metagRoot

F449927

General Info

Members	Datasets	Scaffolds	Average Seq Length
467	298	417	384

Family's Representative Sequence

Representative Sequence	3300049823\|Ga0501044_0266096\|Ga0501044_0266096_105_1382
Length	425
Sequence	MDSQHDSPTIGVGMVGYAFMGRAHSHAWRTVACAFDLPRRPVMAALAGRERAALEEAARRQLWAATDTDWRALIARPDVQLVDICTPGSSHAEIAIAALEAGKHVLCEKPLANTVEEAEAMAXXXXEASRHGVRSMVGFSYRRTPALALARRLIADGRLGSLRHVRAQYLQDWIVDPEFPLVWRLQREHAGSGALGDLGAHIVDLAQYLVGEPLTGVSALTETFVRERPLPAASSGLAAVADGTAPRGPVTVDDAALFTGRFPGGAIASFEATRMAAGRKNALRVEINGDRGSLAFDLERLNELDFHDHTEASETAGFRRILVTEPEHPYLEGWWPPGHGLGYDHTFVHQMRDLLTAIEEGRDPEPSFADGLRVQRVLAAVEHSAANGSAWTPVVHEPAVQAGPPQASGTPAPSAGSDDPVAVAP

Samples

	Sample ID	Description	Type	Environment
1	2554235227	Arthrobacter sp. PAO19	Isolate	Rhizosphere
2	2582580736	Prauserella sp. Am3	Isolate	Unclassified
3	2582581313	Streptomyces mirabilis OV308	Isolate	Rhizosphere
4	2643221616	Leifsonia sp. Root227	Isolate	Unclassified
5	2643221647	Streptomyces sp. Root369	Isolate	Unclassified
6	2643221711	Terrabacter sp. Root85	Isolate	Unclassified
7	2654587600	Glutamicibacter halophytocola KLBMP5180	Isolate	Unclassified
8	2739367654	Promicromonospora sp. YR516	Isolate	Unclassified
9	2791355406	Streptomyces rhizosphaericus NRRL B-24304	Isolate	Unclassified
10	2808606306	Microbacterium sp. SLBN-146	Isolate	Unclassified
11	2808606359	Streptomyces sp. RJA2910	Isolate	Unclassified
12	2808606370	Arthrobacter sp. SLBN-100	Isolate	Unclassified
13	2808606371	Arthrobacter sp. SLBN-53	Isolate	Unclassified
14	2808606394	Promicromonospora sp. C35	Isolate	Unclassified
15	2811994879	Streptomyces sp. 4-17	Isolate	Unclassified
16	2818991458	Terrabacter sp. 3211	Isolate	Rhizosphere
17	2837268691	Jiangella endophytica KE2-3	Isolate	Rhizosphere
18	2844841374	Leifsonia soli DSM 23871	Isolate	Rhizosphere
19	2852635781	Streptomyces sp. AK010	Isolate	Rhizosphere
20	2852643534	Leifsonia sp. AK011	Isolate	Rhizosphere
21	2868088558	Phytoactinopolyspora endophytica EGI 60009	Isolate	Unclassified
22	2870721527	Saccharothrix ecbatanensis DSM 45486	Isolate	Rhizosphere
23	2884693830	Nonomuraea phyllanthi WYY166	Isolate	Unclassified
24	2884763398	Leifsonia sp. PS1209	Isolate	Stem Tuber
25	2891395885	Microbispora catharanthi CR1-09	Isolate	Unclassified
26	2895427314	Nonomuraea sp. PA05	Isolate	Unclassified
27	2895442618	Nonomuraea phyllanthi PA1-10	Isolate	Unclassified
28	2919055335	Leifsonia sp. 1010	Isolate	Rhizosphere
29	2919523602	Leifsonia shinshuensis 3821	Isolate	Unclassified
30	2928121344	Plantibacter flavus 1756	Isolate	Rhizosphere
31	2928153084	Leifsonia sp. 563	Isolate	Unclassified
32	2939660829	Mycetocola sp. 2940	Isolate	Rhizosphere
33	2946024296	Arthrobacter woluwensis W4I2	Isolate	Rhizosphere
34	2946064051	Streptomyces luteogriseus W4I19-1	Isolate	Rhizosphere
35	2947224130	Streptomyces afghaniensis W1I20	Isolate	Rhizosphere
36	2954691527	Streptomyces sp. SAI-127	Isolate	Rhizosphere
37	2954701450	Streptomyces sp. SAI-144	Isolate	Rhizosphere
38	2974294766	Microbacterium proteolyticum SORGH_AS 209	Isolate	Unclassified
39	2974324384	Microbacterium sp. SORGH_AS 344	Isolate	Unclassified
40	2977264416	Microbacterium testaceum SORGH_AS 594	Isolate	Unclassified
41	3002998708	Actinomadura barringtoniae GKU 128	Isolate	Unclassified
42	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
43	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
44	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
45	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
46	3300003373	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
47	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
48	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
49	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
50	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
51	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
52	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
53	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
54	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
55	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
56	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
57	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
58	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
59	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
60	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
61	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
62	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
63	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
64	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
65	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
66	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
67	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
68	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
69	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
70	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
71	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
72	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
73	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
74	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
75	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
76	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
77	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
78	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
79	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
80	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
81	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
82	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
83	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
84	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
85	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
86	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
87	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
88	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
89	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
90	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
91	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
92	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
93	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
94	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
95	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
96	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
97	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
98	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
99	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
100	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
101	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
102	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
103	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
104	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
105	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
106	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
107	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
108	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
109	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
110	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
111	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
112	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
113	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
114	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
115	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
116	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
117	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
118	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
119	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
120	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
121	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
122	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
123	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
124	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
125	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
126	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
127	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
128	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
129	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
130	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
131	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
132	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
133	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
134	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
135	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
165	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
166	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
167	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
168	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
169	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
170	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
171	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
172	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
173	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
174	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
175	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
176	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
177	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
178	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
179	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
180	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
181	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
182	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
183	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
184	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
185	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
186	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
187	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
188	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
189	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
190	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
191	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
192	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
193	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
194	3300042011	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204	Metagenome	Rhizosphere
195	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
196	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
197	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
198	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
199	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
200	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
201	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
202	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
203	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
204	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
205	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
206	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
207	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
208	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
209	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
210	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
211	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
212	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
213	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
214	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
215	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
216	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
217	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
218	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
219	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
220	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
221	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
222	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
223	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
224	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
225	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
226	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
227	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
228	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
229	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
230	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
231	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
232	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
233	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
234	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
235	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
236	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
237	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
238	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
239	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
240	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
241	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
242	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
243	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
244	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
245	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
246	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
247	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
248	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
249	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
250	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
251	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
252	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
253	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
254	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
255	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
256	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
257	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
258	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
259	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
260	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
261	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
262	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
263	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
264	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
265	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
266	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
267	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
268	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
269	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
270	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
271	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
272	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
273	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
274	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
275	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
276	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
277	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
278	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
279	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
280	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
281	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
282	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
283	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
284	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
285	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
286	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
287	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
288	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
289	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
290	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
291	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
292	8004021418	Arthrobacter sp. SDTb3-6	Isolate	Rhizosphere
293	8047893842	Streptomyces cangkringensis DSM 41769	Isolate	Rhizosphere
294	8048127548	Streptomyces samsunensis DSM 42010	Isolate	Rhizosphere
295	8048356638	Streptomyces rhizosphaericus DSM 41760	Isolate	Rhizosphere
296	8048369669	Streptomyces indonesiensis DSM 41759	Isolate	Rhizoplane
297	8048379754	Streptomyces asiaticus DSM 41761	Isolate	Rhizosphere
298	8054609563	Nocardioides astragali CGMCC 4.7327	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	88.87
Metatranscriptomes	0.64
Isolates	10.49

