F449969

General Info

Members Datasets Scaffolds Average Seq Length
468 349 418 203

Family's Representative Sequence

Representative Sequence 3300005333|Ga0070677_10137594|Ga0070677_101375942
Length 221
Sequence MSTIISDVIDHLAGIQPGSSLDRLRDQRPQARENAQKSYLALFEPEFPGHVTAIERYAVATFVAGLHRQPNVTEFYAASLERLGHPRLTDAIRGEIARGSVEGPYGRYPQGPLTVEDREGSVYQVSTDNRERLGSRLAAALEHAHLLVFHPRDASPAALQRLLDAGWSTTDIVTLSQLVAFLSFQIRVVAGLRVLVGASSRASADADQTQIFTGVLASGAV

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
4 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
5 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
6 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
7 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
8 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
9 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
10 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
11 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
12 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
13 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
14 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
15 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
16 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
17 2643221629 Devosia sp. Root105 Isolate Unclassified
18 2643221649 Leifsonia sp. Root4 Isolate Unclassified
19 2643221662 Devosia sp. Root413D1 Isolate Unclassified
20 2738541277 Variovorax sp. GV051 Isolate Unclassified
21 2738541293 Rhizobium sp. GV031 Isolate Unclassified
22 2738541307 Variovorax sp. GV008 Isolate Unclassified
23 2738543013 Variovorax sp. BT01 Isolate Unclassified
24 2738543019 Variovorax sp. GV040 Isolate Unclassified
25 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
26 2773857925 Microvirga vignae BR3299 Isolate Unclassified
27 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
28 2818991446 Variovorax sp. 1180 Isolate Unclassified
29 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
30 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
31 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
32 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
33 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
34 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
35 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
36 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
37 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
38 2899924645 Variovorax sp. 369 Isolate Unclassified
39 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
40 2928037797 Variovorax sp. 1126 Isolate Unclassified
41 2928044640 Variovorax sp. 1128 Isolate Unclassified
42 2928051484 Variovorax sp. 1133 Isolate Unclassified
43 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
44 2928070936 Variovorax gossypii 1167 Isolate Unclassified
45 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
46 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
47 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
48 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
49 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
50 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
51 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
52 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
53 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
54 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
55 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
56 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
57 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
58 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
59 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
60 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
61 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
62 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
63 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
64 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
65 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
66 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
67 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
68 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
69 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
70 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
71 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
72 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
73 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
74 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
75 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
76 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
77 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
78 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
79 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
80 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
81 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
82 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
83 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
84 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
85 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
86 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
98 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
99 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
100 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
101 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
132 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
133 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
134 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
137 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
139 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
141 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
142 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
152 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
179 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
180 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
181 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
191 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
192 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
196 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
215 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
216 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
217 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
222 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
227 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
228 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
231 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
235 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
236 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
237 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
238 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
239 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
240 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
241 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
242 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
245 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
246 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
249 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
250 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
253 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
254 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
255 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
256 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
259 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
