metagRoot

F450010

General Info

Members	Datasets	Scaffolds	Average Seq Length
468	221	467	382

Family's Representative Sequence

Representative Sequence	3300006237\|Ga0097621_100009542\|Ga0097621_1000095425
Length	429
Sequence	MICGLMVFLNKTLTFTPSPKEIVPLSTQVYLIKTKKSMKKVSIKLSALVLILGCFSNVVNGQSSDNKINVVTTAVPFLRISPDARSGGMGDAGVATAPDANAAFWNLAKYPFNTNQGGLSLTYTPWLKDLGLNDVYLISGAGYYKLSEDEAISSSLRYFSLGNIQFTDNFGNDLSSYRPREFAIDAGYSRKLSEKLSLGIALRYINSNLASGTINNVSYKAGTSVAADLTMFHTNLKADGSGLNYGVALTNLGSKISYTSDATQKDYIPAIDESNKITFALDLHKLLVPTPPVASTNPNDSIADAENTANLTEYRTQSVVSSWFTSLSDAPGGFSEEIKEFQLAVGAEYWYNNQFAFRTGYFYENPTKGNRQYFTMGAGLKYNNFGLNFSYLLPSGNGVSRNPLSNTLRFSLFFDFDGKGQGETATPKE

Samples

	Sample ID	Description	Type	Environment
1	2162886011	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
2	2929239360	Chitinophaga sp. R-73072 Hybrid assembly	Isolate	Unclassified
3	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
4	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
5	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
6	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
7	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
8	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
9	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
10	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
11	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
12	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
13	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
14	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
15	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
16	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
17	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
18	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
19	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
20	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
21	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
22	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
23	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
24	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
25	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
26	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
27	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
28	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
29	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
30	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
31	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
32	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
33	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
34	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
35	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
36	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
37	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
38	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
39	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
40	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
41	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
42	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
43	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
44	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
45	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
46	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
47	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
48	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
49	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
50	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
51	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
52	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
53	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
54	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
55	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
56	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
57	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
58	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
59	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
60	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
61	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
62	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
63	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
64	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
65	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
66	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
67	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
68	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
69	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
70	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
71	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
72	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
73	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
74	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
75	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
76	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
77	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
78	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
79	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
80	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
81	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
82	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
83	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
84	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
85	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
86	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
87	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
88	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
89	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
137	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
138	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
139	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
140	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
141	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
142	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
143	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
144	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
145	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
146	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
147	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
148	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
149	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
150	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
151	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
152	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
153	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
154	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
155	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
156	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
157	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
158	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
159	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
160	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
161	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
162	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
163	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
164	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
165	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
166	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
167	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
168	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
169	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
170	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
171	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
172	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
173	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
174	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
175	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
176	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
177	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
178	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
179	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
180	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
181	3300049522	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control	Metagenome	Rhizosphere
182	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
183	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
184	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
185	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
186	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
187	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
188	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
189	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
190	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
191	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
192	3300049653	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control	Metagenome	Rhizosphere
193	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
194	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
195	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
196	3300049664	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought	Metagenome	Rhizosphere
197	3300049668	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought	Metagenome	Rhizosphere
198	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
199	3300049671	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought	Metagenome	Rhizosphere
200	3300049674	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought	Metagenome	Rhizosphere
201	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
202	3300049708	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control	Metagenome	Rhizosphere
203	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
204	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
205	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
206	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
207	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
208	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
209	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
210	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
211	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
212	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
213	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
214	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
215	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
216	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
217	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
218	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
219	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
220	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
221	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.79
Metatranscriptomes	0
Isolates	0.21

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	2.78
Nodule	0
Rhizoplane	0.43
Rhizosphere	93.8
Stem	0
Stem Tuber	0
Unclassified	2.99

