
184 Ga0105243_10533775 3300009148 Bacteria 1118
185 Ga0105241_10019067 3300009174 Bacteria 5059
186 Ga0105241_10090069 3300009174 Viruses 2419
187 Ga0105241_10463743 3300009174 Bacteria 1123
188 Ga0105241_11688350 3300009174 Unclassified 615
189 Ga0105242_10148862 3300009176 Bacteria 2039
190 Ga0105248_10182484 3300009177 Bacteria 2365
191 Ga0105248_10312925 3300009177 Viruses 1769
192 Ga0105248_11791948 3300009177 Bacteria 696
193 Ga0105237_10005382 3300009545 Bacteria 14468
194 Ga0105238_10118925 3300009551 Bacteria 2622
195 Ga0105238_11568172 3300009551 Bacteria 688
196 Ga0105249_10020367 3300009553 Bacteria 5930
197 Ga0105249_11491492 3300009553 Bacteria 748
198 Ga0105239_10012768 3300010375 Bacteria 9344
199 Ga0105239_10999067 3300010375 Viruses 962
200 Ga0105246_10005033 3300011119 Bacteria 8039
201 Ga0105246_10363565 3300011119 Bacteria 1190
202 Ga0105246_10932881 3300011119 Bacteria 781
203 Ga0157373_10113127 3300013100 Bacteria 1907
204 Ga0157371_10221032 3300013102 Bacteria 1360
205 Ga0157378_10028274 3300013297 Unclassified 4945
206 Ga0157378_10060104 3300013297 Bacteria 3391
207 Ga0157378_10168304 3300013297 Bacteria 2054
208 Ga0157378_10344343 3300013297 Bacteria 1454
209 Ga0157378_10856738 3300013297 Bacteria 937
210 Ga0163162_10022461 3300013306 Bacteria 6215
211 Ga0163162_10091382 3300013306 Bacteria 3127
212 Ga0163162_10281649 3300013306 Viruses 1795
213 Ga0163162_11139639 3300013306 Bacteria 884
214 Ga0163162_11285531 3300013306 Unclassified 831
215 Ga0157372_10005077 3300013307 Bacteria 13994
216 Ga0157372_10534710 3300013307 Bacteria 1366
217 Ga0157375_10028250 3300013308 Bacteria 5255
218 Ga0157375_10079371 3300013308 Bacteria 3317
219 Ga0157375_11030059 3300013308 Viruses 962
220 Ga0157375_11188447 3300013308 Bacteria 894
221 Ga0163163_10013210 3300014325 Bacteria 7549
222 Ga0163163_10026475 3300014325 Bacteria 5544
223 Ga0163163_12236034 3300014325 Bacteria 606
224 Ga0157380_10003556 3300014326 Bacteria 10715
225 Ga0157380_10007130 3300014326 Bacteria 7920
226 Ga0157380_10086758 3300014326 Bacteria 2572
227 Ga0157380_10361253 3300014326 Bacteria 1363
228 Ga0157380_11475940 3300014326 Bacteria 732
229 Ga0157377_10113070 3300014745 Bacteria 1635
230 Ga0157377_10279164 3300014745 Bacteria 1094
231 Ga0157379_11072361 3300014968 Bacteria 771
232 Ga0163161_10021985 3300017792 Unclassified 4486
233 Ga0207656_10002644 3300025321 Bacteria 6066
234 Ga0207653_10009230 3300025885 Bacteria 3072
235 Ga0207682_10000238 3300025893 Bacteria 24841
236 Ga0207647_10385921 3300025904 Unclassified 790
237 Ga0207645_10028631 3300025907 Unclassified 3596
238 Ga0207645_10077570 3300025907 Bacteria 2129
239 Ga0207643_10008550 3300025908 Bacteria 5490
240 Ga0207643_10090462 3300025908 Viruses 1784
241 Ga0207643_10283226 3300025908 Bacteria 1028
242 Ga0207705_10033610 3300025909 Bacteria 3665
243 Ga0207684_10387619 3300025910 Bacteria 1201
244 Ga0207654_10025603 3300025911 Bacteria 3184
245 Ga0207654_10698653 3300025911 Unclassified 729
246 Ga0207707_10000072 3300025912 Bacteria 102454
247 Ga0207707_10093491 3300025912 Bacteria 2627