260 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
261 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
262 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
263 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
264 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
269 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
270 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
271 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
272 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
273 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
281 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
282 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
283 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
284 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
285 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
286 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
287 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
288 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
289 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
298 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
299 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
300 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
301 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
302 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
303 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
304 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
308 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
309 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
310 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
311 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
312 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
313 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
314 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
315 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
316 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
317 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
318 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
319 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
320 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
321 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
322 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
323 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
324 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
325 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
326 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
327 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
328 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
329 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
330 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
331 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
332 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
333 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
334 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
335 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
336 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
337 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
338 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
339 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
340 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
341 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
342 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
343 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
344 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
345 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
346 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
347 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
348 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
349 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.32
Metatranscriptomes 0
Isolates 10.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.57
Nodule 3.42
Rhizoplane 2.14
Rhizosphere 52.99
Stem 0
Stem Tuber 0
Unclassified 16.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10037958 3300001979 Bacteria 1482
2 JGI25162J39368_1000440 3300002737 Bacteria 33441
3 JGI25158J39367_1014613 3300002739 Bacteria 1012
4 JGI25152J39213_1000351 3300002773 Bacteria 28906
5 JGI25152J39213_1013240 3300002773 Bacteria 1728
6 JGI25150J39212_1000026 3300002774 Bacteria 107804
7 JGI25150J39212_1000292 3300002774 Bacteria 25686
8 JGI25159J45721_1000047 3300002987 Bacteria 59191
9 JGI25151J46595_10000053 3300003187 Bacteria 156841
10 JGI25151J46595_10000674 3300003187 Bacteria 28906
11 JGI25165J46597_1000494 3300003214 Bacteria 38065
12 JGI25153J46596_10000402 3300003215 Bacteria 28906
13 JGI25153J46596_10003066 3300003215 Bacteria 9437
14 rootH2_10099260 3300003320 Bacteria 2412
15 rootH2_10199587 3300003320 Bacteria 1020
16 rootL2_10027034 3300003322 Bacteria 1703
17 rootL2_10058394 3300003322 Bacteria 3152
18 rootH1_10285170 3300003323 Bacteria 2310
19 JGI25160J50197_1000125 3300003354 Bacteria 69558
20 JGI25161J50226_1000147 3300003374 Bacteria 48979
21 Ga0055535_1000696 3300003761 Bacteria 25939
22 Ga0055542_1000027 3300003762 Bacteria 254819
23 Ga0055526_1000153 3300003771 Bacteria 61300
24 Ga0055537_1000082 3300003773 Bacteria 69558
25 Ga0055524_1000548 3300003775 Bacteria 28368
26 Ga0055536_1002460 3300003781 Bacteria 10399
27 Ga0055536_1037850 3300003781 Bacteria 1176
28 Ga0055534_1000133 3300003784 Bacteria 55735
29 Ga0055534_1000301 3300003784 Bacteria 33108
30 Ga0055528_1000558 3300003790 Bacteria 28344
31 Ga0055528_1063204 3300003790 Bacteria 692
32 Ga0055540_1001156 3300003792 Bacteria 16424
33 Ga0055531_10014804 3300003794 Bacteria 3488
34 Ga0055543_1000182 3300004625 Bacteria 51755
35 Ga0065165_1000516 3300005262 Bacteria 59296
36 Ga0070658_10091699 3300005327 Bacteria 2504
37 Ga0070677_10137594 3300005333 Bacteria 1122
38 Ga0070689_100225556 3300005340 Bacteria 1539
39 Ga0070668_100366893 3300005347 Bacteria 1222
40 Ga0070709_10044414 3300005434 Plasmid 2751
41 Ga0070709_10100532 3300005434 Bacteria 1926
42 Ga0070714_100022721 3300005435 Bacteria 5145
43 Ga0070714_100177680 3300005435 Bacteria 1935
44 Ga0070714_100186467 3300005435 Bacteria 1890
45 Ga0070714_100366735 3300005435 Bacteria 1355
46 Ga0070713_100067713 3300005436 Plasmid 3007
47 Ga0070710_10013396 3300005437 Bacteria 4107
48 Ga0070710_10144316 3300005437 Bacteria 1462
49 Ga0070711_100064075 3300005439 Bacteria 2567
50 Ga0070711_100177671 3300005439 Bacteria 1628
51 Ga0070681_10225650 3300005458 Bacteria 1788
52 Ga0070706_100012800 3300005467 Bacteria 7764
53 Ga0070679_100120192 3300005530 Bacteria 2612
54 Ga0068853_100019486 3300005539 Bacteria 5625
55 Ga0070672_100026919 3300005543 Bacteria 4286
56 Ga0070665_100729701 3300005548 Bacteria 1004
57 Ga0068856_100197392 3300005614 Bacteria 2026
58 Ga0068856_100233159 3300005614 Bacteria 1856
59 Ga0068856_100302645 3300005614 Bacteria 1617
60 Ga0068859_100266755 3300005617 Bacteria 1804
61 Ga0068851_10019255 3300005834 Bacteria 3297
62 Ga0068863_100340599 3300005841 Bacteria 1459
63 Ga0068858_100785941 3300005842 Bacteria 928
64 Ga0081455_10408065 3300005937 Bacteria 941
65 Ga0070717_10012817 3300006028 Bacteria 6401
66 Ga0070717_10209618 3300006028 Bacteria 1710
67 Ga0075368_10100278 3300006042 Bacteria 1189
68 Ga0075363_100179480 3300006048 Bacteria 1204
69 Ga0075364_10142626 3300006051 Bacteria 1612
70 Ga0075364_10304563 3300006051 Bacteria 1085
71 Ga0070715_10074065 3300006163 Bacteria 1529
72 Ga0070715_10079850 3300006163 Bacteria 1482
73 Ga0070712_100016011 3300006175 Bacteria 4836
74 Ga0075362_10108643 3300006177 Bacteria 1304