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MRS1b_contig_3312306	2162886011	Bacteria	1902
2	rootL2_10026242	3300003322	Bacteria	3886
3	rootL2_10258815	3300003322	Unclassified	1805
4	rootL2_10288036	3300003322	Bacteria	2778
5	rootH1_10016194	3300003323	Bacteria	5376
6	Ga0055531_10000076	3300003794	Bacteria	106998
7	Ga0065714_10098800	3300005288	Unclassified	1702
8	Ga0065704_10092826	3300005289	Bacteria	2632
9	Ga0065712_10090291	3300005290	Bacteria	2427
10	Ga0065707_10090440	3300005295	Bacteria	4105
11	Ga0070658_10004224	3300005327	Bacteria	11752
12	Ga0070658_10010879	3300005327	Bacteria	7295
13	Ga0070658_10018958	3300005327	Bacteria	5512
14	Ga0070658_10073192	3300005327	Bacteria	2810
15	Ga0070658_10088480	3300005327	Bacteria	2550
16	Ga0070658_10219480	3300005327	Unclassified	1607
17	Ga0070676_10007906	3300005328	Bacteria	5715
18	Ga0070676_10053776	3300005328	Unclassified	2373
19	Ga0070683_100002991	3300005329	Bacteria	13561
20	Ga0070690_100001960	3300005330	Bacteria	10951
21	Ga0070690_100083855	3300005330	Bacteria	2088
22	Ga0070670_100157851	3300005331	Unclassified	1965
23	Ga0068869_100033197	3300005334	Bacteria	3642
24	Ga0068869_100051559	3300005334	Bacteria	2985
25	Ga0068869_100090070	3300005334	Bacteria	2305
26	Ga0070666_10000038	3300005335	Bacteria	115799
27	Ga0070666_10047120	3300005335	Unclassified	2893
28	Ga0070680_100027257	3300005336	Bacteria	4575
29	Ga0070680_100174078	3300005336	Bacteria	1812
30	Ga0070682_100000005	3300005337	Bacteria	386439
31	Ga0070682_100009063	3300005337	Bacteria	5625
32	Ga0070682_100009901	3300005337	Bacteria	5398
33	Ga0068868_100013033	3300005338	Bacteria	6086
34	Ga0068868_100029098	3300005338	Bacteria	4230
35	Ga0068868_100098978	3300005338	Bacteria	2358
36	Ga0068868_100204336	3300005338	Bacteria	1648
37	Ga0070660_100005010	3300005339	Bacteria	9158
38	Ga0070660_100069826	3300005339	Bacteria	2740
39	Ga0070660_100159050	3300005339	Unclassified	1819
40	Ga0070660_100281667	3300005339	Bacteria	1360
41	Ga0070661_100123044	3300005344	Bacteria	1944
42	Ga0070668_100033120	3300005347	Bacteria	3933
43	Ga0070668_100108616	3300005347	Bacteria	2207
44	Ga0070669_100197313	3300005353	Bacteria	1582
45	Ga0070675_100059384	3300005354	Bacteria	3155
46	Ga0070671_100166003	3300005355	Bacteria	1867
47	Ga0070674_100012744	3300005356	Bacteria	5173
48	Ga0070673_100007802	3300005364	Bacteria	7085
49	Ga0070673_100038304	3300005364	Bacteria	3660
50	Ga0070673_100045663	3300005364	Unclassified	3398
51	Ga0070673_100177061	3300005364	Bacteria	1824
52	Ga0070688_100089582	3300005365	Bacteria	2008
53	Ga0070659_100017377	3300005366	Bacteria	5411
54	Ga0070659_100026705	3300005366	Bacteria	4445
55	Ga0070659_100051398	3300005366	Bacteria	3240
56	Ga0070667_100001526	3300005367	Bacteria	20725
57	Ga0070667_100050618	3300005367	Bacteria	3502
58	Ga0070667_100074981	3300005367	Unclassified	2887
59	Ga0070667_100078398	3300005367	Bacteria	2822
60	Ga0070678_100017339	3300005456	Bacteria	4634
61	Ga0070662_100016738	3300005457	Bacteria	4928
62	Ga0070662_100240393	3300005457	Bacteria	1452
63	Ga0070681_10033830	3300005458	Bacteria	5131
64	Ga0070681_10054755	3300005458	Bacteria	3975
65	Ga0070681_10137358	3300005458	Unclassified	2375
66	Ga0070681_10167321	3300005458	Bacteria	2121
67	Ga0068867_100014038	3300005459	Bacteria	5675
68	Ga0068867_100043547	3300005459	Bacteria	3286
69	Ga0068867_100216748	3300005459	Bacteria	1540
70	Ga0070698_100002644	3300005471	Bacteria	19745
71	Ga0070698_100003140	3300005471	Bacteria	18206
72	Ga0070698_100025402	3300005471	Bacteria	6174
73	Ga0070679_100001610	3300005530	Bacteria	20288
74	Ga0070679_100005255	3300005530	Bacteria	11986
75	Ga0070679_100046872	3300005530	Bacteria	4309
76	Ga0070684_100000097	3300005535	Bacteria	56477
77	Ga0070684_100145560	3300005535	Bacteria	2144
78	Ga0070684_100310085	3300005535	Bacteria	1449
79	Ga0068853_100017552	3300005539	Bacteria	5906
80	Ga0068853_100083215	3300005539	Bacteria	2804
81	Ga0068853_100100703	3300005539	Unclassified	2554
82	Ga0068853_100132809	3300005539	Bacteria	2229
83	Ga0068853_100167550	3300005539	Unclassified	1986
84	Ga0070672_100047957	3300005543	Bacteria	3317
85	Ga0070665_100091463	3300005548	Bacteria	3048
86	Ga0070665_100104479	3300005548	Bacteria	2835
87	Ga0068855_100062145	3300005563	Bacteria	4361
88	Ga0068855_100216448	3300005563	Bacteria	2150
89	Ga0068855_100237595	3300005563	Bacteria	2037
90	Ga0068855_100240868	3300005563	Bacteria	2021
91	Ga0068855_100304719	3300005563	Bacteria	1764
92	Ga0070664_100001366	3300005564	Bacteria	19444
93	Ga0068857_100003139	3300005577	Bacteria	13677
94	Ga0068857_100004934	3300005577	Bacteria	11326
95	Ga0068857_100175433	3300005577	Unclassified	1950
96	Ga0068854_100013151	3300005578	Bacteria	5425
97	Ga0068854_100116388	3300005578	Bacteria	2023
98	Ga0068854_100161619	3300005578	Bacteria	1735
99	Ga0068856_100021815	3300005614	Bacteria	6223
100	Ga0068856_100149965	3300005614	Bacteria	2340
101	Ga0068856_100258922	3300005614	Bacteria	1755
102	Ga0070702_100078480	3300005615	Unclassified	1971
103	Ga0068852_100009862	3300005616	Bacteria	7106
104	Ga0068852_100014489	3300005616	Bacteria	6072
105	Ga0068852_100056651	3300005616	Unclassified	3388
106	Ga0068852_100059761	3300005616	Bacteria	3307
107	Ga0068859_100000007	3300005617	Bacteria	390070
108	Ga0068859_100003007	3300005617	Bacteria	17097
109	Ga0068859_100056305	3300005617	Bacteria	3956
110	Ga0068859_100085391	3300005617	Bacteria	3202
111	Ga0068859_100352801	3300005617	Unclassified	1566
112	Ga0068859_100353845	3300005617	Bacteria	1563
113	Ga0068864_100008725	3300005618	Bacteria	8360
114	Ga0068864_100015093	3300005618	Bacteria	6422
115	Ga0068864_100024227	3300005618	Bacteria	5104
116	Ga0068861_100017009	3300005719	Bacteria	5157
117	Ga0068863_100011953	3300005841	Bacteria	8389
118	Ga0068863_100125301	3300005841	Bacteria	2450
119	Ga0068863_100176743	3300005841	Bacteria	2049
120	Ga0068860_100004369	3300005843	Bacteria	14436
121	Ga0068860_100006905	3300005843	Bacteria	11383
122	Ga0068860_100019108	3300005843	Bacteria	6654
123	Ga0068860_100151749	3300005843	Bacteria	2231
124	Ga0068862_100012344	3300005844	Bacteria	7062
125	Ga0068862_100341745	3300005844	Bacteria	1386
126	Ga0075366_10006805	3300006195	Bacteria	6285
127	Ga0075366_10026916	3300006195	Unclassified	3371
128	Ga0097621_100000118	3300006237	Bacteria	45384
129	Ga0097621_100002035	3300006237	Bacteria	13843
130	Ga0097621_100009542	3300006237	Bacteria	7050
131	Ga0068871_100008142	3300006358	Bacteria	7529
132	Ga0068871_100112914	3300006358	Bacteria	2287
133	Ga0075428_100015617	3300006844	Bacteria	8415
134	Ga0075428_100158326	3300006844	Bacteria	2459
135	Ga0075430_100122337	3300006846	Bacteria	2169
136	Ga0075431_100013446	3300006847	Bacteria	8267
137	Ga0075431_100027219	3300006847	Bacteria	5865
138	Ga0075434_100141144	3300006871	Bacteria	2429
139	Ga0075429_100070203	3300006880	Bacteria	3050
140	Ga0075429_100236911	3300006880	Bacteria	1598
141	Ga0068865_100073113	3300006881	Unclassified	2437
142	Ga0068865_100083886	3300006881	Bacteria	2295
143	Ga0097620_100000007	3300006931	Bacteria	390070
144	Ga0097620_100003007	3300006931	Bacteria	17097
145	Ga0097620_100056297	3300006931	Bacteria	3956
146	Ga0097620_100085384	3300006931	Bacteria	3202
147	Ga0097620_100352775	3300006931	Unclassified	1566
148	Ga0097620_100353852	3300006931	Bacteria	1563
149	Ga0105240_10009165	3300009093	Bacteria	14040
150	Ga0105240_10017744	3300009093	Bacteria	9580
151	Ga0105240_10037355	3300009093	Bacteria	6243
152	Ga0105240_10051147	3300009093	Bacteria	5203
153	Ga0105240_10138628	3300009093	Bacteria	2911
154	Ga0105240_10266848	3300009093	Unclassified	1973
155	Ga0105240_10516717	3300009093	Unclassified	1326