248 Ga0207695_10055442 3300025913 Unclassified 4130
249 Ga0207671_10004857 3300025914 Bacteria 12651
250 Ga0207671_10078418 3300025914 Bacteria 2474
251 Ga0207660_10000584 3300025917 Bacteria 24554
252 Ga0207662_10072505 3300025918 Bacteria 2087
253 Ga0207662_10106035 3300025918 Bacteria 1747
254 Ga0207649_10841536 3300025920 Bacteria 717
255 Ga0207652_10000083 3300025921 Bacteria 101957
256 Ga0207646_10149017 3300025922 Unclassified 2109
257 Ga0207681_10006316 3300025923 Bacteria 7274
258 Ga0207681_10818488 3300025923 Viruses 778
259 Ga0207694_10134355 3300025924 Bacteria 1985
260 Ga0207650_10321939 3300025925 Bacteria 1266
261 Ga0207650_10545600 3300025925 Bacteria 972
262 Ga0207659_10296805 3300025926 Bacteria 1326
263 Ga0207706_10000522 3300025933 Bacteria 40810
264 Ga0207706_10041838 3300025933 Unclassified 4061
265 Ga0207706_10224156 3300025933 Bacteria 1646
266 Ga0207686_10083845 3300025934 Bacteria 2087
267 Ga0207709_11116190 3300025935 Bacteria 648
268 Ga0207711_10751697 3300025941 Bacteria 909
269 Ga0207689_10017403 3300025942 Unclassified 6082
270 Ga0207689_10169764 3300025942 Bacteria 1798
271 Ga0207689_10201099 3300025942 Bacteria 1644
272 Ga0207661_10412686 3300025944 Bacteria 1226
273 Ga0207661_10426986 3300025944 Bacteria 1204
274 Ga0207661_10534158 3300025944 Bacteria 1073
275 Ga0207651_10110661 3300025960 Bacteria 2061
276 Ga0207651_10860364 3300025960 Unclassified 806
277 Ga0207712_10057136 3300025961 Bacteria 2752
278 Ga0207640_10126785 3300025981 Bacteria 1839
279 Ga0207640_10252481 3300025981 Bacteria 1370
280 Ga0207640_10267431 3300025981 Bacteria 1336
281 Ga0207640_10452204 3300025981 Bacteria 1059
282 Ga0207640_10572568 3300025981 Bacteria 952
283 Ga0207677_10142222 3300026023 Unclassified 1839
284 Ga0207703_10092434 3300026035 Bacteria 2546
285 Ga0207703_10244163 3300026035 Bacteria 1616
286 Ga0207639_10103057 3300026041 Bacteria 2311
287 Ga0207708_10002293 3300026075 Bacteria 14068
288 Ga0207708_10014151 3300026075 Bacteria 5965
289 Ga0207708_10019170 3300026075 Bacteria 5153
290 Ga0207708_10110629 3300026075 Bacteria 2132
291 Ga0207708_10333679 3300026075 Viruses 1240
292 Ga0207641_10535836 3300026088 Bacteria 1140
293 Ga0207641_10591648 3300026088 Bacteria 1085
294 Ga0207648_10266786 3300026089 Bacteria 1529
295 Ga0207648_10484067 3300026089 Bacteria 1131
296 Ga0207648_10844566 3300026089 Bacteria 854
297 Ga0207648_11440217 3300026089 Unclassified 648
298 Ga0207648_11811456 3300026089 Unclassified 572
299 Ga0207676_10011171 3300026095 Bacteria 6411
300 Ga0207676_10026494 3300026095 Viruses 4312
301 Ga0207676_10049356 3300026095 Bacteria 3273
302 Ga0207676_10262523 3300026095 Bacteria 1560
303 Ga0207676_10880034 3300026095 Bacteria 877
304 Ga0207674_10086626 3300026116 Bacteria 3126
305 Ga0207674_10910139 3300026116 Viruses 848
306 Ga0207675_100010289 3300026118 Bacteria 8763
307 Ga0207675_100046935 3300026118 Bacteria 4034
308 Ga0207675_100218676 3300026118 Bacteria 1835
309 Ga0207675_100734113 3300026118 Viruses 998
310 Ga0207675_101048808 3300026118 Bacteria 834