75 Ga0075369_10250715 3300006186 Bacteria 822
76 Ga0075366_10000792 3300006195 Bacteria 15136
77 Ga0075428_100151670 3300006844 Bacteria 2518
78 Ga0075430_100103215 3300006846 Bacteria 2380
79 Ga0075431_100196111 3300006847 Bacteria 2067
80 Ga0075429_100009302 3300006880 Bacteria 8529
81 Ga0075429_100237670 3300006880 Bacteria 1596
82 Ga0075436_100856397 3300006914 Bacteria 679
83 Ga0097620_100266769 3300006931 Bacteria 1804
84 Ga0105244_10090231 3300009036 Bacteria 1508
85 Ga0105240_10004352 3300009093 Bacteria 21620
86 Ga0105240_10109201 3300009093 Bacteria 3351
87 Ga0111539_11030389 3300009094 Bacteria 957
88 Ga0114129_10424940 3300009147 Bacteria 1747
89 Ga0105243_10001557 3300009148 Bacteria 20059
90 Ga0105243_10684761 3300009148 Bacteria 997
91 Ga0105033_109710 3300009986 Bacteria 844
92 Ga0105239_10318703 3300010375 Bacteria 1753
93 Ga0105239_10541977 3300010375 Bacteria 1325
94 Ga0105246_10266341 3300011119 Bacteria 1367
95 Ga0105246_10440126 3300011119 Bacteria 1093
96 Ga0157371_10103963 3300013102 Bacteria 2015
97 Ga0157370_10005682 3300013104 Bacteria 13941
98 Ga0157370_10384862 3300013104 Bacteria 1292
99 Ga0157369_10548529 3300013105 Bacteria 1195
100 Ga0157374_10377291 3300013296 Bacteria 1412
101 Ga0157378_10914522 3300013297 Bacteria 909
102 Ga0157375_10266274 3300013308 Bacteria 1875
103 Ga0163163_10138347 3300014325 Bacteria 2477
104 Ga0157380_10034141 3300014326 Bacteria 3922
105 Ga0157380_10353624 3300014326 Bacteria 1376
106 Ga0182008_10085841 3300014497 Bacteria 1550
107 Ga0157379_10322138 3300014968 Bacteria 1411
108 Ga0163161_10028844 3300017792 Bacteria 3943
109 Ga0163161_10301653 3300017792 Bacteria 1262
110 Ga0213874_10022673 3300021377 Bacteria 1745
111 Ga0213874_10073820 3300021377 Bacteria 1093
112 Ga0213875_10000421 3300021388 Bacteria 37100
113 Ga0209436_103609 3300025208 Bacteria 4040
114 Ga0209672_101497 3300025228 Bacteria 8163
115 Ga0209147_102265 3300025229 Bacteria 5062
116 Ga0209437_100064 3300025233 Bacteria 334360
117 Ga0209258_100048 3300025242 Bacteria 365881
118 Ga0207425_1000104 3300025245 Bacteria 79793
119 Ga0207425_1000187 3300025245 Bacteria 50439
120 Ga0209148_1000040 3300025254 Bacteria 473531
121 Ga0209129_1000007 3300025258 Bacteria 771325
122 Ga0209129_1000213 3300025258 Bacteria 67041
123 Ga0209233_1000081 3300025261 Bacteria 336832
124 Ga0209565_1000105 3300025263 Bacteria 122895
125 Ga0209673_1001154 3300025273 Bacteria 28838
126 Ga0209673_1017575 3300025273 Bacteria 2633
127 Ga0209130_1000070 3300025284 Bacteria 179057
128 Ga0209130_1000160 3300025284 Bacteria 100965
129 Ga0209675_1000161 3300025291 Bacteria 86003
130 Ga0209676_1000785 3300025292 Bacteria 42175
131 Ga0209676_1002015 3300025292 Bacteria 15993
132 Ga0209025_1000111 3300025294 Bacteria 218982
133 Ga0209025_1000181 3300025294 Bacteria 156894
134 Ga0209025_1072954 3300025294 Bacteria 1207
135 Ga0209564_1000153 3300025295 Bacteria 166910
136 Ga0209758_1000025 3300025297 Bacteria 586687
137 Ga0209758_1000156 3300025297 Bacteria 156894
138 Ga0209758_1030633 3300025297 Bacteria 2225
139 Ga0209256_1000971 3300025299 Bacteria 34474
140 Ga0207426_1000001 3300025302 Bacteria 1341301
141 Ga0207426_1000098 3300025302 Bacteria 264264
142 Ga0209051_1000398 3300025303 Bacteria 60408
143 Ga0209051_1002681 3300025303 Bacteria 12435
144 Ga0209051_1038431 3300025303 Bacteria 1742
145 Ga0209257_1000905 3300025304 Bacteria 41519
146 Ga0209257_1009161 3300025304 Bacteria 5388
147 Ga0207656_10108512 3300025321 Bacteria 1280
148 Ga0207692_10214336 3300025898 Bacteria 1138
149 Ga0207688_10147290 3300025901 Bacteria 1389
150 Ga0207680_10076178 3300025903 Bacteria 2094
151 Ga0207699_10021837 3300025906 Bacteria 3458
152 Ga0207705_10086662 3300025909 Bacteria 2289
153 Ga0207693_10013748 3300025915 Bacteria 6520
154 Ga0207693_10235775 3300025915 Bacteria 1437
155 Ga0207663_10057429 3300025916 Bacteria 2452
156 Ga0207663_10859612 3300025916 Bacteria 724
157 Ga0207652_10077226 3300025921 Bacteria 2906
158 Ga0207700_10052371 3300025928 Bacteria 3051
159 Ga0207700_10234830 3300025928 Bacteria 1561
160 Ga0207664_10013278 3300025929 Bacteria 5906
161 Ga0207664_10363120 3300025929 Bacteria 1283
162 Ga0207664_10370463 3300025929 Bacteria 1270
163 Ga0207706_10105761 3300025933 Bacteria 2476
164 Ga0207706_10210768 3300025933 Bacteria 1703
165 Ga0207709_10000295 3300025935 Bacteria 55888
166 Ga0207665_10022925 3300025939 Bacteria 4110
167 Ga0207691_10034628 3300025940 Bacteria 4695
168 Ga0207691_10464015 3300025940 Bacteria 1077
169 Ga0207668_10451389 3300025972 Bacteria 1097
170 Ga0207677_10299600 3300026023 Bacteria 1327
171 Ga0207703_10641873 3300026035 Bacteria 1007
172 Ga0207702_10316317 3300026078 Bacteria 1486
173 Ga0207674_10443275 3300026116 Bacteria 1255
174 Ga0207683_10865334 3300026121 Bacteria 839
175 Ga0207428_10221766 3300027907 Bacteria 1417
176 Ga0207428_10356718 3300027907 Bacteria 1075
177 Ga0265334_10007467 3300028573 Bacteria 4688
178 Ga0307515_10000734 3300028794 Bacteria 75701
179 Ga0265330_10023925 3300031235 Bacteria 2771
180 Ga0265340_10006640 3300031247 Bacteria 6346
181 Ga0265340_10058642 3300031247 Bacteria 1848
182 Ga0265339_10080465 3300031249 Bacteria 1723
183 Ga0307508_10259885 3300031616 Bacteria 1331
184 Ga0307405_10000692 3300031731 Bacteria 13042
185 Ga0307405_10031248 3300031731 Bacteria 3132
186 Ga0307405_10242599 3300031731 Bacteria 1336
187 Ga0307413_10303964 3300031824 Bacteria 1211
188 Ga0307410_10029869 3300031852 Bacteria 3476
189 Ga0307407_10054286 3300031903 Bacteria 2310
190 Ga0307412_10001472 3300031911 Bacteria 13075
191 Ga0307416_100363509 3300032002 Bacteria 1470
192 Ga0307411_10061373 3300032005 Bacteria 2502
193 Ga0307411_10120180 3300032005 Bacteria 1899
194 Ga0307415_100188605 3300032126 Bacteria 1625
195 Ga0307510_10056863 3300033180 Bacteria 4067
196 Ga0373934_0054742 3300035086 Bacteria 1584
197 Ga0373923_0000665 3300035111 Bacteria 8726
198 Ga0373936_0008498 3300035113 Bacteria 3868
199 Ga0373939_0019884 3300035114 Bacteria 1817
200 Ga0373945_0030583 3300035116 Bacteria 1899
201 Ga0373953_0155826 3300035117 Bacteria 980
202 Ga0373954_0031538 3300035118 Unclassified 2447
203 Ga0373956_0028794 3300035119 Bacteria 2418
204 Ga0373943_0110343 3300035170 Bacteria 1450
205 Ga0373946_0008138 3300035171 Bacteria 3849
206 Ga0373924_0002958 3300035410 Bacteria 5772
207 Ga0373931_0029945 3300035691 Bacteria 2799
208 Ga0373935_0129135 3300035692 Bacteria 1696
209 Ga0373927_0031293 3300035695 Bacteria 3469
210 Ga0373927_0425958 3300035695 Bacteria 876
211 Ga0373933_0024223 3300035724 Bacteria 3474
212 Ga0373933_0454037 3300035724 Unclassified 838
213 Ga0373947_0082161 3300035725 Bacteria 1996
214 Ga0373937_0013781 3300036401 Bacteria 7124
215 Ga0395900_0162024 3300037418 Bacteria 2281
216 Ga0436364_0189042 3300037853 Bacteria 18054
217 Ga0436364_0907328 3300037853 Bacteria 907
218 Ga0436364_1077066 3300037853 Bacteria 6497
219 Ga0395901_0000429 3300038443 Bacteria 49524
220 Ga0436365_0386367 3300039437 Bacteria 1718
221 Ga0436365_1270831 3300039437 Bacteria 2377
222 Ga0436365_1361371 3300039437 Bacteria 4277
223 Ga0436365_1484954 3300039437 Bacteria 2569
224 Ga0436361_0763867 3300039447 Bacteria 2811
225 Ga0436363_0053010 3300039450 Unclassified 704
226 Ga0436363_0110353 3300039450 Bacteria 3489
227 Ga0439461_0059598 3300041410 Bacteria 864
228 Ga0450909_015400 3300042185 Bacteria 1129
229 Ga0439435_0068761 3300042436 Bacteria 1045
230 Ga0466965_0128118 3300044683 Bacteria 1314
231 Ga0466957_0343863 3300044842 Bacteria 1011
232 Ga0466960_0119535 3300044901 Bacteria 1379
233 Ga0466967_0316767 3300045976 Bacteria 1504
234 Ga0466967_0702978 3300045976 Bacteria 1001