156	Ga0111539_10029652	3300009094	Bacteria	6660
157	Ga0111539_10204553	3300009094	Bacteria	2301
158	Ga0105247_10000702	3300009101	Bacteria	26164
159	Ga0114129_10005818	3300009147	Bacteria	17462
160	Ga0114129_10018475	3300009147	Bacteria	9930
161	Ga0114129_10199044	3300009147	Bacteria	2714
162	Ga0105241_10000104	3300009174	Bacteria	60482
163	Ga0105241_10007003	3300009174	Bacteria	8295
164	Ga0105241_10060440	3300009174	Unclassified	2915
165	Ga0105241_10090037	3300009174	Bacteria	2419
166	Ga0105248_10013248	3300009177	Bacteria	9079
167	Ga0105237_10002631	3300009545	Bacteria	22095
168	Ga0105237_10014452	3300009545	Bacteria	8254
169	Ga0105237_10032624	3300009545	Bacteria	5273
170	Ga0105237_10237783	3300009545	Bacteria	1823
171	Ga0105238_10018596	3300009551	Bacteria	7075
172	Ga0105238_10021216	3300009551	Bacteria	6620
173	Ga0105238_10090490	3300009551	Bacteria	3047
174	Ga0105249_10001119	3300009553	Bacteria	23864
175	Ga0105249_10003042	3300009553	Bacteria	14469
176	Ga0105249_10012567	3300009553	Bacteria	7463
177	Ga0105249_10190518	3300009553	Unclassified	2001
178	Ga0105249_10258427	3300009553	Unclassified	1729
179	Ga0105239_10006591	3300010375	Bacteria	13447
180	Ga0105239_10023009	3300010375	Bacteria	6870
181	Ga0105239_10202240	3300010375	Unclassified	2225
182	Ga0105239_10246306	3300010375	Bacteria	2007
183	Ga0157373_10006378	3300013100	Bacteria	8812
184	Ga0157373_10011288	3300013100	Bacteria	6569
185	Ga0157373_10042596	3300013100	Bacteria	3244
186	Ga0157371_10000420	3300013102	Bacteria	52349
187	Ga0157371_10006644	3300013102	Bacteria	9476
188	Ga0157371_10058828	3300013102	Unclassified	2726
189	Ga0157371_10123945	3300013102	Bacteria	1838
190	Ga0157370_10004098	3300013104	Bacteria	16897
191	Ga0157370_10028655	3300013104	Bacteria	5475
192	Ga0157370_10032883	3300013104	Bacteria	5061
193	Ga0157369_10014809	3300013105	Bacteria	8800
194	Ga0157369_10192013	3300013105	Bacteria	2145
195	Ga0157374_10000336	3300013296	Bacteria	43367
196	Ga0157374_10004823	3300013296	Bacteria	11320
197	Ga0157374_10042721	3300013296	Bacteria	4183
198	Ga0157374_10129416	3300013296	Bacteria	2442
199	Ga0157378_10003328	3300013297	Bacteria	14295
200	Ga0157378_10031080	3300013297	Bacteria	4716
201	Ga0157378_10049398	3300013297	Bacteria	3742
202	Ga0157378_10079357	3300013297	Bacteria	2963
203	Ga0157378_10084455	3300013297	Bacteria	2875
204	Ga0157378_10145577	3300013297	Bacteria	2203
205	Ga0163162_10000086	3300013306	Bacteria	85949
206	Ga0163162_10000970	3300013306	Bacteria	26653
207	Ga0163162_10025527	3300013306	Bacteria	5839
208	Ga0163162_10027924	3300013306	Bacteria	5582
209	Ga0163162_10113013	3300013306	Bacteria	2814
210	Ga0163162_10141948	3300013306	Bacteria	2515
211	Ga0163162_10156590	3300013306	Unclassified	2398
212	Ga0157372_10017153	3300013307	Bacteria	7773
213	Ga0157372_10052558	3300013307	Unclassified	4537
214	Ga0157372_10090254	3300013307	Unclassified	3483
215	Ga0157372_10107988	3300013307	Unclassified	3185
216	Ga0157372_10162975	3300013307	Bacteria	2577
217	Ga0157372_10332620	3300013307	Bacteria	1769
218	Ga0157375_10000115	3300013308	Bacteria	77964
219	Ga0157375_10071957	3300013308	Bacteria	3472
220	Ga0157375_10165154	3300013308	Bacteria	2358
221	Ga0157375_10329919	3300013308	Bacteria	1691
222	Ga0157380_10123906	3300014326	Bacteria	2193
223	Ga0157380_10186858	3300014326	Bacteria	1826
224	Ga0157377_10002032	3300014745	Bacteria	8867
225	Ga0157377_10030867	3300014745	Bacteria	2907
226	Ga0157377_10044329	3300014745	Unclassified	2480
227	Ga0157379_10036442	3300014968	Bacteria	4386
228	Ga0157376_10000467	3300014969	Bacteria	26068
229	Ga0157376_10032450	3300014969	Bacteria	4193
230	Ga0157376_10144818	3300014969	Bacteria	2136
231	Ga0163161_10018504	3300017792	Bacteria	4881
232	Ga0209257_1000064	3300025304	Bacteria	356803
233	Ga0207682_10023523	3300025893	Bacteria	2434
234	Ga0207710_10091705	3300025900	Bacteria	1422
235	Ga0207680_10000015	3300025903	Bacteria	138253
236	Ga0207647_10007990	3300025904	Bacteria	7606
237	Ga0207647_10042456	3300025904	Bacteria	2853
238	Ga0207645_10012784	3300025907	Bacteria	5687
239	Ga0207705_10011365	3300025909	Bacteria	6447
240	Ga0207705_10017370	3300025909	Bacteria	5153
241	Ga0207705_10174388	3300025909	Bacteria	1620
242	Ga0207654_10019538	3300025911	Bacteria	3577
243	Ga0207654_10034747	3300025911	Unclassified	2803
244	Ga0207654_10131394	3300025911	Bacteria	1585
245	Ga0207707_10055999	3300025912	Bacteria	3429
246	Ga0207707_10079218	3300025912	Bacteria	2869
247	Ga0207707_10170729	3300025912	Unclassified	1900
248	Ga0207695_10004747	3300025913	Bacteria	18391
249	Ga0207695_10005828	3300025913	Bacteria	16206
250	Ga0207695_10013243	3300025913	Bacteria	9841
251	Ga0207695_10041700	3300025913	Bacteria	4911
252	Ga0207695_10125741	3300025913	Bacteria	2526
253	Ga0207671_10007206	3300025914	Bacteria	9688
254	Ga0207671_10018867	3300025914	Bacteria	5286
255	Ga0207671_10029829	3300025914	Unclassified	4072
256	Ga0207671_10038127	3300025914	Bacteria	3562
257	Ga0207671_10101354	3300025914	Bacteria	2181
258	Ga0207660_10012120	3300025917	Bacteria	5635
259	Ga0207660_10116051	3300025917	Unclassified	2022
260	Ga0207657_10011382	3300025919	Bacteria	8836
261	Ga0207657_10028007	3300025919	Bacteria	5149
262	Ga0207657_10031731	3300025919	Bacteria	4781
263	Ga0207657_10061831	3300025919	Bacteria	3208
264	Ga0207652_10000057	3300025921	Bacteria	113664
265	Ga0207652_10000210	3300025921	Bacteria	61797
266	Ga0207652_10010171	3300025921	Bacteria	7573
267	Ga0207652_10031285	3300025921	Bacteria	4469
268	Ga0207652_10046207	3300025921	Bacteria	3714
269	Ga0207652_10050394	3300025921	Bacteria	3567
270	Ga0207694_10026813	3300025924	Bacteria	4387
271	Ga0207694_10062336	3300025924	Bacteria	2903
272	Ga0207650_10045458	3300025925	Bacteria	3230
273	Ga0207650_10049439	3300025925	Unclassified	3105
274	Ga0207690_10041535	3300025932	Bacteria	3015
275	Ga0207690_10050551	3300025932	Unclassified	2776
276	Ga0207706_10006567	3300025933	Bacteria	10770
277	Ga0207706_10017530	3300025933	Bacteria	6454
278	Ga0207706_10061738	3300025933	Unclassified	3300
279	Ga0207706_10102604	3300025933	Bacteria	2516
280	Ga0207686_10023549	3300025934	Unclassified	3558
281	Ga0207670_10006475	3300025936	Bacteria	6499
282	Ga0207669_10026363	3300025937	Bacteria	3160
283	Ga0207704_10174887	3300025938	Bacteria	1544
284	Ga0207704_10277737	3300025938	Unclassified	1272
285	Ga0207691_10022993	3300025940	Bacteria	5871
286	Ga0207689_10000795	3300025942	Bacteria	30379
287	Ga0207689_10003497	3300025942	Bacteria	14356
288	Ga0207689_10008027	3300025942	Bacteria	9211
289	Ga0207689_10010642	3300025942	Bacteria	7917
290	Ga0207661_10002533	3300025944	Bacteria	12572
291	Ga0207661_10038715	3300025944	Bacteria	3739
292	Ga0207661_10215591	3300025944	Bacteria	1694
293	Ga0207679_10001397	3300025945	Bacteria	15216
294	Ga0207679_10225161	3300025945	Bacteria	1580
295	Ga0207667_10008192	3300025949	Bacteria	12438
296	Ga0207667_10013853	3300025949	Bacteria	9211
297	Ga0207667_10016284	3300025949	Bacteria	8401
298	Ga0207667_10049050	3300025949	Bacteria	4462
299	Ga0207651_10022179	3300025960	Unclassified	3876
300	Ga0207712_10001318	3300025961	Bacteria	17023
301	Ga0207712_10036120	3300025961	Bacteria	3363
302	Ga0207712_10079088	3300025961	Bacteria	2388
303	Ga0207668_10012948	3300025972	Bacteria	5124
304	Ga0207668_10016625	3300025972	Bacteria	4595
305	Ga0207640_10056251	3300025981	Unclassified	2581
306	Ga0207640_10126222	3300025981	Bacteria	1842
307	Ga0207640_10151006	3300025981	Bacteria	1707
308	Ga0207640_10253802	3300025981	Unclassified	1366
309	Ga0207658_10013954	3300025986	Bacteria	5499
310	Ga0207658_10042725	3300025986	Unclassified	3290