311 Ga0207698_10184104 3300026142 Bacteria 1853
312 Ga0207698_10657063 3300026142 Bacteria 1039
313 Ga0207428_10025585 3300027907 Bacteria 4939
314 Ga0207428_10059057 3300027907 Bacteria 3041
315 Ga0268265_10007973 3300028380 Bacteria 7149
316 Ga0268265_10354450 3300028380 Bacteria 1341
317 Ga0268265_11397245 3300028380 Bacteria 702
318 Ga0268265_11582051 3300028380 Unclassified 660
319 Ga0268264_10090908 3300028381 Viruses 2632
320 Ga0268264_10659082 3300028381 Bacteria 1036
321 Ga0268264_11048309 3300028381 Unclassified 823
322 Ga0307516_10208117 3300031730 Bacteria 1672
323 Ga0307405_10019269 3300031731 Bacteria 3785
324 Ga0307406_10855253 3300031901 Bacteria 771
325 Ga0307407_10335879 3300031903 Bacteria 1065
326 Ga0307412_10051223 3300031911 Bacteria 2727
327 Ga0307416_100181227 3300032002 Bacteria 1974
328 Ga0307411_10019979 3300032005 Bacteria 3884
329 Ga0307415_100028042 3300032126 Bacteria 3576
330 Ga0307415_100749966 3300032126 Bacteria 886
331 Ga0373959_0000713 3300034820 Bacteria 5683
332 Ga0395899_0119754 3300037312 Unclassified 1887
333 Ga0395898_0085130 3300037466 Bacteria 3047
334 Ga0395898_0985781 3300037466 Unclassified 779
335 Ga0395905_0190520 3300037471 Bacteria 1924
336 Ga0395901_0056632 3300038443 Bacteria 4078
337 Ga0439455_0131963 3300042012 Bacteria 705
338 Ga0453684_1398198 3300044712 Unclassified 726
339 Ga0466957_0206873 3300044842 Bacteria 1291
340 Ga0451576_0521915 3300045051 Bacteria 1248
341 Ga0495639_0381181 3300046475 Bacteria 711
342 Ga0495642_0084216 3300046528 Bacteria 1342
343 Ga0495613_0257028 3300046689 Bacteria 1218
344 Ga0496109_0464111 3300048912 Viruses 1196
345 Ga0496109_0598457 3300048912 Bacteria 1039
346 Ga0501306_014536 3300049127 Viruses 1040
347 Ga0501308_010839 3300049128 Viruses 1019
348 Ga0501308_033616 3300049128 Bacteria 698
349 Ga0501309_007203 3300049129 Bacteria 1374
350 Ga0501309_025811 3300049129 Unclassified 846
351 Ga0501310_001221 3300049130 Bacteria 2306
352 Ga0501310_006704 3300049130 Unclassified 1215
353 Ga0501304_005615 3300049160 Bacteria 988
354 Ga0501305_007429 3300049161 Bacteria 1392
355 Ga0501307_000829 3300049162 Bacteria 2351
356 Ga0501307_010877 3300049162 Viruses 1060
357 Ga0501290_005298 3300049513 Bacteria 1612
358 Ga0501291_002189 3300049514 Bacteria 2319
359 Ga0501292_002347 3300049515 Bacteria 2433
360 Ga0501292_006837 3300049515 Bacteria 1633
361 Ga0501295_052245 3300049518 Viruses 877
362 Ga0501298_001929 3300049521 Bacteria 3094
363 Ga0501299_007771 3300049522 Bacteria 1722
364 Ga0501301_018653 3300049524 Unclassified 648
365 Ga0501303_004042 3300049526 Unclassified 1200
366 Ga0501311_001349 3300049527 Bacteria 2101
367 Ga0501311_009451 3300049527 Viruses 1165
368 Ga0501312_001653 3300049528 Bacteria 2246
369 Ga0501317_005473 3300049533 Bacteria 1362
370 Ga0501318_004049 3300049534 Bacteria 1385
371 Ga0501320_004758 3300049536 Viruses 1209
372 Ga0501320_006885 3300049536 Bacteria 1079
373 Ga0501321_005712 3300049537 Viruses 1240
374 Ga0501323_004507 3300049539 Bacteria 1478
375 Ga0501323_010696 3300049539 Bacteria 1097