235 Ga0495627_009766 3300046453 Bacteria 3518
236 Ga0495592_0065348 3300046454 Bacteria 2663
237 Ga0495629_0127318 3300046459 Bacteria 1774
238 Ga0495638_0005667 3300046460 Bacteria 9201
239 Ga0495638_0076592 3300046460 Bacteria 2038
240 Ga0495638_0410056 3300046460 Unclassified 701
241 Ga0495651_0010673 3300046462 Bacteria 7067
242 Ga0495662_0119120 3300046476 Bacteria 1295
243 Ga0495664_0001055 3300046477 Bacteria 14235
244 Ga0495585_0033136 3300046492 Bacteria 2926
245 Ga0495594_0158043 3300046499 Bacteria 1288
246 Ga0495607_0043228 3300046501 Bacteria 2666
247 Ga0495583_0152994 3300046506 Bacteria 955
248 Ga0495606_0000286 3300046507 Bacteria 87736
249 Ga0495606_0058611 3300046507 Bacteria 2474
250 Ga0495606_0328306 3300046507 Bacteria 819
251 Ga0495608_0104176 3300046511 Bacteria 1827
252 Ga0495610_0064734 3300046512 Bacteria 1727
253 Ga0495616_0005580 3300046513 Bacteria 7714
254 Ga0495616_0171689 3300046513 Bacteria 969
255 Ga0495618_0072399 3300046514 Bacteria 2193
256 Ga0495620_0003772 3300046515 Bacteria 8652
257 Ga0495628_0034861 3300046516 Bacteria 4046
258 Ga0495630_0071797 3300046517 Bacteria 2606
259 Ga0495631_0000135 3300046518 Bacteria 50021
260 Ga0495637_0006294 3300046520 Bacteria 5975
261 Ga0495643_0005026 3300046522 Bacteria 9058
262 Ga0495587_0004246 3300046536 Bacteria 9474
263 Ga0495621_0023947 3300046539 Bacteria 2034
264 Ga0495645_0000621 3300046543 Bacteria 24430
265 Ga0495622_0141077 3300046557 Bacteria 1094
266 Ga0495667_0037769 3300046559 Bacteria 3217
267 Ga0495656_0000768 3300046615 Bacteria 10345
268 Ga0495656_0028109 3300046615 Bacteria 2253
269 Ga0495668_0032774 3300046616 Bacteria 2921
270 Ga0495668_0201195 3300046616 Bacteria 1090
271 Ga0495625_0074868 3300046660 Bacteria 2370
272 Ga0495625_0207561 3300046660 Bacteria 1289
273 Ga0495635_0011990 3300046663 Bacteria 6074
274 Ga0495588_0019333 3300046674 Bacteria 3336
275 Ga0495588_0267767 3300046674 Bacteria 900
276 Ga0495588_0298851 3300046674 Bacteria 848
277 Ga0495657_0059497 3300046675 Bacteria 2534
278 Ga0495599_0024941 3300046678 Bacteria 3740
279 Ga0495623_0227519 3300046679 Bacteria 1059
280 Ga0495646_0033870 3300046680 Bacteria 3175
281 Ga0495613_0190860 3300046689 Bacteria 1448
282 Ga0495624_0039603 3300046690 Bacteria 3021
283 Ga0495670_0313817 3300046691 Unclassified 841
284 Ga0495671_0069322 3300046692 Bacteria 1733
285 Ga0495600_0014376 3300046809 Bacteria 4987
286 Ga0495660_0213769 3300046810 Bacteria 913
287 Ga0495581_0160962 3300047315 Bacteria 1312
288 Ga0495604_0024163 3300047317 Bacteria 4850
289 Ga0495604_0243500 3300047317 Bacteria 1228
290 Ga0495674_0177694 3300047319 Bacteria 1774
291 Ga0495676_0017468 3300047321 Bacteria 6342
292 Ga0495680_0048773 3300047322 Bacteria 3323
293 Ga0495675_0005107 3300047444 Bacteria 7988
294 Ga0495681_0114837 3300047470 Bacteria 1162
295 Ga0495686_0000301 3300047472 Bacteria 84924
296 Ga0495686_0008318 3300047472 Bacteria 7627
297 Ga0495593_0003733 3300047673 Bacteria 9084
298 Ga0495602_0027115 3300048088 Bacteria 5513
299 Ga0495602_0046211 3300048088 Bacteria 3935
300 Ga0495614_0000628 3300048089 Bacteria 14772
301 Ga0496100_0158536 3300048903 Bacteria 1620
302 Ga0496101_0002024 3300048904 Bacteria 12315
303 Ga0496105_0025100 3300048908 Bacteria 4847
304 Ga0496106_0416968 3300048909 Bacteria 1079
305 Ga0496113_0100149 3300048916 Bacteria 2245
306 Ga0496114_0384046 3300048917 Bacteria 1243
307 Ga0496114_0554710 3300048917 Bacteria 1015
308 Ga0496116_0003414 3300048919 Bacteria 15708
309 Ga0496117_0040615 3300048920 Bacteria 3418
310 Ga0496117_0128993 3300048920 Bacteria 1537
311 Ga0496117_0273687 3300048920 Bacteria 908
312 Ga0496118_0005495 3300048921 Bacteria 14383
313 Ga0496118_0009108 3300048921 Bacteria 10105
314 Ga0496118_0046702 3300048921 Bacteria 3365
315 Ga0496118_0164025 3300048921 Bacteria 1369
316 Ga0496119_0010494 3300048922 Bacteria 7787
317 Ga0496119_0016180 3300048922 Bacteria 5697
318 Ga0496119_0021616 3300048922 Bacteria 4640
319 Ga0496119_0210264 3300048922 Bacteria 1001
320 Ga0496121_0005293 3300048924 Bacteria 16613
321 Ga0496121_0017118 3300048924 Bacteria 7428
322 Ga0496121_0019634 3300048924 Bacteria 6749
323 Ga0496121_0063117 3300048924 Bacteria 3029
324 Ga0496121_0093985 3300048924 Bacteria 2333
325 Ga0496121_0114352 3300048924 Bacteria 2051
326 Ga0496121_0151254 3300048924 Bacteria 1707
327 Ga0496121_0167716 3300048924 Bacteria 1598
328 Ga0496121_0168353 3300048924 Bacteria 1595
329 Ga0496122_0017844 3300048925 Bacteria 6599
330 Ga0496122_0031377 3300048925 Bacteria 4424
331 Ga0496122_0086217 3300048925 Bacteria 2162
332 Ga0496122_0197503 3300048925 Bacteria 1180
333 Ga0496123_0012165 3300048926 Bacteria 7366
334 Ga0496123_0092108 3300048926 Bacteria 1795
335 Ga0496123_0108658 3300048926 Bacteria 1591
336 Ga0496123_0121497 3300048926 Bacteria 1468
337 Ga0496124_0004534 3300048927 Bacteria 16169
338 Ga0496124_0015745 3300048927 Bacteria 7230
339 Ga0496124_0368617 3300048927 Bacteria 1009
340 Ga0496125_0026113 3300048928 Bacteria 5333
341 Ga0496125_0060927 3300048928 Bacteria 3029
342 Ga0496125_0085397 3300048928 Bacteria 2392
343 Ga0496125_0141403 3300048928 Bacteria 1673
344 Ga0496126_0018511 3300048929 Bacteria 6897
345 Ga0496126_0088408 3300048929 Bacteria 2729
346 Ga0496126_0490083 3300048929 Unclassified 984
347 Ga0501036_0327538 3300049572 Bacteria 1280
348 Ga0501038_0043906 3300049574 Bacteria 3886
349 Ga0501039_1254254 3300049575 Bacteria 572
350 Ga0501041_0113459 3300049577 Bacteria 1682
351 Ga0501042_0185391 3300049578 Bacteria 1501
352 Ga0501043_0190959 3300049579 Bacteria 1593
353 Ga0501048_0045305 3300049582 Bacteria 3142
354 Ga0501069_0418781 3300049585 Bacteria 794
355 Ga0501072_0063548 3300049588 Bacteria 2912
356 Ga0501074_0020311 3300049590 Bacteria 4828
357 Ga0501075_0200680 3300049591 Bacteria 1521
358 Ga0501077_0203426 3300049593 Bacteria 1258
359 Ga0501079_0295330 3300049741 Bacteria 1267
360 Ga0501080_0257175 3300049742 Bacteria 1591
361 Ga0501081_0290335 3300049743 Bacteria 1198
362 Ga0501035_0255546 3300049822 Bacteria 1487
363 Ga0501045_0123650 3300049824 Bacteria 1921
364 nmdc:mga03683_131136_c1 3300050489 Bacteria 1121
365 nmdc:mga03n38_105640_c1 3300050490 Bacteria 1364
366 nmdc:mga00v17_291778_c1 3300050491 Bacteria 1059
367 nmdc:mga00v17_76569_c1 3300050491 Bacteria 2081
368 nmdc:mga0k408_8213_c1 3300050493 Bacteria 5595
369 nmdc:mga07m45_210447_c1 3300050496 Bacteria 1131
370 nmdc:mga05p37_557652_c1 3300050507 Bacteria 1303
371 nmdc:mga09592_306408_c1 3300050508 Bacteria 1377
372 nmdc:mga09592_38415_c1 3300050508 Bacteria 4019
373 nmdc:mga0qj67_23148_c1 3300050509 Bacteria 4776
374 nmdc:mga06r32_6170_c1 3300050510 Bacteria 10761
375 nmdc:mga0sz30_196881_c1 3300050516 Bacteria 894
376 Ga0495601_0003004 3300053077 Bacteria 9611
377 Ga0495612_0000926 3300053078 Bacteria 12019
378 Ga0500610_0007049 3300053079 Bacteria 4775
379 Ga0500610_0054019 3300053079 Bacteria 2094
380 Ga0495595_0075712 3300053084 Bacteria 1596
381 Ga0495619_0005491 3300053085 Bacteria 8039
382 Ga0500578_0177543 3300053086 Bacteria 1314
383 Ga0500651_0000042 3300053093 Bacteria 87895
384 Ga0500651_0031665 3300053093 Bacteria 3330
385 Ga0500566_0007251 3300053094 Bacteria 6571
386 Ga0500566_0221237 3300053094 Bacteria 941
387 Ga0500571_000075 3300053110 Bacteria 31313
388 Ga0500572_006892 3300053111 Bacteria 2616
389 Ga0500592_013976 3300053116 Bacteria 1287
390 Ga0500594_0000588 3300053118 Bacteria 7789
391 Ga0500594_0076782 3300053118 Bacteria 992
392 Ga0500595_000443 3300053119 Bacteria 25930
393 Ga0500595_018050 3300053119 Bacteria 2588
394 Ga0500607_039572 3300053121 Bacteria 2559
395 Ga0500608_007382 3300053122 Bacteria 4545