311	Ga0207658_10045543	3300025986	Bacteria	3198
312	Ga0207658_10111409	3300025986	Bacteria	2164
313	Ga0207658_10160640	3300025986	Bacteria	1841
314	Ga0207658_10235270	3300025986	Bacteria	1548
315	Ga0207677_10002608	3300026023	Bacteria	9484
316	Ga0207677_10020606	3300026023	Bacteria	4007
317	Ga0207703_10029833	3300026035	Unclassified	4305
318	Ga0207703_10053688	3300026035	Bacteria	3276
319	Ga0207639_10150883	3300026041	Unclassified	1946
320	Ga0207639_10171698	3300026041	Unclassified	1837
321	Ga0207639_10209485	3300026041	Bacteria	1677
322	Ga0207678_10005531	3300026067	Bacteria	11289
323	Ga0207708_10018473	3300026075	Bacteria	5251
324	Ga0207702_10039973	3300026078	Bacteria	3932
325	Ga0207641_10000056	3300026088	Bacteria	170719
326	Ga0207641_10008719	3300026088	Bacteria	8377
327	Ga0207641_10027919	3300026088	Unclassified	4662
328	Ga0207648_10038000	3300026089	Bacteria	4237
329	Ga0207648_10056517	3300026089	Unclassified	3425
330	Ga0207648_10083248	3300026089	Bacteria	2791
331	Ga0207648_10108202	3300026089	Bacteria	2440
332	Ga0207648_10263528	3300026089	Bacteria	1538
333	Ga0207676_10008945	3300026095	Bacteria	7126
334	Ga0207676_10010372	3300026095	Bacteria	6634
335	Ga0207676_10028232	3300026095	Bacteria	4190
336	Ga0207676_10037692	3300026095	Bacteria	3686
337	Ga0207674_10001712	3300026116	Bacteria	28070
338	Ga0207674_10004448	3300026116	Bacteria	16847
339	Ga0207674_10028342	3300026116	Bacteria	5912
340	Ga0207675_100002556	3300026118	Bacteria	18017
341	Ga0207675_100019273	3300026118	Bacteria	6364
342	Ga0207683_10024788	3300026121	Bacteria	5168
343	Ga0207698_10002668	3300026142	Bacteria	10608
344	Ga0207698_10008454	3300026142	Bacteria	6515
345	Ga0207698_10010894	3300026142	Bacteria	5871
346	Ga0207698_10036730	3300026142	Unclassified	3600
347	Ga0207698_10073709	3300026142	Bacteria	2720
348	Ga0268266_10000022	3300028379	Bacteria	508060
349	Ga0268266_10318107	3300028379	Bacteria	1456
350	Ga0268265_10150768	3300028380	Bacteria	1961
351	Ga0268264_10001512	3300028381	Bacteria	21658
352	Ga0268264_10003067	3300028381	Bacteria	14469
353	Ga0268264_10032362	3300028381	Bacteria	4290
354	Ga0268264_10047212	3300028381	Unclassified	3580
355	Ga0307517_10069665	3300028786	Bacteria	3182
356	Ga0307515_10000001	3300028794	Bacteria	4259510
357	Ga0307515_10000684	3300028794	Bacteria	78055
358	Ga0307509_10046037	3300031507	Unclassified	4699
359	Ga0307509_10094004	3300031507	Bacteria	3058
360	Ga0307508_10001710	3300031616	Bacteria	24355
361	Ga0307508_10178311	3300031616	Bacteria	1728
362	Ga0316576_10059557	3300031727	Bacteria	2796
363	Ga0307516_10196424	3300031730	Unclassified	1740
364	Ga0307410_10099350	3300031852	Bacteria	2083
365	Ga0373956_0043658	3300035119	Bacteria	1997
366	Ga0373943_0198582	3300035170	Bacteria	1109
367	Ga0373955_0012736	3300035172	Bacteria	4051
368	Ga0316574_0071795	3300035398	Bacteria	2187
369	Ga0373924_0011747	3300035410	Unclassified	3258
370	Ga0373933_0008410	3300035724	Bacteria	5635
371	Ga0373937_0069223	3300036401	Unclassified	3253
372	Ga0395899_0013188	3300037312	Bacteria	6322
373	Ga0395899_0017388	3300037312	Bacteria	5477
374	Ga0395899_0138763	3300037312	Bacteria	1731
375	Ga0395900_0010519	3300037418	Bacteria	9464
376	Ga0395900_0026274	3300037418	Bacteria	5962
377	Ga0395900_0082332	3300037418	Bacteria	3306
378	Ga0395898_0001664	3300037466	Bacteria	29804
379	Ga0395898_0027448	3300037466	Bacteria	5714
380	Ga0395905_0011381	3300037471	Bacteria	8595
381	Ga0395905_0136638	3300037471	Bacteria	2307
382	Ga0395905_0139608	3300037471	Bacteria	2280
383	Ga0395901_0005252	3300038443	Bacteria	13079
384	Ga0439439_0007711	3300041406	Bacteria	2523
385	Ga0439431_0025411	3300041997	Bacteria	1446
386	Ga0439441_002959	3300042001	Bacteria	2449
387	Ga0439449_0017656	3300042007	Bacteria	2679
388	Ga0451577_0002869	3300042876	Bacteria	19808
389	Ga0466972_0020511	3300044658	Bacteria	3302
390	Ga0453684_0029937	3300044712	Bacteria	7709
391	Ga0466960_0044058	3300044901	Bacteria	2126
392	Ga0495638_0116581	3300046460	Bacteria	1582
393	Ga0495653_0102418	3300046463	Bacteria	2072
394	Ga0495618_0034037	3300046514	Unclassified	3194
395	Ga0495630_0072139	3300046517	Bacteria	2599
396	Ga0495648_0005439	3300046524	Bacteria	10573
397	Ga0495587_0032154	3300046536	Unclassified	3174
398	Ga0495622_0068692	3300046557	Bacteria	1637
399	Ga0495668_0000268	3300046616	Bacteria	73486
400	Ga0495634_0227636	3300046642	Bacteria	1148
401	Ga0495625_0026872	3300046660	Bacteria	4341
402	Ga0495613_0239198	3300046689	Bacteria	1270
403	Ga0495672_0048225	3300047320	Bacteria	2527
404	Ga0495687_004292	3300047443	Bacteria	9729
405	Ga0495684_0031357	3300047471	Bacteria	4081
406	Ga0496101_0003876	3300048904	Bacteria	9348
407	Ga0496102_0075872	3300048905	Unclassified	3091
408	Ga0496126_0004187	3300048929	Bacteria	17384
409	Ga0501298_013443	3300049521	Bacteria	1450
410	Ga0501299_006022	3300049522	Bacteria	1889
411	Ga0501032_0025981	3300049569	Bacteria	4033
412	Ga0501033_0045698	3300049570	Bacteria	3258
413	Ga0501033_0047950	3300049570	Bacteria	3175
414	Ga0501033_0107422	3300049570	Unclassified	2033
415	Ga0501034_0000002	3300049571	Bacteria	565510
416	Ga0501034_0006675	3300049571	Bacteria	12375
417	Ga0501034_0013795	3300049571	Bacteria	8315
418	Ga0501036_0002554	3300049572	Bacteria	14316
419	Ga0501036_0223995	3300049572	Bacteria	1579
420	Ga0501037_0024933	3300049573	Bacteria	4420
421	Ga0501038_0025195	3300049574	Bacteria	5303
422	Ga0501039_0042688	3300049575	Unclassified	3503
423	Ga0501043_0010490	3300049579	Bacteria	7255
424	Ga0501043_0013511	3300049579	Bacteria	6389
425	Ga0501047_0007092	3300049581	Bacteria	10523
426	Ga0501047_0033433	3300049581	Bacteria	4964
427	Ga0501047_0343944	3300049581	Unclassified	1329
428	Ga0501070_0007290	3300049586	Bacteria	9390
429	Ga0501070_0190208	3300049586	Unclassified	1687
430	Ga0501206_007663	3300049653	Bacteria	1418
431	Ga0501217_000068	3300049661	Bacteria	12339
432	Ga0501222_011302	3300049662	Bacteria	1178
433	Ga0501223_000404	3300049663	Bacteria	10565
434	Ga0501224_000500	3300049664	Unclassified	4748
435	Ga0501233_002457	3300049668	Bacteria	3270
436	Ga0501235_003100	3300049669	Unclassified	3581
437	Ga0501238_002530	3300049671	Bacteria	2191
438	Ga0501242_000455	3300049674	Unclassified	3568
439	Ga0501225_0001821	3300049705	Bacteria	6680
440	Ga0501245_000166	3300049708	Bacteria	7163
441	Ga0501080_0032729	3300049742	Bacteria	4850
442	Ga0501083_0012545	3300049744	Bacteria	5928
443	Ga0501241_000111	3300049758	Bacteria	17719
444	Ga0501035_0007189	3300049822	Bacteria	10419
445	Ga0501044_0039658	3300049823	Bacteria	4912
446	Ga0501044_0098369	3300049823	Bacteria	2946
447	nmdc:mga0k408_5519_c1	3300050493	Bacteria	6733
448	nmdc:mga05p37_3872_c1	3300050507	Bacteria	17505
449	nmdc:mga05p37_88667_c1	3300050507	Bacteria	3812
450	nmdc:mga09592_10490_c1	3300050508	Bacteria	7540
451	nmdc:mga09592_224264_c1	3300050508	Bacteria	1628
452	nmdc:mga09592_54370_c1	3300050508	Bacteria	3383
453	nmdc:mga0qj67_312251_c1	3300050509	Bacteria	1273
454	nmdc:mga0qj67_5037_c1	3300050509	Bacteria	9603
455	nmdc:mga06r32_121040_c1	3300050510	Bacteria	2582
456	nmdc:mga06r32_528437_c1	3300050510	Bacteria	1155
457	nmdc:mga08y16_21862_c1	3300050511	Bacteria	6750
458	nmdc:mga08y16_289016_c1	3300050511	Bacteria	1690
459	Ga0495619_0159350	3300053085	Bacteria	1558
460	Ga0500646_0026769	3300053090	Bacteria	1565
461	Ga0500562_000025	3300053108	Bacteria	105616
462	Ga0500568_0011758	3300053139	Bacteria	4045
463	Ga0500588_0004478	3300053146	Bacteria	3034
464	Ga0500622_0002705	3300053156	Bacteria	12550
465	Ga0500622_0005868	3300053156	Bacteria	7258
466	Ga0500645_005126	3300053730	Unclassified	4887
467	Ga0500661_003310	3300055283	Bacteria	3030