376 Ga0501198_002373 3300049649 Bacteria 2532
377 Ga0501198_022149 3300049649 Bacteria 1017
378 Ga0501201_004493 3300049651 Bacteria 1294
379 Ga0501202_002316 3300049652 Bacteria 3188
380 Ga0501207_000807 3300049654 Bacteria 3704
381 Ga0501207_003187 3300049654 Bacteria 2168
382 Ga0501217_000471 3300049661 Bacteria 6612
383 Ga0501217_003208 3300049661 Bacteria 3285
384 Ga0501223_022845 3300049663 Viruses 1221
385 Ga0501224_003402 3300049664 Bacteria 2216
386 Ga0501227_008334 3300049665 Bacteria 2224
387 Ga0501233_001737 3300049668 Bacteria 3754
388 Ga0501235_005061 3300049669 Bacteria 2861
389 Ga0501236_009430 3300049670 Bacteria 1259
390 Ga0501239_006787 3300049672 Viruses 1185
391 Ga0501240_000813 3300049673 Bacteria 2786
392 Ga0501247_000492 3300049677 Bacteria 3155
393 Ga0501249_003116 3300049679 Bacteria 3338
394 Ga0501249_074787 3300049679 Unclassified 793
395 Ga0501251_034397 3300049681 Unclassified 739
396 Ga0501253_001740 3300049683 Bacteria 2299
397 Ga0501253_002059 3300049683 Bacteria 2203
398 Ga0501255_006923 3300049684 Unclassified 1186
399 Ga0501257_000865 3300049686 Bacteria 6085
400 Ga0501257_011139 3300049686 Bacteria 2049
401 Ga0501260_001450 3300049689 Bacteria 1959
402 Ga0501221_027895 3300049704 Bacteria 1158
403 Ga0501225_0002335 3300049705 Bacteria 5851
404 Ga0501225_0013234 3300049705 Bacteria 2312
405 Ga0501229_001892 3300049706 Bacteria 2454
406 Ga0501234_005416 3300049707 Bacteria 1997
407 Ga0501234_055038 3300049707 Unclassified 667
408 Ga0501241_006368 3300049758 Bacteria 2172
409 Ga0501268_002063 3300049765 Bacteria 2598
410 Ga0501268_049488 3300049765 Unclassified 810
411 Ga0501270_005195 3300049767 Bacteria 1502
412 Ga0501273_000762 3300049770 Bacteria 2769
413 Ga0501273_005337 3300049770 Bacteria 1449
414 Ga0501279_015205 3300049775 Bacteria 1064
415 Ga0501283_001161 3300049779 Bacteria 3466
416 Ga0501283_012901 3300049779 Bacteria 1262
417 Ga0501204_003206 3300049850 Bacteria 1708
418 Ga0501212_001283 3300049851 Bacteria 2802
419 Ga0501212_018235 3300049851 Unclassified 1067
420 Ga0501226_001172 3300049853 Bacteria 3399
421 nmdc:mga00v17_28629_c1 3300050491 Bacteria 3264
422 nmdc:mga06z11_100532_c1 3300050494 Bacteria 1586
423 nmdc:mga05p37_1155323_c1 3300050507 Bacteria 805
424 nmdc:mga05p37_125917_c1 3300050507 Unclassified 3146
425 nmdc:mga05p37_16040_c1 3300050507 Bacteria 9015
426 nmdc:mga05p37_166948_c1 3300050507 Bacteria 2686
427 nmdc:mga09592_12167_c1 3300050508 Bacteria 7002
428 nmdc:mga09592_215107_c1 3300050508 Bacteria 1665
429 nmdc:mga09592_436579_c1 3300050508 Bacteria 1130
430 nmdc:mga09592_91186_c1 3300050508 Bacteria 2604
431 nmdc:mga0qj67_23262_c1 3300050509 Bacteria 4765
432 nmdc:mga0qj67_507033_c1 3300050509 Bacteria 970
433 nmdc:mga06r32_113789_c1 3300050510 Bacteria 2664
434 nmdc:mga08y16_1632871_c1 3300050511 Unclassified 602
435 nmdc:mga08y16_1734_c1 3300050511 Bacteria 22134
436 nmdc:mga08y16_35458_c1 3300050511 Bacteria 5238
437 nmdc:mga08y16_466138_c1 3300050511 Bacteria 1287
438 nmdc:mga0n895_1169955_c1 3300050512 Unclassified 744