396 Ga0500618_000405 3300053125 Bacteria 29227
397 Ga0500626_020349 3300053128 Bacteria 2951
398 Ga0500628_025356 3300053129 Bacteria 1240
399 Ga0500655_000155 3300053133 Bacteria 17130
400 Ga0500658_0000134 3300053134 Bacteria 34937
401 Ga0500658_0000142 3300053134 Bacteria 34080
402 Ga0500559_0005546 3300053136 Bacteria 5791
403 Ga0500564_006845 3300053138 Bacteria 4791
404 Ga0500568_0000983 3300053139 Bacteria 19591
405 Ga0500568_0016920 3300053139 Bacteria 3229
406 Ga0500574_000142 3300053141 Bacteria 8167
407 Ga0500588_0025830 3300053146 Bacteria 1637
408 Ga0500604_0019579 3300053151 Bacteria 1897
409 Ga0500616_0075817 3300053153 Bacteria 1701
410 Ga0500616_0100128 3300053153 Bacteria 1418
411 Ga0500624_002913 3300053157 Bacteria 2264
412 Ga0500638_064602 3300053162 Bacteria 1755
413 Ga0500638_075940 3300053162 Bacteria 1600
414 Ga0500636_0069704 3300053177 Bacteria 2040
415 Ga0500636_0114460 3300053177 Bacteria 1520
416 Ga0500636_0158740 3300053177 Bacteria 1235
417 Ga0501084_0306547 3300054114 Bacteria 1341
418 Ga0530510_0405539 3300061734 Bacteria 1028

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009986 Ga0105033_109710 Ga0105033_1097101 163
2 3300049575 Ga0501039_1254254 Ga0501039_1254254_30_527 164
3 3300035116 Ga0373945_0030583 Ga0373945_0030583_1309_1827 172
4 3300035117 Ga0373953_0155826 Ga0373953_0155826_47_565 172
5 3300006844 Ga0075428_100151670 Ga0075428_1001516702 179
6 3300006846 Ga0075430_100103215 Ga0075430_1001032152 179
7 3300006847 Ga0075431_100196111 Ga0075431_1001961112 179
8 3300006880 Ga0075429_100237670 Ga0075429_1002376702 179
9 3300009147 Ga0114129_10424940 Ga0114129_104249402 179
10 3300050507 nmdc:mga05p37_557652_c1 nmdc:mga05p37_557652_c1_228_836 179
11 3300050508 nmdc:mga09592_306408_c1 nmdc:mga09592_306408_c1_739_1347 179
12 3300050509 nmdc:mga0qj67_23148_c1 nmdc:mga0qj67_23148_c1_3650_4258 179
13 3300050510 nmdc:mga06r32_6170_c1 nmdc:mga06r32_6170_c1_6957_7565 179
14 3300005435 Ga0070714_100366735 Ga0070714_1003667352 180
15 3300006028 Ga0070717_10209618 Ga0070717_102096183 180
16 3300006880 Ga0075429_100009302 Ga0075429_1000093024 180
17 3300025929 Ga0207664_10363120 Ga0207664_103631202 180
18 3300048924 Ga0496121_0005293 Ga0496121_0005293_14517_15131 180
19 3300050508 nmdc:mga09592_38415_c1 nmdc:mga09592_38415_c1_1441_2043 180
20 3300031731 Ga0307405_10000692 Ga0307405_100006923 181
21 3300006163 Ga0070715_10074065 Ga0070715_100740652 182
22 3300005467 Ga0070706_100012800 Ga0070706_1000128003 183
23 3300042436 Ga0439435_0068761 Ga0439435_0068761_175_777 183
24 3300021377 Ga0213874_10022673 Ga0213874_100226732 185
25 3300031852 Ga0307410_10029869 Ga0307410_100298694 185
26 3300032005 Ga0307411_10120180 Ga0307411_101201803 185
27 3300039437 Ga0436365_1270831 Ga0436365_1270831_1361_1969 185
28 3300002773 JGI25152J39213_1013240 JGI25152J39213_10132402 186
29 3300002774 JGI25150J39212_1000026 JGI25150J39212_100002636 186
30 3300003187 JGI25151J46595_10000053 JGI25151J46595_1000005398 186
31 3300003215 JGI25153J46596_10003066 JGI25153J46596_100030667 186
32 3300003790 Ga0055528_1063204 Ga0055528_10632041 186
33 3300009036 Ga0105244_10090231 Ga0105244_100902312 186
34 3300013104 Ga0157370_10384862 Ga0157370_103848622 186
35 3300025245 Ga0207425_1000104 Ga0207425_100010448 186
36 3300025258 Ga0209129_1000213 Ga0209129_100021348 186
37 3300025273 Ga0209673_1017575 Ga0209673_10175753 186
38 3300025294 Ga0209025_1000181 Ga0209025_100018148 186
39 3300025297 Ga0209758_1000156 Ga0209758_100015648 186
40 3300031911 Ga0307412_10001472 Ga0307412_1000147210 186
41 3300048903 Ga0496100_0158536 Ga0496100_0158536_62_694 186
42 3300048904 Ga0496101_0002024 Ga0496101_0002024_5892_6524 186
43 3300048909 Ga0496106_0416968 Ga0496106_0416968_305_937 186
44 3300048916 Ga0496113_0100149 Ga0496113_0100149_597_1229 186
45 3300048919 Ga0496116_0003414 Ga0496116_0003414_4841_5473 186
46 3300048921 Ga0496118_0009108 Ga0496118_0009108_5673_6305 186
47 3300048922 Ga0496119_0010494 Ga0496119_0010494_2132_2764 186
48 3300048924 Ga0496121_0063117 Ga0496121_0063117_1755_2387 186
49 3300048926 Ga0496123_0012165 Ga0496123_0012165_907_1539 186
50 3300048927 Ga0496124_0004534 Ga0496124_0004534_12182_12814 186
51 3300048928 Ga0496125_0060927 Ga0496125_0060927_771_1403 186
52 3300048929 Ga0496126_0018511 Ga0496126_0018511_549_1181 186
53 3300046507 Ga0495606_0328306 Ga0495606_0328306_69_713 187
54 3300046522 Ga0495643_0005026 Ga0495643_0005026_2347_2991 187
55 3300048927 Ga0496124_0015745 Ga0496124_0015745_5217_5861 187
56 3300039447 Ga0436361_0763867 Ga0436361_0763867_1908_2474 188
57 3300005617 Ga0068859_100266755 Ga0068859_1002667553 189
58 3300006931 Ga0097620_100266769 Ga0097620_1002667692 189
59 3300009148 Ga0105243_10684761 Ga0105243_106847611 189
60 3300013297 Ga0157378_10914522 Ga0157378_109145221 189
61 3300014326 Ga0157380_10353624 Ga0157380_103536242 189
62 3300013308 Ga0157375_10266274 Ga0157375_102662741 190
63 3300025297 Ga0209758_1030633 Ga0209758_10306332 190
64 iso_pu_bacteria 2894772417 2894774011 190
65 3300031824 Ga0307413_10303964 Ga0307413_103039642 191
66 3300031903 Ga0307407_10054286 Ga0307407_100542862 191
67 3300032126 Ga0307415_100188605 Ga0307415_1001886052 191
68 3300045976 Ga0466967_0702978 Ga0466967_0702978_232_894 191
69 3300049572 Ga0501036_0327538 Ga0501036_0327538_33_656 191
70 3300049574 Ga0501038_0043906 Ga0501038_0043906_1056_1679 191
71 3300049577 Ga0501041_0113459 Ga0501041_0113459_125_748 191
72 3300049578 Ga0501042_0185391 Ga0501042_0185391_518_1141 191
73 3300049579 Ga0501043_0190959 Ga0501043_0190959_789_1412 191
74 3300049582 Ga0501048_0045305 Ga0501048_0045305_2020_2643 191
75 3300049585 Ga0501069_0418781 Ga0501069_0418781_148_771 191
76 3300049588 Ga0501072_0063548 Ga0501072_0063548_801_1424 191
77 3300049590 Ga0501074_0020311 Ga0501074_0020311_2305_2928 191
78 3300049591 Ga0501075_0200680 Ga0501075_0200680_717_1340 191
79 3300049593 Ga0501077_0203426 Ga0501077_0203426_625_1248 191
80 3300049741 Ga0501079_0295330 Ga0501079_0295330_16_639 191
81 3300049743 Ga0501081_0290335 Ga0501081_0290335_357_980 191
82 3300049822 Ga0501035_0255546 Ga0501035_0255546_706_1329 191
83 3300049824 Ga0501045_0123650 Ga0501045_0123650_31_654 191
84 3300054114 Ga0501084_0306547 Ga0501084_0306547_637_1260 191
85 3300061734 Ga0530510_0405539 Ga0530510_0405539_219_842 191
86 3300006051 Ga0075364_10142626 Ga0075364_101426262 192
87 3300031731 Ga0307405_10031248 Ga0307405_100312484 192
88 3300032005 Ga0307411_10061373 Ga0307411_100613734 192
89 iso_pu_bacteria 2841911363 2841913587 192
90 iso_pu_bacteria 2841917233 2841919334 192
91 iso_pu_bacteria 2844533157 2844536920 193
92 iso_pu_bacteria 2643221649 2644278503 194
93 iso_pu_bacteria 2744054633 2745082253 194
94 3300037853 Ga0436364_0907328 Ga0436364_0907328_266_883 195
95 iso_pu_bacteria 2582581283 2585169082 195
96 iso_pu_bacteria 2936055302 2936058033 195
97 3300031616 Ga0307508_10259885 Ga0307508_102598852 196
98 3300033180 Ga0307510_10056863 Ga0307510_100568634 196
99 3300005434 Ga0070709_10100532 Ga0070709_101005323 197
100 3300005841 Ga0068863_100340599 Ga0068863_1003405992 197
101 3300005937 Ga0081455_10408065 Ga0081455_104080652 197
102 3300006042 Ga0075368_10100278 Ga0075368_101002782 197
103 3300006048 Ga0075363_100179480 Ga0075363_1001794802 197
104 3300006051 Ga0075364_10304563 Ga0075364_103045632 197
105 3300006177 Ga0075362_10108643 Ga0075362_101086432 197
106 3300006186 Ga0075369_10250715 Ga0075369_102507152 197
107 3300006195 Ga0075366_10000792 Ga0075366_100007929 197
108 3300010375 Ga0105239_10541977 Ga0105239_105419772 197
109 3300025284 Ga0209130_1000160 Ga0209130_100016059 197
110 3300025294 Ga0209025_1072954 Ga0209025_10729542 197