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300048929	Ga0496126_0004187	Ga0496126_0004187_2571_3701	327
2	3300003322	rootL2_10258815	rootL2_102588151	329
3	3300013307	Ga0157372_10052558	Ga0157372_100525583	332
4	3300025913	Ga0207695_10004747	Ga0207695_1000474718	332
5	3300009093	Ga0105240_10037355	Ga0105240_100373553	333
6	3300025913	Ga0207695_10005828	Ga0207695_100058284	333
7	3300049653	Ga0501206_007663	Ga0501206_007663_391_1407	333
8	3300049662	Ga0501222_011302	Ga0501222_011302_43_1059	333
9	3300003322	rootL2_10026242	rootL2_100262423	336
10	3300005344	Ga0070661_100123044	Ga0070661_1001230442	336
11	3300025904	Ga0207647_10007990	Ga0207647_100079906	336
12	3300025913	Ga0207695_10125741	Ga0207695_101257413	336
13	3300025949	Ga0207667_10016284	Ga0207667_100162844	336
14	3300025981	Ga0207640_10056251	Ga0207640_100562513	336
15	3300026116	Ga0207674_10001712	Ga0207674_1000171210	336
16	3300028786	Ga0307517_10069665	Ga0307517_100696652	336
17	3300031730	Ga0307516_10196424	Ga0307516_101964243	336
18	3300009545	Ga0105237_10014452	Ga0105237_100144523	337
19	3300035170	Ga0373943_0198582	Ga0373943_0198582_40_1062	337
20	3300050510	nmdc:mga06r32_528437_c1	nmdc:mga06r32_528437_c1_38_1057	337
21	3300013306	Ga0163162_10025527	Ga0163162_100255273	339
22	3300014745	Ga0157377_10002032	Ga0157377_100020323	339
23	3300031507	Ga0307509_10046037	Ga0307509_100460372	339
24	3300046642	Ga0495634_0227636	Ga0495634_0227636_59_1087	339
25	3300046689	Ga0495613_0239198	Ga0495613_0239198_212_1240	339
26	3300003322	rootL2_10288036	rootL2_102880361	340
27	3300049572	Ga0501036_0223995	Ga0501036_0223995_76_1119	344
28	3300049758	Ga0501241_000111	Ga0501241_000111_16161_17291	345
29	3300003794	Ga0055531_10000076	Ga0055531_100000762	347
30	3300025304	Ga0209257_1000064	Ga0209257_10000642	347
31	3300047320	Ga0495672_0048225	Ga0495672_0048225_419_1570	347
32	3300005458	Ga0070681_10167321	Ga0070681_101673211	348
33	3300005563	Ga0068855_100240868	Ga0068855_1002408682	348
34	3300025911	Ga0207654_10019538	Ga0207654_100195383	348
35	3300026142	Ga0207698_10073709	Ga0207698_100737093	348
36	3300049671	Ga0501238_002530	Ga0501238_002530_653_1801	349
37	3300005327	Ga0070658_10088480	Ga0070658_100884802	350
38	3300005337	Ga0070682_100009063	Ga0070682_1000090633	350
39	3300005339	Ga0070660_100069826	Ga0070660_1000698262	350
40	3300005367	Ga0070667_100074981	Ga0070667_1000749812	350
41	3300005458	Ga0070681_10054755	Ga0070681_100547552	350
42	3300005530	Ga0070679_100005255	Ga0070679_1000052559	350
43	3300005539	Ga0068853_100083215	Ga0068853_1000832152	350
44	3300005563	Ga0068855_100304719	Ga0068855_1003047191	350
45	3300005578	Ga0068854_100116388	Ga0068854_1001163882	350
46	3300005616	Ga0068852_100009862	Ga0068852_1000098624	350
47	3300005843	Ga0068860_100004369	Ga0068860_10000436913	350
48	3300005844	Ga0068862_100012344	Ga0068862_1000123446	350
49	3300025909	Ga0207705_10011365	Ga0207705_100113656	350
50	3300025919	Ga0207657_10028007	Ga0207657_100280072	350
51	3300025921	Ga0207652_10010171	Ga0207652_100101715	350
52	3300025986	Ga0207658_10160640	Ga0207658_101606402	350
53	3300026041	Ga0207639_10209485	Ga0207639_102094851	350
54	3300026142	Ga0207698_10010894	Ga0207698_100108945	350
55	3300028381	Ga0268264_10047212	Ga0268264_100472124	350
56	3300005336	Ga0070680_100174078	Ga0070680_1001740781	360
57	3300005530	Ga0070679_100046872	Ga0070679_1000468725	360
58	3300005614	Ga0068856_100021815	Ga0068856_1000218151	360
59	3300005616	Ga0068852_100014489	Ga0068852_1000144892	360
60	3300009093	Ga0105240_10017744	Ga0105240_100177448	360
61	3300009174	Ga0105241_10007003	Ga0105241_100070038	360
62	3300009545	Ga0105237_10032624	Ga0105237_100326243	360
63	3300010375	Ga0105239_10023009	Ga0105239_100230092	360
64	3300013100	Ga0157373_10011288	Ga0157373_100112886	360
65	3300013105	Ga0157369_10014809	Ga0157369_100148092	360
66	3300025912	Ga0207707_10079218	Ga0207707_100792183	360
67	3300025913	Ga0207695_10013243	Ga0207695_100132439	360
68	3300025921	Ga0207652_10031285	Ga0207652_100312851	360
69	3300025949	Ga0207667_10008192	Ga0207667_100081929	360
70	3300009553	Ga0105249_10258427	Ga0105249_102584271	361
71	3300044712	Ga0453684_0029937	Ga0453684_0029937_4082_5185	361
72	3300046524	Ga0495648_0005439	Ga0495648_0005439_3128_4288	361
73	3300053139	Ga0500568_0011758	Ga0500568_0011758_1221_2381	361
74	3300053156	Ga0500622_0002705	Ga0500622_0002705_3254_4414	361
75	iso_pu_bacteria	2929239360	2929243583	361
76	3300009553	Ga0105249_10190518	Ga0105249_101905182	362
77	3300013102	Ga0157371_10123945	Ga0157371_101239451	362
78	3300013306	Ga0163162_10113013	Ga0163162_101130134	362
79	3300013307	Ga0157372_10332620	Ga0157372_103326201	362
80	3300028379	Ga0268266_10000022	Ga0268266_10000022417	362
81	3300047443	Ga0495687_004292	Ga0495687_004292_7905_9065	362
82	3300005336	Ga0070680_100027257	Ga0070680_1000272574	363
83	3300005458	Ga0070681_10033830	Ga0070681_100338304	363
84	3300005578	Ga0068854_100161619	Ga0068854_1001616192	363
85	3300005614	Ga0068856_100149965	Ga0068856_1001499651	363
86	3300025912	Ga0207707_10055999	Ga0207707_100559993	363
87	3300025917	Ga0207660_10012120	Ga0207660_100121204	363
88	3300025921	Ga0207652_10000057	Ga0207652_100000574	363
89	3300025949	Ga0207667_10049050	Ga0207667_100490503	363
90	3300025981	Ga0207640_10151006	Ga0207640_101510062	363
91	3300026067	Ga0207678_10005531	Ga0207678_1000553110	363
92	3300026078	Ga0207702_10039973	Ga0207702_100399734	363
93	3300037312	Ga0395899_0013188	Ga0395899_0013188_4474_5640	363
94	3300037418	Ga0395900_0082332	Ga0395900_0082332_288_1454	363
95	3300037466	Ga0395898_0027448	Ga0395898_0027448_4203_5369	363
96	3300037471	Ga0395905_0136638	Ga0395905_0136638_413_1579	363
97	3300005334	Ga0068869_100051559	Ga0068869_1000515592	364
98	3300005337	Ga0070682_100000005	Ga0070682_100000005105	364
99	3300005347	Ga0070668_100033120	Ga0070668_1000331202	364
100	3300005356	Ga0070674_100012744	Ga0070674_1000127441	364
101	3300005459	Ga0068867_100216748	Ga0068867_1002167482	364
102	3300005617	Ga0068859_100353845	Ga0068859_1003538451	364
103	3300005843	Ga0068860_100019108	Ga0068860_1000191085	364
104	3300005844	Ga0068862_100341745	Ga0068862_1003417452	364
105	3300006931	Ga0097620_100353852	Ga0097620_1003538521	364
106	3300025937	Ga0207669_10026363	Ga0207669_100263632	364
107	3300025942	Ga0207689_10010642	Ga0207689_100106425	364
108	3300025972	Ga0207668_10012948	Ga0207668_100129484	364
109	3300026089	Ga0207648_10263528	Ga0207648_102635282	364
110	3300026118	Ga0207675_100019273	Ga0207675_1000192736	364
111	3300028381	Ga0268264_10032362	Ga0268264_100323623	364
112	3300013306	Ga0163162_10027924	Ga0163162_100279245	365
113	3300031852	Ga0307410_10099350	Ga0307410_100993501	365
114	3300005563	Ga0068855_100216448	Ga0068855_1002164481	366
115	3300009093	Ga0105240_10138628	Ga0105240_101386282	366
116	3300013104	Ga0157370_10032883	Ga0157370_100328832	366
117	3300035398	Ga0316574_0071795	Ga0316574_0071795_63_1208	366
118	3300046460	Ga0495638_0116581	Ga0495638_0116581_82_1254	368
119	3300049569	Ga0501032_0025981	Ga0501032_0025981_2040_3212	368
120	3300049571	Ga0501034_0006675	Ga0501034_0006675_5866_7038	368
121	3300049572	Ga0501036_0002554	Ga0501036_0002554_7138_8310	368
122	3300049575	Ga0501039_0042688	Ga0501039_0042688_196_1368	368
123	3300049579	Ga0501043_0010490	Ga0501043_0010490_5338_6510	368
124	3300049581	Ga0501047_0007092	Ga0501047_0007092_7437_8609	368
125	3300049586	Ga0501070_0007290	Ga0501070_0007290_1734_2906	368
126	3300049742	Ga0501080_0032729	Ga0501080_0032729_2831_4003	368
127	3300049744	Ga0501083_0012545	Ga0501083_0012545_4250_5422	368
128	3300049823	Ga0501044_0039658	Ga0501044_0039658_2131_3303	368
129	3300005288	Ga0065714_10098800	Ga0065714_100988001	369
130	3300049570	Ga0501033_0045698	Ga0501033_0045698_1988_3151	369
131	3300049571	Ga0501034_0013795	Ga0501034_0013795_6488_7651	369
132	3300049823	Ga0501044_0098369	Ga0501044_0098369_1121_2284	369
133	3300050509	nmdc:mga0qj67_312251_c1	nmdc:mga0qj67_312251_c1_16_1134	369
134	3300005338	Ga0068868_100204336	Ga0068868_1002043362	370
135	3300006871	Ga0075434_100141144	Ga0075434_1001411443	370
136	3300010375	Ga0105239_10006591	Ga0105239_100065914	370
137	3300013306	Ga0163162_10156590	Ga0163162_101565902	370
138	3300031727	Ga0316576_10059557	Ga0316576_100595572	370
139	3300003323	rootH1_10016194	rootH1_100161944	371
140	3300013100	Ga0157373_10006378	Ga0157373_100063783	371
141	3300013307	Ga0157372_10107988	Ga0157372_101079881	371
142	3300049570	Ga0501033_0107422	Ga0501033_0107422_531_1658	371
143	3300049586	Ga0501070_0190208	Ga0501070_0190208_406_1533	371
144	3300005616	Ga0068852_100059761	Ga0068852_1000597612	372
145	3300010375	Ga0105239_10246306	Ga0105239_102463062	372
146	3300013308	Ga0157375_10165154	Ga0157375_101651542	372
147	3300025914	Ga0207671_10038127	Ga0207671_100381272	372
148	3300053156	Ga0500622_0005868	Ga0500622_0005868_3711_4841	372
149	3300005327	Ga0070658_10004224	Ga0070658_100042244	373
150	3300025938	Ga0207704_10277737	Ga0207704_102777371	373
151	3300026142	Ga0207698_10008454	Ga0207698_100084548	373
152	3300005339	Ga0070660_100281667	Ga0070660_1002816671	374
153	3300005366	Ga0070659_100017377	Ga0070659_1000173772	374
154	3300005577	Ga0068857_100175433	Ga0068857_1001754331	374
155	3300013100	Ga0157373_10042596	Ga0157373_100425962	374
156	3300013307	Ga0157372_10090254	Ga0157372_100902544	374
157	3300025919	Ga0207657_10061831	Ga0207657_100618312	374