439 nmdc:mga0n895_87339_c1 3300050512 Bacteria 3116
440 nmdc:mga0rr50_1020194_c1 3300050513 Bacteria 705
441 nmdc:mga0a205_41603_c1 3300050515 Unclassified 4426
442 nmdc:mga0a205_52566_c1 3300050515 Bacteria 3931
443 Ga0500628_000192 3300053129 Bacteria 11866
444 Ga0587093_006613 3300059478 Bacteria 1269
445 Ga0587093_021799 3300059478 Bacteria 863
446 Ga0587077_007494 3300059493 Unclassified 1592
447 Ga0587077_056886 3300059493 Bacteria 836
448 Ga0587085_013355 3300059506 Bacteria 1142
449 Ga0587092_026532 3300059512 Unclassified 932
450 Ga0587092_073673 3300059512 Bacteria 662
451 Ga0587125_002832 3300059607 Bacteria 1427
452 Ga0587101_014903 3300059623 Bacteria 1045
453 Ga0587109_052282 3300059624 Unclassified 840
454 Ga0587117_005761 3300059627 Bacteria 1354
455 Ga0587117_063603 3300059627 Bacteria 639
456 Ga0587062_007415 3300059639 Bacteria 1279
457 Ga0587062_016181 3300059639 Bacteria 1005
458 Ga0587068_009687 3300059641 Bacteria 1423
459 Ga0587068_036107 3300059641 Bacteria 878
460 Ga0587069_002954 3300059642 Bacteria 1786
461 Ga0587076_033281 3300059645 Bacteria 926
462 Ga0587076_055878 3300059645 Bacteria 783
463 Ga0587078_016130 3300059646 Bacteria 907
464 Ga0587079_041110 3300059647 Bacteria 934
465 Ga0587079_050869 3300059647 Bacteria 869
466 Ga0587108_016040 3300059653 Bacteria 679
467 Ga0587060_012791 3300060243 Bacteria 739
468 Ga0587081_01526 3300060246 Unclassified 1333
469 Ga0307408_100190138
470 MRS1b_contig_9387706
471 CNAas_1000839
472 rootL2_10219126
473 Ga0058859_11389759
474 Ga0058863_11418228
475 Ga0058861_10094560
476 Ga0058860_11806974
477 Ga0058862_11746648
478 Ga0065704_10003045
479 Ga0065704_10088223
480 Ga0065715_10100678
481 Ga0065715_10138819
482 Ga0065715_10211202
483 Ga0065715_10320738
484 Ga0065707_10002730
485 Ga0065707_10038470
486 Ga0065707_10113046
487 Ga0070658_10019135
488 Ga0070676_10061669
489 Ga0070676_10067674
490 Ga0070676_10075972
491 Ga0070683_101045849
492 Ga0070690_100101699
493 Ga0070690_100207744
494 Ga0070670_100479433
495 Ga0070670_100568822
496 Ga0070677_10000079
497 Ga0068869_100046249
498 Ga0068869_100642470
499 Ga0070666_10511748
500 Ga0070680_100000437
501 Ga0070680_100299618
502 Ga0070682_100003873
503 Ga0070682_100452424
504 Ga0068868_100233221
505 Ga0068868_100386941
506 Ga0068868_100766384
507 Ga0070689_100248105
508 Ga0070687_100000723
509 Ga0070687_100083582
510 Ga0070687_100397964
511 Ga0070687_100594587
512 Ga0070661_100922126
513 Ga0070661_100969326
514 Ga0070692_10005032
515 Ga0070692_10051537
516 Ga0070692_10082354
517 Ga0070692_10086460
518 Ga0070669_100313453
519 Ga0070675_100313625
520 Ga0070671_100217127
521 Ga0070673_100080603
522 Ga0070673_100349442
523 Ga0070703_10008816
524 Ga0070703_10223202
525 Ga0070701_10096653
526 Ga0070705_100012212
527 Ga0070705_100314882
528 Ga0070700_100000913
529 Ga0070700_100013797
530 Ga0070700_100019146
531 Ga0070700_100257593
532 Ga0070700_100375161
533 Ga0070700_100492397
534 Ga0070694_100001863
535 Ga0070694_100007175
536 Ga0070694_100010258
537 Ga0070694_100014537
538 Ga0070694_100040275
539 Ga0070694_100058119