111 3300025302 Ga0207426_1000098 Ga0207426_100009863 197
112 3300025928 Ga0207700_10234830 Ga0207700_102348302 197
113 3300027907 Ga0207428_10221766 Ga0207428_102217662 197
114 3300028573 Ga0265334_10007467 Ga0265334_100074672 197
115 3300031247 Ga0265340_10058642 Ga0265340_100586422 197
116 3300035114 Ga0373939_0019884 Ga0373939_0019884_441_1034 197
117 3300035691 Ga0373931_0029945 Ga0373931_0029945_298_891 197
118 3300035695 Ga0373927_0425958 Ga0373927_0425958_227_820 197
119 3300037418 Ga0395900_0162024 Ga0395900_0162024_1117_1710 197
120 3300038443 Ga0395901_0000429 Ga0395901_0000429_34555_35148 197
121 3300039437 Ga0436365_1484954 Ga0436365_1484954_418_1041 197
122 3300041410 Ga0439461_0059598 Ga0439461_0059598_204_797 197
123 3300042185 Ga0450909_015400 Ga0450909_015400_226_819 197
124 3300044842 Ga0466957_0343863 Ga0466957_0343863_223_816 197
125 3300046460 Ga0495638_0005667 Ga0495638_0005667_7144_7770 197
126 3300046512 Ga0495610_0064734 Ga0495610_0064734_1006_1599 197
127 3300046513 Ga0495616_0171689 Ga0495616_0171689_171_797 197
128 3300046616 Ga0495668_0032774 Ga0495668_0032774_1370_1996 197
129 3300046660 Ga0495625_0074868 Ga0495625_0074868_19_645 197
130 3300046692 Ga0495671_0069322 Ga0495671_0069322_193_819 197
131 3300048929 Ga0496126_0088408 Ga0496126_0088408_1504_2130 197
132 3300050489 nmdc:mga03683_131136_c1 nmdc:mga03683_131136_c1_300_893 197
133 3300050490 nmdc:mga03n38_105640_c1 nmdc:mga03n38_105640_c1_474_1067 197
134 3300050491 nmdc:mga00v17_291778_c1 nmdc:mga00v17_291778_c1_158_751 197
135 3300050493 nmdc:mga0k408_8213_c1 nmdc:mga0k408_8213_c1_4946_5539 197
136 3300050516 nmdc:mga0sz30_196881_c1 nmdc:mga0sz30_196881_c1_127_720 197
137 3300053094 Ga0500566_0221237 Ga0500566_0221237_91_684 197
138 iso_pu_bacteria 2643221629 2644168121 197
139 iso_pu_bacteria 2643221662 2644348817 197
140 3300005434 Ga0070709_10044414 Ga0070709_100444144 198
141 3300005435 Ga0070714_100022721 Ga0070714_1000227213 198
142 3300005436 Ga0070713_100067713 Ga0070713_1000677133 198
143 3300005437 Ga0070710_10013396 Ga0070710_100133963 198
144 3300005439 Ga0070711_100177671 Ga0070711_1001776712 198
145 3300005614 Ga0068856_100197392 Ga0068856_1001973922 198
146 3300006163 Ga0070715_10079850 Ga0070715_100798502 198
147 3300006175 Ga0070712_100016011 Ga0070712_1000160115 198
148 3300010375 Ga0105239_10318703 Ga0105239_103187032 198
149 3300025898 Ga0207692_10214336 Ga0207692_102143361 198
150 3300025906 Ga0207699_10021837 Ga0207699_100218372 198
151 3300025915 Ga0207693_10013748 Ga0207693_100137483 198
152 3300025928 Ga0207700_10052371 Ga0207700_100523713 198
153 3300025929 Ga0207664_10013278 Ga0207664_100132786 198
154 3300026121 Ga0207683_10865334 Ga0207683_108653341 198
155 3300031235 Ga0265330_10023925 Ga0265330_100239252 198
156 3300031247 Ga0265340_10006640 Ga0265340_100066405 198
157 3300031249 Ga0265339_10080465 Ga0265339_100804652 198
158 iso_pu_bacteria 2513237144 2513912064 198
159 iso_pu_bacteria 2513237146 2513927370 198
160 iso_pu_bacteria 2582581316 2585334565 198
161 iso_pu_bacteria 2585427594 2585846062 198
162 iso_pu_bacteria 2599185170 2599415187 198
163 iso_pu_bacteria 2617270742 2617382134 198
164 iso_pu_bacteria 2738541293 2738801457 198
165 iso_pu_bacteria 2838035591 2838039088 198
166 iso_pu_bacteria 2838661181 2838664320 198
167 iso_pu_bacteria 2842482326 2842484345 198
168 iso_pu_bacteria 2933016740 2933019445 198
169 3300005435 Ga0070714_100177680 Ga0070714_1001776802 199
170 3300005435 Ga0070714_100186467 Ga0070714_1001864672 199
171 3300005437 Ga0070710_10144316 Ga0070710_101443162 199
172 3300005439 Ga0070711_100064075 Ga0070711_1000640751 199
173 3300005614 Ga0068856_100233159 Ga0068856_1002331591 199
174 3300005614 Ga0068856_100302645 Ga0068856_1003026452 199
175 3300006028 Ga0070717_10012817 Ga0070717_100128171 199
176 3300006914 Ga0075436_100856397 Ga0075436_1008563971 199
177 3300009093 Ga0105240_10004352 Ga0105240_100043529 199
178 3300013296 Ga0157374_10377291 Ga0157374_103772912 199
179 3300014325 Ga0163163_10138347 Ga0163163_101383473 199
180 3300014497 Ga0182008_10085841 Ga0182008_100858411 199
181 3300025903 Ga0207680_10076178 Ga0207680_100761783 199
182 3300025915 Ga0207693_10235775 Ga0207693_102357753 199
183 3300025916 Ga0207663_10057429 Ga0207663_100574294 199
184 3300025916 Ga0207663_10859612 Ga0207663_108596122 199
185 3300025929 Ga0207664_10370463 Ga0207664_103704631 199
186 3300025933 Ga0207706_10105761 Ga0207706_101057612 199
187 3300025939 Ga0207665_10022925 Ga0207665_100229254 199
188 3300025940 Ga0207691_10464015 Ga0207691_104640151 199
189 3300026023 Ga0207677_10299600 Ga0207677_102996002 199
190 3300026078 Ga0207702_10316317 Ga0207702_103163172 199
191 3300035086 Ga0373934_0054742 Ga0373934_0054742_668_1267 199
192 3300035111 Ga0373923_0000665 Ga0373923_0000665_6627_7226 199
193 3300035113 Ga0373936_0008498 Ga0373936_0008498_1435_2034 199
194 3300035118 Ga0373954_0031538 Ga0373954_0031538_1158_1757 199
195 3300035119 Ga0373956_0028794 Ga0373956_0028794_512_1111 199
196 3300035170 Ga0373943_0110343 Ga0373943_0110343_356_955 199
197 3300035171 Ga0373946_0008138 Ga0373946_0008138_1634_2233 199
198 3300035410 Ga0373924_0002958 Ga0373924_0002958_1159_1758 199
199 3300035692 Ga0373935_0129135 Ga0373935_0129135_925_1524 199
200 3300035695 Ga0373927_0031293 Ga0373927_0031293_1959_2558 199
201 3300035724 Ga0373933_0024223 Ga0373933_0024223_2566_3165 199
202 3300035724 Ga0373933_0454037 Ga0373933_0454037_68_667 199
203 3300035725 Ga0373947_0082161 Ga0373947_0082161_697_1296 199
204 3300036401 Ga0373937_0013781 Ga0373937_0013781_5302_5901 199
205 3300037853 Ga0436364_1077066 Ga0436364_1077066_3446_4045 199
206 3300039450 Ga0436363_0053010 Ga0436363_0053010_93_692 199
207 3300045976 Ga0466967_0316767 Ga0466967_0316767_386_1048 199
208 3300046454 Ga0495592_0065348 Ga0495592_0065348_1305_1904 199
209 3300046459 Ga0495629_0127318 Ga0495629_0127318_141_740 199
210 3300046460 Ga0495638_0410056 Ga0495638_0410056_36_635 199
211 3300046462 Ga0495651_0010673 Ga0495651_0010673_1209_1808 199
212 3300046476 Ga0495662_0119120 Ga0495662_0119120_490_1089 199
213 3300046477 Ga0495664_0001055 Ga0495664_0001055_2590_3189 199
214 3300046499 Ga0495594_0158043 Ga0495594_0158043_574_1173 199
215 3300046511 Ga0495608_0104176 Ga0495608_0104176_792_1391 199
216 3300046514 Ga0495618_0072399 Ga0495618_0072399_823_1422 199
217 3300046516 Ga0495628_0034861 Ga0495628_0034861_1287_1886 199
218 3300046517 Ga0495630_0071797 Ga0495630_0071797_1709_2308 199
219 3300046536 Ga0495587_0004246 Ga0495587_0004246_5383_5982 199
220 3300046543 Ga0495645_0000621 Ga0495645_0000621_15344_15943 199
221 3300046559 Ga0495667_0037769 Ga0495667_0037769_2239_2838 199
222 3300046663 Ga0495635_0011990 Ga0495635_0011990_4455_5054 199
223 3300046674 Ga0495588_0298851 Ga0495588_0298851_194_820 199
224 3300046675 Ga0495657_0059497 Ga0495657_0059497_1446_2045 199
225 3300046678 Ga0495599_0024941 Ga0495599_0024941_1037_1636 199
226 3300046679 Ga0495623_0227519 Ga0495623_0227519_283_882 199
227 3300046680 Ga0495646_0033870 Ga0495646_0033870_1155_1754 199
228 3300046689 Ga0495613_0190860 Ga0495613_0190860_824_1423 199
229 3300046809 Ga0495600_0014376 Ga0495600_0014376_2797_3396 199
230 3300047315 Ga0495581_0160962 Ga0495581_0160962_496_1095 199
231 3300047317 Ga0495604_0024163 Ga0495604_0024163_3824_4426 199
232 3300047317 Ga0495604_0243500 Ga0495604_0243500_186_785 199
233 3300047319 Ga0495674_0177694 Ga0495674_0177694_132_731 199
234 3300047322 Ga0495680_0048773 Ga0495680_0048773_1957_2556 199
235 3300047444 Ga0495675_0005107 Ga0495675_0005107_3563_4162 199
236 3300048088 Ga0495602_0027115 Ga0495602_0027115_1804_2403 199