158	3300026041	Ga0207639_10171698	Ga0207639_101716981	374
159	3300028794	Ga0307515_10000001	Ga0307515_100000011873	374
160	3300037312	Ga0395899_0017388	Ga0395899_0017388_385_1560	374
161	3300037418	Ga0395900_0010519	Ga0395900_0010519_6366_7541	374
162	3300037466	Ga0395898_0001664	Ga0395898_0001664_8412_9587	374
163	3300038443	Ga0395901_0005252	Ga0395901_0005252_11352_12527	374
164	3300005335	Ga0070666_10047120	Ga0070666_100471201	375
165	3300005617	Ga0068859_100003007	Ga0068859_1000030072	375
166	3300006931	Ga0097620_100003007	Ga0097620_1000030072	375
167	3300046616	Ga0495668_0000268	Ga0495668_0000268_7964_9103	375
168	3300026089	Ga0207648_10083248	Ga0207648_100832482	376
169	3300005330	Ga0070690_100083855	Ga0070690_1000838552	377
170	3300005459	Ga0068867_100043547	Ga0068867_1000435473	377
171	3300005841	Ga0068863_100125301	Ga0068863_1001253011	377
172	3300026088	Ga0207641_10027919	Ga0207641_100279192	377
173	3300026089	Ga0207648_10038000	Ga0207648_100380004	377
174	3300009093	Ga0105240_10516717	Ga0105240_105167171	378
175	3300025913	Ga0207695_10041700	Ga0207695_100417004	378
176	3300005539	Ga0068853_100100703	Ga0068853_1001007032	379
177	3300005614	Ga0068856_100258922	Ga0068856_1002589222	379
178	3300006237	Ga0097621_100009542	Ga0097621_1000095425	379
179	3300009093	Ga0105240_10009165	Ga0105240_100091657	379
180	3300009174	Ga0105241_10060440	Ga0105241_100604402	379
181	3300009551	Ga0105238_10018596	Ga0105238_100185962	379
182	3300013104	Ga0157370_10004098	Ga0157370_1000409818	379
183	3300013297	Ga0157378_10079357	Ga0157378_100793573	379
184	3300025911	Ga0207654_10034747	Ga0207654_100347472	379
185	3300025914	Ga0207671_10029829	Ga0207671_100298292	379
186	3300025924	Ga0207694_10062336	Ga0207694_100623363	379
187	3300031616	Ga0307508_10178311	Ga0307508_101783111	379
188	3300037471	Ga0395905_0011381	Ga0395905_0011381_4668_5849	379
189	3300044658	Ga0466972_0020511	Ga0466972_0020511_1125_2336	379
190	3300049571	Ga0501034_0000002	Ga0501034_0000002_205759_206934	379
191	3300009551	Ga0105238_10021216	Ga0105238_100212162	380
192	3300010375	Ga0105239_10202240	Ga0105239_102022402	380
193	3300037471	Ga0395905_0139608	Ga0395905_0139608_1045_2229	380
194	3300042876	Ga0451577_0002869	Ga0451577_0002869_10924_12090	380
195	3300046557	Ga0495622_0068692	Ga0495622_0068692_198_1388	381
196	3300053090	Ga0500646_0026769	Ga0500646_0026769_158_1348	381
197	3300053108	Ga0500562_000025	Ga0500562_000025_22056_23234	381
198	3300053730	Ga0500645_005126	Ga0500645_005126_3405_4583	381
199	3300005471	Ga0070698_100025402	Ga0070698_1000254026	382
200	3300005719	Ga0068861_100017009	Ga0068861_1000170096	382
201	3300006844	Ga0075428_100015617	Ga0075428_1000156172	382
202	3300006846	Ga0075430_100122337	Ga0075430_1001223372	382
203	3300006847	Ga0075431_100027219	Ga0075431_1000272192	382
204	3300006881	Ga0068865_100073113	Ga0068865_1000731133	382
205	3300013102	Ga0157371_10006644	Ga0157371_100066443	382
206	3300025893	Ga0207682_10023523	Ga0207682_100235232	382
207	3300026089	Ga0207648_10108202	Ga0207648_101082021	382
208	3300026118	Ga0207675_100002556	Ga0207675_1000025569	382
209	3300049521	Ga0501298_013443	Ga0501298_013443_148_1317	382
210	3300049522	Ga0501299_006022	Ga0501299_006022_580_1749	382
211	3300049661	Ga0501217_000068	Ga0501217_000068_2814_3983	382
212	3300049663	Ga0501223_000404	Ga0501223_000404_7347_8516	382
213	3300049664	Ga0501224_000500	Ga0501224_000500_2178_3347	382
214	3300049668	Ga0501233_002457	Ga0501233_002457_1350_2519	382
215	3300049669	Ga0501235_003100	Ga0501235_003100_2063_3232	382
216	3300049674	Ga0501242_000455	Ga0501242_000455_320_1489	382
217	3300049705	Ga0501225_0001821	Ga0501225_0001821_2331_3500	382
218	3300049708	Ga0501245_000166	Ga0501245_000166_3316_4485	382
219	3300050508	nmdc:mga09592_54370_c1	nmdc:mga09592_54370_c1_726_1880	382
220	3300050509	nmdc:mga0qj67_5037_c1	nmdc:mga0qj67_5037_c1_540_1694	382
221	3300050510	nmdc:mga06r32_121040_c1	nmdc:mga06r32_121040_c1_332_1486	382
222	3300005327	Ga0070658_10010879	Ga0070658_100108792	383
223	3300005327	Ga0070658_10073192	Ga0070658_100731922	383
224	3300005327	Ga0070658_10219480	Ga0070658_102194801	383
225	3300005339	Ga0070660_100005010	Ga0070660_10000501011	383
226	3300005339	Ga0070660_100159050	Ga0070660_1001590501	383
227	3300005366	Ga0070659_100051398	Ga0070659_1000513982	383
228	3300005458	Ga0070681_10137358	Ga0070681_101373581	383
229	3300005530	Ga0070679_100001610	Ga0070679_1000016101	383
230	3300005539	Ga0068853_100132809	Ga0068853_1001328092	383
231	3300005563	Ga0068855_100062145	Ga0068855_1000621454	383
232	3300005563	Ga0068855_100237595	Ga0068855_1002375952	383
233	3300005577	Ga0068857_100004934	Ga0068857_1000049343	383
234	3300005616	Ga0068852_100056651	Ga0068852_1000566513	383
235	3300006844	Ga0075428_100158326	Ga0075428_1001583262	383
236	3300009093	Ga0105240_10051147	Ga0105240_100511474	383
237	3300009094	Ga0111539_10029652	Ga0111539_100296522	383
238	3300009147	Ga0114129_10199044	Ga0114129_101990442	383
239	3300009174	Ga0105241_10090037	Ga0105241_100900371	383
240	3300009545	Ga0105237_10237783	Ga0105237_102377831	383
241	3300009551	Ga0105238_10090490	Ga0105238_100904901	383
242	3300013104	Ga0157370_10028655	Ga0157370_100286556	383
243	3300013105	Ga0157369_10192013	Ga0157369_101920133	383
244	3300013307	Ga0157372_10017153	Ga0157372_100171532	383
245	3300025909	Ga0207705_10174388	Ga0207705_101743881	383
246	3300025911	Ga0207654_10131394	Ga0207654_101313941	383
247	3300025912	Ga0207707_10170729	Ga0207707_101707292	383
248	3300025914	Ga0207671_10101354	Ga0207671_101013542	383
249	3300025917	Ga0207660_10116051	Ga0207660_101160512	383
250	3300025919	Ga0207657_10011382	Ga0207657_100113823	383
251	3300025919	Ga0207657_10031731	Ga0207657_100317312	383
252	3300025921	Ga0207652_10000210	Ga0207652_1000021022	383
253	3300025921	Ga0207652_10046207	Ga0207652_100462072	383
254	3300025921	Ga0207652_10050394	Ga0207652_100503942	383
255	3300025924	Ga0207694_10026813	Ga0207694_100268132	383
256	3300025932	Ga0207690_10041535	Ga0207690_100415352	383
257	3300025949	Ga0207667_10013853	Ga0207667_100138536	383
258	3300026075	Ga0207708_10018473	Ga0207708_100184732	383
259	3300026142	Ga0207698_10036730	Ga0207698_100367302	383
260	3300037312	Ga0395899_0138763	Ga0395899_0138763_90_1262	383
261	3300037418	Ga0395900_0026274	Ga0395900_0026274_1012_2184	383
262	3300046660	Ga0495625_0026872	Ga0495625_0026872_381_1556	383
263	3300050511	nmdc:mga08y16_21862_c1	nmdc:mga08y16_21862_c1_3319_4479	383
264	3300050511	nmdc:mga08y16_289016_c1	nmdc:mga08y16_289016_c1_371_1531	383
265	3300055283	Ga0500661_003310	Ga0500661_003310_1490_2674	383
266	3300005327	Ga0070658_10018958	Ga0070658_100189584	384
267	3300005471	Ga0070698_100002644	Ga0070698_10000264417	384
268	3300005617	Ga0068859_100352801	Ga0068859_1003528011	384
269	3300006931	Ga0097620_100352775	Ga0097620_1003527751	384
270	3300013102	Ga0157371_10000420	Ga0157371_1000042014	384
271	3300013297	Ga0157378_10145577	Ga0157378_101455772	384
272	3300013306	Ga0163162_10141948	Ga0163162_101419482	384
273	3300025914	Ga0207671_10007206	Ga0207671_100072065	384
274	3300053146	Ga0500588_0004478	Ga0500588_0004478_972_2150	384
275	3300005295	Ga0065707_10090440	Ga0065707_100904403	385
276	3300005329	Ga0070683_100002991	Ga0070683_1000029917	385
277	3300005365	Ga0070688_100089582	Ga0070688_1000895823	385
278	3300005366	Ga0070659_100026705	Ga0070659_1000267054	385
279	3300005367	Ga0070667_100050618	Ga0070667_1000506182	385
280	3300005457	Ga0070662_100240393	Ga0070662_1002403931	385
281	3300005471	Ga0070698_100003140	Ga0070698_1000031404	385
282	3300005535	Ga0070684_100000097	Ga0070684_10000009721	385
283	3300005539	Ga0068853_100017552	Ga0068853_1000175525	385
284	3300005548	Ga0070665_100091463	Ga0070665_1000914632	385
285	3300005564	Ga0070664_100001366	Ga0070664_10000136614	385
286	3300005577	Ga0068857_100003139	Ga0068857_10000313912	385
287	3300005617	Ga0068859_100056305	Ga0068859_1000563052	385
288	3300005841	Ga0068863_100176743	Ga0068863_1001767432	385
289	3300006195	Ga0075366_10006805	Ga0075366_100068056	385
290	3300006195	Ga0075366_10026916	Ga0075366_100269163	385
291	3300006880	Ga0075429_100236911	Ga0075429_1002369111	385
292	3300006931	Ga0097620_100056297	Ga0097620_1000562972	385
293	3300009553	Ga0105249_10012567	Ga0105249_100125672	385
294	3300013296	Ga0157374_10042721	Ga0157374_100427212	385
295	3300013308	Ga0157375_10071957	Ga0157375_100719573	385
296	3300014745	Ga0157377_10030867	Ga0157377_100308672	385
297	3300025909	Ga0207705_10017370	Ga0207705_100173702	385
298	3300025932	Ga0207690_10050551	Ga0207690_100505512	385
299	3300025933	Ga0207706_10061738	Ga0207706_100617382	385
300	3300025944	Ga0207661_10002533	Ga0207661_100025337	385
301	3300025944	Ga0207661_10215591	Ga0207661_102155911	385
302	3300025945	Ga0207679_10001397	Ga0207679_100013978	385
303	3300025945	Ga0207679_10225161	Ga0207679_102251612	385
304	3300025961	Ga0207712_10036120	Ga0207712_100361205	385
305	3300025986	Ga0207658_10111409	Ga0207658_101114092	385
306	3300026035	Ga0207703_10029833	Ga0207703_100298332	385
307	3300026041	Ga0207639_10150883	Ga0207639_101508831	385
308	3300026116	Ga0207674_10004448	Ga0207674_100044482	385
309	3300041406	Ga0439439_0007711	Ga0439439_0007711_1085_2248	385
310	3300041997	Ga0439431_0025411	Ga0439431_0025411_198_1361	385
311	3300042007	Ga0439449_0017656	Ga0439449_0017656_1277_2440	385
312	3300044901	Ga0466960_0044058	Ga0466960_0044058_699_1880	385