540 Ga0070708_100506994
541 Ga0070662_100025708
542 Ga0070662_100178424
543 Ga0070681_10000158
544 Ga0070681_10010318
545 Ga0068867_100232020
546 Ga0068867_100335338
547 Ga0068867_101469429
548 Ga0070685_10000405
549 Ga0070706_100211062
550 Ga0070706_101065113
551 Ga0070707_100067922
552 Ga0070698_100028269
553 Ga0070698_100050963
554 Ga0070698_100802352
555 Ga0070679_100000173
556 Ga0070697_100039041
557 Ga0070697_100203094
558 Ga0068853_100006081
559 Ga0068853_101177213
560 Ga0070686_100000004
561 Ga0070686_100010649
562 Ga0070695_100038159
563 Ga0070695_100038948
564 Ga0070695_100122700
565 Ga0070695_100155836
566 Ga0070695_100229163
567 Ga0070696_100031999
568 Ga0070696_100033027
569 Ga0070696_100527338
570 Ga0070696_100682968
571 Ga0070693_100004428
572 Ga0070704_100025493
573 Ga0070704_100046762
574 Ga0070704_100053598
575 Ga0070704_100255592
576 Ga0068857_100164505
577 Ga0068857_100278707
578 Ga0068857_101087359
579 Ga0068854_100330147
580 Ga0068854_100571194
581 Ga0068856_101063236
582 Ga0070702_100066019
583 Ga0068852_100049225
584 Ga0068852_100049641
585 Ga0068859_100021579
586 Ga0068859_100064193
587 Ga0068859_100068603
588 Ga0068859_100096991
589 Ga0068859_100212513
590 Ga0068859_100331013
591 Ga0068864_100029006
592 Ga0068864_100049776
593 Ga0068864_100315949
594 Ga0068864_100401210
595 Ga0068861_100025177
596 Ga0068861_100195726
597 Ga0068861_100645464
598 Ga0068861_100776652
599 Ga0068851_10004808
600 Ga0068870_10028343
601 Ga0068870_10172627
602 Ga0068863_100044247
603 Ga0068863_100563273
604 Ga0068863_100612774
605 Ga0068858_100032748
606 Ga0068858_100226439
607 Ga0068860_100399085
608 Ga0068860_100699754
609 Ga0068860_101233492
610 Ga0068862_100023316
611 Ga0068862_100062670
612 Ga0068862_100712500
613 Ga0068862_100726607
614 Ga0075364_10002050
615 Ga0075367_10007908
616 Ga0075366_10148955
617 Ga0097621_100618836
618 Ga0068871_100016489
619 Ga0075428_100014452
620 Ga0075430_100002299
621 Ga0075431_100011652
622 Ga0075433_10002899
623 Ga0075433_10046680
624 Ga0075434_100160673
625 Ga0075429_100008213
626 Ga0075429_100067193
627 Ga0075429_100401129
628 Ga0068865_100030480
629 Ga0068865_101336950
630 Ga0097620_100021577
631 Ga0097620_100064191
632 Ga0097620_100068602
633 Ga0097620_100096991
634 Ga0097620_100212504
635 Ga0097620_100330993
636 Ga0075435_101500868
637 Ga0105251_10028257
638 Ga0111539_10020974
639 Ga0111539_10031416
640 Ga0111539_10080774
641 Ga0111539_10123206
642 Ga0111539_10655805
643 Ga0105245_11120300
644 Ga0105245_11558700
645 Ga0114129_10007892
646 Ga0114129_10009058
647 Ga0114129_10034310
648 Ga0114129_10166798
649 Ga0105243_10003627
650 Ga0105243_10290682
651 Ga0105243_10352981
652 Ga0105243_10533775
653 Ga0105241_10019067
654 Ga0105241_10090069
655 Ga0105241_10463743
656 Ga0105241_11688350
657 Ga0105242_10148862
658 Ga0105248_10182484
659 Ga0105248_10312925
660 Ga0105248_11791948
661 Ga0105237_10005382
662 Ga0105238_10118925
663 Ga0105238_11568172
664 Ga0105249_10020367
665 Ga0105249_11491492
666 Ga0105239_10012768
667 Ga0105239_10999067
668 Ga0105246_10005033