237 3300048908 Ga0496105_0025100 Ga0496105_0025100_1702_2304 199
238 3300048921 Ga0496118_0046702 Ga0496118_0046702_1949_2548 199
239 3300048921 Ga0496118_0164025 Ga0496118_0164025_595_1194 199
240 3300048924 Ga0496121_0017118 Ga0496121_0017118_6209_6808 199
241 3300048929 Ga0496126_0490083 Ga0496126_0490083_202_801 199
242 3300053077 Ga0495601_0003004 Ga0495601_0003004_2500_3099 199
243 3300053078 Ga0495612_0000926 Ga0495612_0000926_5828_6427 199
244 3300053084 Ga0495595_0075712 Ga0495595_0075712_318_917 199
245 3300053085 Ga0495619_0005491 Ga0495619_0005491_6649_7248 199
246 3300053093 Ga0500651_0031665 Ga0500651_0031665_1455_2054 199
247 3300053116 Ga0500592_013976 Ga0500592_013976_540_1139 199
248 3300053118 Ga0500594_0076782 Ga0500594_0076782_328_927 199
249 3300053119 Ga0500595_000443 Ga0500595_000443_19300_19899 199
250 3300053119 Ga0500595_018050 Ga0500595_018050_1369_1968 199
251 3300053146 Ga0500588_0025830 Ga0500588_0025830_57_656 199
252 3300053151 Ga0500604_0019579 Ga0500604_0019579_169_768 199
253 3300053162 Ga0500638_064602 Ga0500638_064602_667_1266 199
254 iso_pu_bacteria 8024486573 8024490415 199
255 3300005340 Ga0070689_100225556 Ga0070689_1002255562 200
256 3300005458 Ga0070681_10225650 Ga0070681_102256502 200
257 3300005530 Ga0070679_100120192 Ga0070679_1001201922 200
258 3300009094 Ga0111539_11030389 Ga0111539_110303892 200
259 3300014968 Ga0157379_10322138 Ga0157379_103221382 200
260 3300025921 Ga0207652_10077226 Ga0207652_100772262 200
261 3300026116 Ga0207674_10443275 Ga0207674_104432752 200
262 3300027907 Ga0207428_10356718 Ga0207428_103567182 200
263 3300044683 Ga0466965_0128118 Ga0466965_0128118_559_1161 200
264 3300046557 Ga0495622_0141077 Ga0495622_0141077_165_806 200
265 3300046690 Ga0495624_0039603 Ga0495624_0039603_1032_1634 200
266 3300053153 Ga0500616_0100128 Ga0500616_0100128_110_718 200
267 3300053177 Ga0500636_0069704 Ga0500636_0069704_942_1550 200
268 iso_pu_bacteria 2508501050 2508728761 200
269 iso_pu_bacteria 2508501114 2509078336 200
270 iso_pu_bacteria 2773857925 2774868686 200
271 iso_pu_bacteria 2775506901 2776262480 200
272 iso_pu_bacteria 2835312727 2835316194 200
273 iso_pu_bacteria 2894232714 2894233126 200
274 3300021377 Ga0213874_10073820 Ga0213874_100738202 201
275 3300021388 Ga0213875_10000421 Ga0213875_1000042122 201
276 3300037853 Ga0436364_0189042 Ga0436364_0189042_7610_8218 201
277 3300039437 Ga0436365_0386367 Ga0436365_0386367_585_1193 201
278 3300039437 Ga0436365_1361371 Ga0436365_1361371_1485_2090 201
279 3300039450 Ga0436363_0110353 Ga0436363_0110353_2683_3291 201
280 3300044901 Ga0466960_0119535 Ga0466960_0119535_121_777 201
281 3300050496 nmdc:mga07m45_210447_c1 nmdc:mga07m45_210447_c1_246_896 201
282 3300053139 Ga0500568_0016920 Ga0500568_0016920_534_1139 201
283 iso_pu_bacteria 2510917030 2511194681 201
284 iso_pu_bacteria 2582581298 2585222119 201
285 iso_pu_bacteria 2585427529 2585544928 201
286 3300002737 JGI25162J39368_1000440 JGI25162J39368_100044019 202
287 3300003214 JGI25165J46597_1000494 JGI25165J46597_100049422 202
288 3300003323 rootH1_10285170 rootH1_102851702 202
289 3300005548 Ga0070665_100729701 Ga0070665_1007297012 202
290 3300025233 Ga0209437_100064 Ga0209437_100064170 202
291 3300025261 Ga0209233_1000081 Ga0209233_1000081131 202
292 3300025303 Ga0209051_1038431 Ga0209051_10384312 202
293 3300046492 Ga0495585_0033136 Ga0495585_0033136_134_769 202
294 3300046501 Ga0495607_0043228 Ga0495607_0043228_1048_1677 202
295 3300046507 Ga0495606_0000286 Ga0495606_0000286_34054_34686 202
296 3300046515 Ga0495620_0003772 Ga0495620_0003772_6931_7563 202
297 3300046615 Ga0495656_0028109 Ga0495656_0028109_1586_2221 202
298 3300046674 Ga0495588_0019333 Ga0495588_0019333_2289_2924 202
299 3300047470 Ga0495681_0114837 Ga0495681_0114837_216_857 202
300 3300047472 Ga0495686_0000301 Ga0495686_0000301_50136_50768 202
301 3300047472 Ga0495686_0008318 Ga0495686_0008318_5351_5983 202
302 3300048920 Ga0496117_0128993 Ga0496117_0128993_182_814 202
303 3300048922 Ga0496119_0016180 Ga0496119_0016180_484_1116 202
304 3300048922 Ga0496119_0210264 Ga0496119_0210264_336_968 202
305 3300048924 Ga0496121_0019634 Ga0496121_0019634_5851_6483 202
306 3300048924 Ga0496121_0093985 Ga0496121_0093985_475_1107 202
307 3300048924 Ga0496121_0167716 Ga0496121_0167716_197_829 202
308 3300048924 Ga0496121_0168353 Ga0496121_0168353_704_1336 202
309 3300048925 Ga0496122_0086217 Ga0496122_0086217_468_1100 202
310 3300048927 Ga0496124_0368617 Ga0496124_0368617_49_681 202
311 3300053086 Ga0500578_0177543 Ga0500578_0177543_87_716 202
312 3300053125 Ga0500618_000405 Ga0500618_000405_6772_7395 202
313 3300053177 Ga0500636_0114460 Ga0500636_0114460_396_1025 202
314 3300003320 rootH2_10199587 rootH2_101995872 203
315 3300046520 Ga0495637_0006294 Ga0495637_0006294_3745_4356 203
316 3300048925 Ga0496122_0017844 Ga0496122_0017844_51_662 203
317 3300048926 Ga0496123_0092108 Ga0496123_0092108_29_640 203
318 3300048926 Ga0496123_0108658 Ga0496123_0108658_124_735 203
319 3300003781 Ga0055536_1002460 Ga0055536_100246014 204
320 3300003792 Ga0055540_1001156 Ga0055540_10011568 204
321 3300005333 Ga0070677_10137594 Ga0070677_101375942 204
322 3300009148 Ga0105243_10001557 Ga0105243_1000155720 204
323 3300011119 Ga0105246_10440126 Ga0105246_104401262 204
324 3300013102 Ga0157371_10103963 Ga0157371_101039633 204
325 3300014326 Ga0157380_10034141 Ga0157380_100341413 204
326 3300025292 Ga0209676_1000785 Ga0209676_100078515 204
327 3300025303 Ga0209051_1000398 Ga0209051_100039815 204
328 3300025304 Ga0209257_1009161 Ga0209257_10091613 204
329 3300025901 Ga0207688_10147290 Ga0207688_101472902 204
330 3300025935 Ga0207709_10000295 Ga0207709_1000029532 204
331 3300032002 Ga0307416_100363509 Ga0307416_1003635092 204
332 3300050491 nmdc:mga00v17_76569_c1 nmdc:mga00v17_76569_c1_897_1520 204
333 iso_pu_bacteria 2738543013 2739248423 204
334 3300005347 Ga0070668_100366893 Ga0070668_1003668932 205
335 3300005543 Ga0070672_100026919 Ga0070672_1000269192 205
336 3300005842 Ga0068858_100785941 Ga0068858_1007859411 205
337 3300017792 Ga0163161_10028844 Ga0163161_100288443 205
338 3300025940 Ga0207691_10034628 Ga0207691_100346282 205
339 3300025972 Ga0207668_10451389 Ga0207668_104513892 205
340 3300026035 Ga0207703_10641873 Ga0207703_106418731 205
341 3300046615 Ga0495656_0000768 Ga0495656_0000768_5542_6189 205
342 3300046691 Ga0495670_0313817 Ga0495670_0313817_93_740 205
343 3300048917 Ga0496114_0554710 Ga0496114_0554710_180_827 205
344 3300049742 Ga0501080_0257175 Ga0501080_0257175_766_1389 205
345 iso_pu_bacteria 2904541872 2904547611 206
346 iso_pu_bacteria 2929160207 2929167148 206
347 3300002739 JGI25158J39367_1014613 JGI25158J39367_10146131 207
348 3300002773 JGI25152J39213_1000351 JGI25152J39213_100035123 207
349 3300002774 JGI25150J39212_1000292 JGI25150J39212_100029220 207
350 3300002987 JGI25159J45721_1000047 JGI25159J45721_100004770 207
351 3300003187 JGI25151J46595_10000674 JGI25151J46595_1000067412 207
352 3300003215 JGI25153J46596_10000402 JGI25153J46596_1000040212 207
353 3300003354 JGI25160J50197_1000125 JGI25160J50197_100012571 207
354 3300003374 JGI25161J50226_1000147 JGI25161J50226_100014717 207
355 3300003771 Ga0055526_1000153 Ga0055526_100015362 207
356 3300003773 Ga0055537_1000082 Ga0055537_100008272 207
357 3300003775 Ga0055524_1000548 Ga0055524_100054823 207
358 3300003781 Ga0055536_1037850 Ga0055536_10378502 207
359 3300003784 Ga0055534_1000133 Ga0055534_100013310 207
360 3300003784 Ga0055534_1000301 Ga0055534_100030123 207
361 3300003790 Ga0055528_1000558 Ga0055528_100055823 207
362 3300003794 Ga0055531_10014804 Ga0055531_100148042 207
363 3300004625 Ga0055543_1000182 Ga0055543_100018249 207