313	3300050493	nmdc:mga0k408_5519_c1	nmdc:mga0k408_5519_c1_4889_6058	385
314	3300050508	nmdc:mga09592_224264_c1	nmdc:mga09592_224264_c1_385_1551	385
315	3300005289	Ga0065704_10092826	Ga0065704_100928261	386
316	3300005364	Ga0070673_100177061	Ga0070673_1001770612	386
317	3300005459	Ga0068867_100014038	Ga0068867_1000140382	386
318	3300005535	Ga0070684_100310085	Ga0070684_1003100851	386
319	3300005539	Ga0068853_100167550	Ga0068853_1001675502	386
320	3300005617	Ga0068859_100085391	Ga0068859_1000853912	386
321	3300005618	Ga0068864_100024227	Ga0068864_1000242275	386
322	3300006237	Ga0097621_100000118	Ga0097621_10000011846	386
323	3300006358	Ga0068871_100008142	Ga0068871_1000081423	386
324	3300006881	Ga0068865_100083886	Ga0068865_1000838863	386
325	3300006931	Ga0097620_100085384	Ga0097620_1000853842	386
326	3300009147	Ga0114129_10005818	Ga0114129_100058188	386
327	3300009177	Ga0105248_10013248	Ga0105248_100132484	386
328	3300013297	Ga0157378_10003328	Ga0157378_100033283	386
329	3300013306	Ga0163162_10000086	Ga0163162_1000008626	386
330	3300013308	Ga0157375_10000115	Ga0157375_1000011552	386
331	3300014326	Ga0157380_10186858	Ga0157380_101868581	386
332	3300014969	Ga0157376_10000467	Ga0157376_1000046718	386
333	3300017792	Ga0163161_10018504	Ga0163161_100185043	386
334	3300025925	Ga0207650_10049439	Ga0207650_100494393	386
335	3300025938	Ga0207704_10174887	Ga0207704_101748872	386
336	3300025986	Ga0207658_10013954	Ga0207658_100139545	386
337	3300026035	Ga0207703_10053688	Ga0207703_100536881	386
338	3300026089	Ga0207648_10056517	Ga0207648_100565172	386
339	3300026095	Ga0207676_10037692	Ga0207676_100376922	386
340	3300031616	Ga0307508_10001710	Ga0307508_1000171025	386
341	3300042001	Ga0439441_002959	Ga0439441_002959_1252_2421	386
342	3300048904	Ga0496101_0003876	Ga0496101_0003876_436_1608	386
343	3300048905	Ga0496102_0075872	Ga0496102_0075872_1200_2372	386
344	3300050507	nmdc:mga05p37_3872_c1	nmdc:mga05p37_3872_c1_8728_9894	386
345	3300050508	nmdc:mga09592_10490_c1	nmdc:mga09592_10490_c1_359_1528	386
346	3300005328	Ga0070676_10007906	Ga0070676_100079062	387
347	3300005328	Ga0070676_10053776	Ga0070676_100537761	387
348	3300005330	Ga0070690_100001960	Ga0070690_1000019604	387
349	3300005334	Ga0068869_100090070	Ga0068869_1000900702	387
350	3300005338	Ga0068868_100013033	Ga0068868_1000130333	387
351	3300005338	Ga0068868_100098978	Ga0068868_1000989782	387
352	3300005353	Ga0070669_100197313	Ga0070669_1001973131	387
353	3300005355	Ga0070671_100166003	Ga0070671_1001660032	387
354	3300005364	Ga0070673_100007802	Ga0070673_1000078024	387
355	3300005364	Ga0070673_100045663	Ga0070673_1000456632	387
356	3300005367	Ga0070667_100078398	Ga0070667_1000783982	387
357	3300005456	Ga0070678_100017339	Ga0070678_1000173392	387
358	3300005457	Ga0070662_100016738	Ga0070662_1000167382	387
359	3300005535	Ga0070684_100145560	Ga0070684_1001455601	387
360	3300005548	Ga0070665_100104479	Ga0070665_1001044792	387
361	3300005578	Ga0068854_100013151	Ga0068854_1000131512	387
362	3300005615	Ga0070702_100078480	Ga0070702_1000784802	387
363	3300005618	Ga0068864_100008725	Ga0068864_1000087255	387
364	3300009093	Ga0105240_10266848	Ga0105240_102668481	387
365	3300009094	Ga0111539_10204553	Ga0111539_102045532	387
366	3300009553	Ga0105249_10003042	Ga0105249_1000304211	387
367	3300013102	Ga0157371_10058828	Ga0157371_100588282	387
368	3300013296	Ga0157374_10000336	Ga0157374_100003364	387
369	3300013296	Ga0157374_10004823	Ga0157374_100048235	387
370	3300013307	Ga0157372_10162975	Ga0157372_101629752	387
371	3300013308	Ga0157375_10329919	Ga0157375_103299192	387
372	3300014326	Ga0157380_10123906	Ga0157380_101239063	387
373	3300014745	Ga0157377_10044329	Ga0157377_100443292	387
374	3300014968	Ga0157379_10036442	Ga0157379_100364425	387
375	3300014969	Ga0157376_10032450	Ga0157376_100324502	387
376	3300025904	Ga0207647_10042456	Ga0207647_100424563	387
377	3300025907	Ga0207645_10012784	Ga0207645_100127842	387
378	3300025933	Ga0207706_10006567	Ga0207706_100065674	387
379	3300025933	Ga0207706_10017530	Ga0207706_100175302	387
380	3300025933	Ga0207706_10102604	Ga0207706_101026042	387
381	3300025934	Ga0207686_10023549	Ga0207686_100235493	387
382	3300025936	Ga0207670_10006475	Ga0207670_100064755	387
383	3300025942	Ga0207689_10003497	Ga0207689_100034978	387
384	3300025942	Ga0207689_10008027	Ga0207689_100080278	387
385	3300025944	Ga0207661_10038715	Ga0207661_100387152	387
386	3300025960	Ga0207651_10022179	Ga0207651_100221792	387
387	3300025961	Ga0207712_10001318	Ga0207712_100013188	387
388	3300025981	Ga0207640_10126222	Ga0207640_101262222	387
389	3300025981	Ga0207640_10253802	Ga0207640_102538022	387
390	3300025986	Ga0207658_10042725	Ga0207658_100427254	387
391	3300026023	Ga0207677_10020606	Ga0207677_100206062	387
392	3300026095	Ga0207676_10008945	Ga0207676_100089458	387
393	3300026116	Ga0207674_10028342	Ga0207674_100283425	387
394	3300026121	Ga0207683_10024788	Ga0207683_100247882	387
395	3300028379	Ga0268266_10318107	Ga0268266_103181071	387
396	3300028380	Ga0268265_10150768	Ga0268265_101507682	387
397	3300028794	Ga0307515_10000684	Ga0307515_1000068469	388
398	3300035119	Ga0373956_0043658	Ga0373956_0043658_443_1621	388
399	3300035172	Ga0373955_0012736	Ga0373955_0012736_2598_3776	388
400	3300035410	Ga0373924_0011747	Ga0373924_0011747_478_1656	388
401	3300035724	Ga0373933_0008410	Ga0373933_0008410_3952_5130	388
402	3300036401	Ga0373937_0069223	Ga0373937_0069223_1738_2916	388
403	3300046463	Ga0495653_0102418	Ga0495653_0102418_653_1831	388
404	3300046514	Ga0495618_0034037	Ga0495618_0034037_1431_2609	388
405	3300046517	Ga0495630_0072139	Ga0495630_0072139_35_1213	388
406	3300046536	Ga0495587_0032154	Ga0495587_0032154_1101_2279	388
407	3300047471	Ga0495684_0031357	Ga0495684_0031357_97_1275	388
408	3300053085	Ga0495619_0159350	Ga0495619_0159350_280_1458	388
409	3300005331	Ga0070670_100157851	Ga0070670_1001578512	390
410	3300005334	Ga0068869_100033197	Ga0068869_1000331972	390
411	3300005335	Ga0070666_10000038	Ga0070666_1000003832	390
412	3300005338	Ga0068868_100029098	Ga0068868_1000290982	390
413	3300005347	Ga0070668_100108616	Ga0070668_1001086162	390
414	3300005364	Ga0070673_100038304	Ga0070673_1000383043	390
415	3300005367	Ga0070667_100001526	Ga0070667_1000015268	390
416	3300005543	Ga0070672_100047957	Ga0070672_1000479575	390
417	3300005617	Ga0068859_100000007	Ga0068859_10000000734	390
418	3300005618	Ga0068864_100015093	Ga0068864_1000150933	390
419	3300005841	Ga0068863_100011953	Ga0068863_1000119534	390
420	3300005843	Ga0068860_100006905	Ga0068860_1000069052	390
421	3300005843	Ga0068860_100151749	Ga0068860_1001517492	390
422	3300006237	Ga0097621_100002035	Ga0097621_1000020352	390
423	3300006358	Ga0068871_100112914	Ga0068871_1001129141	390
424	3300006931	Ga0097620_100000007	Ga0097620_10000000735	390
425	3300009101	Ga0105247_10000702	Ga0105247_100007025	390
426	3300009174	Ga0105241_10000104	Ga0105241_100001042	390
427	3300009545	Ga0105237_10002631	Ga0105237_100026316	390
428	3300009553	Ga0105249_10001119	Ga0105249_1000111912	390
429	3300013296	Ga0157374_10129416	Ga0157374_101294161	390
430	3300013297	Ga0157378_10031080	Ga0157378_100310803	390
431	3300013297	Ga0157378_10049398	Ga0157378_100493983	390
432	3300013297	Ga0157378_10084455	Ga0157378_100844552	390
433	3300013306	Ga0163162_10000970	Ga0163162_1000097011	390
434	3300014969	Ga0157376_10144818	Ga0157376_101448181	390
435	3300025900	Ga0207710_10091705	Ga0207710_100917051	390
436	3300025903	Ga0207680_10000015	Ga0207680_1000001534	390
437	3300025914	Ga0207671_10018867	Ga0207671_100188676	390
438	3300025925	Ga0207650_10045458	Ga0207650_100454584	390
439	3300025940	Ga0207691_10022993	Ga0207691_100229936	390
440	3300025942	Ga0207689_10000795	Ga0207689_1000079528	390
441	3300025961	Ga0207712_10079088	Ga0207712_100790883	390
442	3300025972	Ga0207668_10016625	Ga0207668_100166255	390
443	3300025986	Ga0207658_10045543	Ga0207658_100455435	390
444	3300025986	Ga0207658_10235270	Ga0207658_102352702	390
445	3300026023	Ga0207677_10002608	Ga0207677_100026082	390
446	3300026088	Ga0207641_10000056	Ga0207641_1000005633	390
447	3300026088	Ga0207641_10008719	Ga0207641_100087193	390
448	3300026095	Ga0207676_10010372	Ga0207676_100103723	390
449	3300026095	Ga0207676_10028232	Ga0207676_100282321	390
450	3300026142	Ga0207698_10002668	Ga0207698_100026682	390
451	3300028381	Ga0268264_10001512	Ga0268264_100015122	390
452	3300028381	Ga0268264_10003067	Ga0268264_100030672	390
453	3300031507	Ga0307509_10094004	Ga0307509_100940041	390
454	3300049570	Ga0501033_0047950	Ga0501033_0047950_1948_3135	392
455	3300049573	Ga0501037_0024933	Ga0501037_0024933_2382_3569	392
456	3300049574	Ga0501038_0025195	Ga0501038_0025195_2076_3263	392
457	3300049579	Ga0501043_0013511	Ga0501043_0013511_1993_3180	392
458	3300049581	Ga0501047_0033433	Ga0501047_0033433_1208_2395	392
459	3300049581	Ga0501047_0343944	Ga0501047_0343944_17_1204	392
460	3300049822	Ga0501035_0007189	Ga0501035_0007189_2375_3562	392
461	3300005337	Ga0070682_100009901	Ga0070682_1000099014	393
462	2162886011	MRS1b_contig_3312306	MRS1b_0656.00002600	400
463	3300005290	Ga0065712_10090291	Ga0065712_100902912	400
464	3300005354	Ga0070675_100059384	Ga0070675_1000593842	400
465	3300006847	Ga0075431_100013446	Ga0075431_1000134463	400
466	3300006880	Ga0075429_100070203	Ga0075429_1000702031	400
467	3300009147	Ga0114129_10018475	Ga0114129_100184759	400
468	3300050507	nmdc:mga05p37_88667_c1	nmdc:mga05p37_88667_c1_2060_3265	400