669 Ga0105246_10363565
670 Ga0105246_10932881
671 Ga0157373_10113127
672 Ga0157371_10221032
673 Ga0157378_10028274
674 Ga0157378_10060104
675 Ga0157378_10168304
676 Ga0157378_10344343
677 Ga0157378_10856738
678 Ga0163162_10022461
679 Ga0163162_10091382
680 Ga0163162_10281649
681 Ga0163162_11139639
682 Ga0163162_11285531
683 Ga0157372_10005077
684 Ga0157372_10534710
685 Ga0157375_10028250
686 Ga0157375_10079371
687 Ga0157375_11030059
688 Ga0157375_11188447
689 Ga0163163_10013210
690 Ga0163163_10026475
691 Ga0163163_12236034
692 Ga0157380_10003556
693 Ga0157380_10007130
694 Ga0157380_10086758
695 Ga0157380_10361253
696 Ga0157380_11475940
697 Ga0157377_10113070
698 Ga0157377_10279164
699 Ga0157379_11072361
700 Ga0163161_10021985
701 Ga0207656_10002644
702 Ga0207653_10009230
703 Ga0207682_10000238
704 Ga0207647_10385921
705 Ga0207645_10028631
706 Ga0207645_10077570
707 Ga0207643_10008550
708 Ga0207643_10090462
709 Ga0207643_10283226
710 Ga0207705_10033610
711 Ga0207684_10387619
712 Ga0207654_10025603
713 Ga0207654_10698653
714 Ga0207707_10000072
715 Ga0207707_10093491
716 Ga0207695_10055442
717 Ga0207671_10004857
718 Ga0207671_10078418
719 Ga0207660_10000584
720 Ga0207662_10072505
721 Ga0207662_10106035
722 Ga0207649_10841536
723 Ga0207652_10000083
724 Ga0207646_10149017
725 Ga0207681_10006316
726 Ga0207681_10818488
727 Ga0207694_10134355
728 Ga0207650_10321939
729 Ga0207650_10545600
730 Ga0207659_10296805
731 Ga0207706_10000522
732 Ga0207706_10041838
733 Ga0207706_10224156
734 Ga0207686_10083845
735 Ga0207709_11116190
736 Ga0207711_10751697
737 Ga0207689_10017403
738 Ga0207689_10169764
739 Ga0207689_10201099
740 Ga0207661_10412686
741 Ga0207661_10426986
742 Ga0207661_10534158
743 Ga0207651_10110661
744 Ga0207651_10860364
745 Ga0207712_10057136
746 Ga0207640_10126785
747 Ga0207640_10252481
748 Ga0207640_10267431
749 Ga0207640_10452204
750 Ga0207640_10572568
751 Ga0207677_10142222
752 Ga0207703_10092434
753 Ga0207703_10244163
754 Ga0207639_10103057
755 Ga0207708_10002293
756 Ga0207708_10014151
757 Ga0207708_10019170
758 Ga0207708_10110629
759 Ga0207708_10333679
760 Ga0207641_10535836
761 Ga0207641_10591648
762 Ga0207648_10266786
763 Ga0207648_10484067
764 Ga0207648_10844566
765 Ga0207648_11440217
766 Ga0207648_11811456
767 Ga0207676_10011171
768 Ga0207676_10026494
769 Ga0207676_10049356
770 Ga0207676_10262523
771 Ga0207676_10880034
772 Ga0207674_10086626
773 Ga0207674_10910139
774 Ga0207675_100010289
775 Ga0207675_100046935
776 Ga0207675_100218676
777 Ga0207675_100734113
778 Ga0207675_101048808
779 Ga0207698_10184104
780 Ga0207698_10657063
781 Ga0207428_10025585
782 Ga0207428_10059057
783 Ga0268265_10007973
784 Ga0268265_10354450
785 Ga0268265_11397245
786 Ga0268265_11582051
787 Ga0268264_10090908
788 Ga0268264_10659082
789 Ga0268264_11048309
790 Ga0307516_10208117
791 Ga0307405_10019269
792 Ga0307406_10855253
793 Ga0307407_10335879
794 Ga0307412_10051223
795 Ga0307416_100181227
796 Ga0307411_10019979
797 Ga0307415_100028042
798 Ga0307415_100749966
799 Ga0373959_0000713
800 Ga0395899_0119754
801 Ga0395898_0085130