364 3300005262 Ga0065165_1000516 Ga0065165_100051612 207
365 3300025208 Ga0209436_103609 Ga0209436_1036092 207
366 3300025245 Ga0207425_1000187 Ga0207425_100018719 207
367 3300025258 Ga0209129_1000007 Ga0209129_1000007253 207
368 3300025263 Ga0209565_1000105 Ga0209565_100010572 207
369 3300025273 Ga0209673_1001154 Ga0209673_100115423 207
370 3300025284 Ga0209130_1000070 Ga0209130_100007031 207
371 3300025291 Ga0209675_1000161 Ga0209675_100016130 207
372 3300025292 Ga0209676_1002015 Ga0209676_10020157 207
373 3300025294 Ga0209025_1000111 Ga0209025_100011189 207
374 3300025295 Ga0209564_1000153 Ga0209564_1000153102 207
375 3300025297 Ga0209758_1000025 Ga0209758_1000025273 207
376 3300025299 Ga0209256_1000971 Ga0209256_100097130 207
377 3300025302 Ga0207426_1000001 Ga0207426_1000001305 207
378 3300025303 Ga0209051_1002681 Ga0209051_10026813 207
379 3300025304 Ga0209257_1000905 Ga0209257_100090523 207
380 3300028794 Ga0307515_10000734 Ga0307515_1000073425 207
381 iso_pu_bacteria 2738541277 2738717871 207
382 iso_pu_bacteria 2738541307 2738879525 207
383 iso_pu_bacteria 2738543019 2739278557 207
384 3300003322 rootL2_10058394 rootL2_100583942 209
385 3300005327 Ga0070658_10091699 Ga0070658_100916992 209
386 3300025909 Ga0207705_10086662 Ga0207705_100866622 209
387 3300031731 Ga0307405_10242599 Ga0307405_102425992 210
388 iso_pu_bacteria 2928084124 2928088301 210
389 iso_pu_bacteria 2945945610 2945948139 210
390 3300013104 Ga0157370_10005682 Ga0157370_100056828 211
391 3300046453 Ga0495627_009766 Ga0495627_009766_961_1596 211
392 3300046507 Ga0495606_0058611 Ga0495606_0058611_1662_2297 211
393 3300048925 Ga0496122_0031377 Ga0496122_0031377_1515_2150 211
394 3300048926 Ga0496123_0121497 Ga0496123_0121497_157_792 211
395 3300048928 Ga0496125_0141403 Ga0496125_0141403_375_1010 211
396 3300053121 Ga0500607_039572 Ga0500607_039572_1356_2003 211
397 iso_pu_bacteria 2818991446 2819597022 211
398 iso_pu_bacteria 2899924645 2899930237 211
399 iso_pu_bacteria 2928037797 2928039350 211
400 iso_pu_bacteria 2928044640 2928045045 211
401 iso_pu_bacteria 2928051484 2928052851 211
402 iso_pu_bacteria 2928064002 2928064478 211
403 3300011119 Ga0105246_10266341 Ga0105246_102663412 214
404 3300017792 Ga0163161_10301653 Ga0163161_103016531 214
405 3300025933 Ga0207706_10210768 Ga0207706_102107682 214
406 3300046460 Ga0495638_0076592 Ga0495638_0076592_175_819 214
407 3300046506 Ga0495583_0152994 Ga0495583_0152994_49_693 214
408 3300046513 Ga0495616_0005580 Ga0495616_0005580_5689_6333 214
409 3300046518 Ga0495631_0000135 Ga0495631_0000135_37009_37653 214
410 3300046539 Ga0495621_0023947 Ga0495621_0023947_58_702 214
411 3300046616 Ga0495668_0201195 Ga0495668_0201195_384_1028 214
412 3300046660 Ga0495625_0207561 Ga0495625_0207561_284_928 214
413 3300046674 Ga0495588_0267767 Ga0495588_0267767_63_707 214
414 3300046810 Ga0495660_0213769 Ga0495660_0213769_244_888 214
415 3300047321 Ga0495676_0017468 Ga0495676_0017468_4246_4890 214
416 3300047673 Ga0495593_0003733 Ga0495593_0003733_4257_4901 214
417 3300048088 Ga0495602_0046211 Ga0495602_0046211_116_760 214
418 3300048089 Ga0495614_0000628 Ga0495614_0000628_7568_8212 214
419 3300048917 Ga0496114_0384046 Ga0496114_0384046_494_1138 214
420 3300048920 Ga0496117_0273687 Ga0496117_0273687_97_765 214
421 3300048922 Ga0496119_0021616 Ga0496119_0021616_1759_2427 214
422 3300048924 Ga0496121_0114352 Ga0496121_0114352_1023_1667 214
423 3300048924 Ga0496121_0151254 Ga0496121_0151254_54_698 214
424 3300048928 Ga0496125_0085397 Ga0496125_0085397_956_1600 214
425 3300053079 Ga0500610_0007049 Ga0500610_0007049_706_1350 214
426 3300053079 Ga0500610_0054019 Ga0500610_0054019_1126_1770 214
427 3300053093 Ga0500651_0000042 Ga0500651_0000042_73818_74462 214
428 3300053094 Ga0500566_0007251 Ga0500566_0007251_4290_4934 214
429 3300053110 Ga0500571_000075 Ga0500571_000075_3474_4118 214
430 3300053111 Ga0500572_006892 Ga0500572_006892_153_797 214
431 3300053118 Ga0500594_0000588 Ga0500594_0000588_2101_2745 214
432 3300053122 Ga0500608_007382 Ga0500608_007382_1336_1980 214
433 3300053128 Ga0500626_020349 Ga0500626_020349_534_1178 214
434 3300053129 Ga0500628_025356 Ga0500628_025356_495_1163 214
435 3300053133 Ga0500655_000155 Ga0500655_000155_16087_16731 214
436 3300053134 Ga0500658_0000134 Ga0500658_0000134_5733_6377 214
437 3300053134 Ga0500658_0000142 Ga0500658_0000142_9454_10122 214
438 3300053136 Ga0500559_0005546 Ga0500559_0005546_2597_3241 214
439 3300053138 Ga0500564_006845 Ga0500564_006845_3442_4086 214
440 3300053139 Ga0500568_0000983 Ga0500568_0000983_918_1562 214
441 3300053141 Ga0500574_000142 Ga0500574_000142_3471_4115 214
442 3300053153 Ga0500616_0075817 Ga0500616_0075817_294_938 214
443 3300053157 Ga0500624_002913 Ga0500624_002913_103_747 214
444 3300053162 Ga0500638_075940 Ga0500638_075940_754_1398 214
445 3300053177 Ga0500636_0158740 Ga0500636_0158740_68_712 214
446 3300001979 JGI24740J21852_10037958 JGI24740J21852_100379582 215
447 3300003320 rootH2_10099260 rootH2_100992602 215
448 3300003322 rootL2_10027034 rootL2_100270342 215
449 3300003761 Ga0055535_1000696 Ga0055535_10006965 215
450 3300003762 Ga0055542_1000027 Ga0055542_100002723 215
451 3300005539 Ga0068853_100019486 Ga0068853_1000194863 215
452 3300005834 Ga0068851_10019255 Ga0068851_100192552 215
453 3300009093 Ga0105240_10109201 Ga0105240_101092013 215
454 3300013105 Ga0157369_10548529 Ga0157369_105485292 215
455 3300025228 Ga0209672_101497 Ga0209672_1014973 215
456 3300025229 Ga0209147_102265 Ga0209147_1022652 215
457 3300025242 Ga0209258_100048 Ga0209258_100048352 215
458 3300025254 Ga0209148_1000040 Ga0209148_1000040352 215
459 3300025321 Ga0207656_10108512 Ga0207656_101085122 215
460 3300048920 Ga0496117_0040615 Ga0496117_0040615_2495_3142 215
461 3300048921 Ga0496118_0005495 Ga0496118_0005495_7153_7800 215
462 3300048925 Ga0496122_0197503 Ga0496122_0197503_239_886 215
463 3300048928 Ga0496125_0026113 Ga0496125_0026113_104_751 215
464 iso_pu_bacteria 2599185214 2599625085 215
465 iso_pu_bacteria 2599185226 2599673098 215
466 iso_pu_bacteria 2599185227 2599682452 215
467 iso_pu_bacteria 2599185229 2599694706 215
468 iso_pu_bacteria 2928070936 2928075123 215

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oyo-assembly1.cif.gz_A crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution 0.8822 38 202
3c1l-assembly2.cif.gz_J crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution 0.848 31 202
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.8372 37 202
6k40-assembly5.cif.gz_K crystal structure of alkyl hydroperoxide reductase from d. radiodurans r1 0.8245 39 202
2prr-assembly1.cif.gz_E crystal structure of alkylhydroperoxidase ahpd core: uncharacterized peroxidase-related protein (yp_296737.1) from ralstonia eutropha jmp134 at 2.15 a resolution 0.8154 32 212
ID Description Score Start End Superfamily
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8335 33 203 1.20.1290.10
3beyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8008 30 109 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7954 33 203 1.20.1290.10
3beyD00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7751 29 109 1.20.1290.10
3c1lB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7747 62 212 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A0D0LQD3-F1-model_v4 Avi_7170 family CMD domain-containing protein 0.9892 14 215
AF-A0A0D0LQD3-F1-model_v4 Avi_7170 family CMD domain-containing protein 0.9796 14 215
AF-A0A6S6NRJ2-F1-model_v4 deleted 0.9774 15 206
AF-A0A7K1R5P3-F1-model_v4 deleted 0.9766 15 206
AF-A0A7M4DIL3-F1-model_v4 CMD domain protein 0.9681 14 211

Feature Viewer

pLDDT pTM Quality
90.22 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map