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19572

PorV

Type IX secretion system protein PorV

62

293

0.92 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6h3i-assembly1.cif.gz_F	structural snapshots of the type 9 protein translocon	0.8909	31	391
6h3i-assembly1.cif.gz_F	structural snapshots of the type 9 protein translocon	0.8809	31	391
2wvp-assembly1.cif.gz_A	synthetically modified ompg	0.6898	79	382
2wvp-assembly1.cif.gz_A	synthetically modified ompg	0.6623	79	382
4fqe-assembly1.cif.gz_A	kdgm porin	0.6473	80	384

ID	Description	Score	Start	End	Superfamily
2wvpA00	Mainly Beta;Beta Barrel;Porin;monomeric porin ompg	0.6898	79	382	2.40.160.40
2wvpA00	Mainly Beta;Beta Barrel;Porin;monomeric porin ompg	0.6623	79	382	2.40.160.40
af_Q5AMP9_96_290_3.90.1150.210	Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;F-actin capping protein, beta subunit	0.6595	114	202	3.90.1150.210
4fqeA00	Mainly Beta;Beta Barrel;Porin;monomeric porin ompg	0.6473	80	384	2.40.160.40
4fqeA00	Mainly Beta;Beta Barrel;Porin;monomeric porin ompg	0.6375	80	384	2.40.160.40

ID	Description	Score	Start	End	GO Terms
AF-A0A2M7NZR3-F1-model_v4	Type IX secretion system protein PorV domain-containing protein	0.9181	31	384	GO:0016020
AF-A0A3D2P5M1-F1-model_v4	PorV/PorQ family protein	0.9104	61	384
AF-A0A1Q6FZ02-F1-model_v4	Outer membrane protein beta-barrel domain-containing protein	0.9085	55	384
AF-A0A2G6BUP0-F1-model_v4	PorV/PorQ family protein	0.901	40	384
AF-A0A3D5H915-F1-model_v4	PorV/PorQ family protein	0.898	39	217

Feature Viewer

pLDDT	pTM	Quality
80.52	0.81	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F450010

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF19572

PorV

Type IX secretion system protein PorV

62

293

0.92

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map