802 Ga0395898_0985781
803 Ga0395905_0190520
804 Ga0395901_0056632
805 Ga0439455_0131963
806 Ga0453684_1398198
807 Ga0466957_0206873
808 Ga0451576_0521915
809 Ga0495639_0381181
810 Ga0495642_0084216
811 Ga0495613_0257028
812 Ga0496109_0464111
813 Ga0496109_0598457
814 Ga0501306_014536
815 Ga0501308_010839
816 Ga0501308_033616
817 Ga0501309_007203
818 Ga0501309_025811
819 Ga0501310_001221
820 Ga0501310_006704
821 Ga0501304_005615
822 Ga0501305_007429
823 Ga0501307_000829
824 Ga0501307_010877
825 Ga0501290_005298
826 Ga0501291_002189
827 Ga0501292_002347
828 Ga0501292_006837
829 Ga0501295_052245
830 Ga0501298_001929
831 Ga0501299_007771
832 Ga0501301_018653
833 Ga0501303_004042
834 Ga0501311_001349
835 Ga0501311_009451
836 Ga0501312_001653
837 Ga0501317_005473
838 Ga0501318_004049
839 Ga0501320_004758
840 Ga0501320_006885
841 Ga0501321_005712
842 Ga0501323_004507
843 Ga0501323_010696
844 Ga0501198_002373
845 Ga0501198_022149
846 Ga0501201_004493
847 Ga0501202_002316
848 Ga0501207_000807
849 Ga0501207_003187
850 Ga0501217_000471
851 Ga0501217_003208
852 Ga0501223_022845
853 Ga0501224_003402
854 Ga0501227_008334
855 Ga0501233_001737
856 Ga0501235_005061
857 Ga0501236_009430
858 Ga0501239_006787
859 Ga0501240_000813
860 Ga0501247_000492
861 Ga0501249_003116
862 Ga0501249_074787
863 Ga0501251_034397
864 Ga0501253_001740
865 Ga0501253_002059
866 Ga0501255_006923
867 Ga0501257_000865
868 Ga0501257_011139
869 Ga0501260_001450
870 Ga0501221_027895
871 Ga0501225_0002335
872 Ga0501225_0013234
873 Ga0501229_001892
874 Ga0501234_005416
875 Ga0501234_055038
876 Ga0501241_006368
877 Ga0501268_002063
878 Ga0501268_049488
879 Ga0501270_005195
880 Ga0501273_000762
881 Ga0501273_005337
882 Ga0501279_015205
883 Ga0501283_001161
884 Ga0501283_012901
885 Ga0501204_003206
886 Ga0501212_001283
887 Ga0501212_018235
888 Ga0501226_001172
889 nmdc:mga00v17_28629_c1
890 nmdc:mga06z11_100532_c1
891 nmdc:mga05p37_1155323_c1
892 nmdc:mga05p37_125917_c1
893 nmdc:mga05p37_16040_c1
894 nmdc:mga05p37_166948_c1
895 nmdc:mga09592_12167_c1
896 nmdc:mga09592_215107_c1
897 nmdc:mga09592_436579_c1
898 nmdc:mga09592_91186_c1
899 nmdc:mga0qj67_23262_c1
900 nmdc:mga0qj67_507033_c1
901 nmdc:mga06r32_113789_c1
902 nmdc:mga08y16_1632871_c1
903 nmdc:mga08y16_1734_c1
904 nmdc:mga08y16_35458_c1
905 nmdc:mga08y16_466138_c1
906 nmdc:mga0n895_1169955_c1
907 nmdc:mga0n895_87339_c1
908 nmdc:mga0rr50_1020194_c1
909 nmdc:mga0a205_41603_c1
910 nmdc:mga0a205_52566_c1
911 Ga0500628_000192
912 Ga0587093_006613
913 Ga0587093_021799
914 Ga0587077_007494
915 Ga0587077_056886
916 Ga0587085_013355
917 Ga0587092_026532
918 Ga0587092_073673
919 Ga0587125_002832
920 Ga0587101_014903
921 Ga0587109_052282
922 Ga0587117_005761
923 Ga0587117_063603
924 Ga0587062_007415
925 Ga0587062_016181
926 Ga0587068_009687
927 Ga0587068_036107
928 Ga0587069_002954
929 Ga0587076_033281
930 Ga0587076_055878
931 Ga0587078_016130
932 Ga0587079_041110
933 Ga0587079_050869
934 Ga0587108_016040
935 Ga0587060_012791
936 Ga0587081_01526

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

7

63

0.99

Map