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	7.71
Nodule	0.21
Rhizoplane	4.71
Rhizosphere	80.09
Stem	0
Stem Tuber	0.21
Unclassified	7.07

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24735J21928_10000896	3300002067	Bacteria	10630
2	JGI25164J39214_1000209	3300002772	Bacteria	49837
3	JGI25406J46586_10016359	3300003203	Bacteria	3094
4	JGI25165J46597_1000125	3300003214	Bacteria	131155
5	JGI25407J50210_10006374	3300003373	Bacteria	2935
6	Ga0006562J51391_1039374	3300003578	Bacteria	8300
7	Ga0006562J51391_1039375	3300003578	Bacteria	6460
8	Ga0055539_1000135	3300003752	Bacteria	77054
9	Ga0055533_1000002	3300003756	Bacteria	1196393
10	Ga0055525_1000303	3300003759	Bacteria	40809
11	Ga0055527_1000003	3300003760	Bacteria	705001
12	Ga0055542_1000005	3300003762	Bacteria	550280
13	Ga0055529_1000006	3300003763	Bacteria	416978
14	Ga0065714_10134965	3300005288	Bacteria	1217
15	Ga0065712_10070108	3300005290	Bacteria	6322
16	Ga0065712_10076426	3300005290	Bacteria	3653
17	Ga0065712_10102694	3300005290	Bacteria	2003
18	Ga0065715_10000761	3300005293	Bacteria	8776
19	Ga0065715_10091184	3300005293	Bacteria	6024
20	Ga0065715_10161758	3300005293	Bacteria	1623
21	Ga0065707_10003867	3300005295	Bacteria	8223
22	Ga0070658_10012281	3300005327	Bacteria	6877
23	Ga0070683_100051384	3300005329	Bacteria	3817
24	Ga0070683_100364559	3300005329	Bacteria	1376
25	Ga0070690_100162040	3300005330	Bacteria	1533
26	Ga0070670_100005842	3300005331	Bacteria	10403
27	Ga0068869_100246976	3300005334	Bacteria	1424
28	Ga0070669_100225850	3300005353	Bacteria	1482
29	Ga0070675_100091582	3300005354	Bacteria	2548
30	Ga0070671_100156986	3300005355	Bacteria	1922
31	Ga0070674_100007915	3300005356	Bacteria	6291
32	Ga0070673_100004563	3300005364	Bacteria	8776
33	Ga0070688_100012579	3300005365	Bacteria	4744
34	Ga0070659_100062576	3300005366	Bacteria	2942
35	Ga0070667_100010206	3300005367	Bacteria	7760
36	Ga0070667_100012184	3300005367	Bacteria	7116
37	Ga0070714_100191361	3300005435	Bacteria	1867
38	Ga0070701_10028877	3300005438	Bacteria	2729
39	Ga0070663_100079630	3300005455	Bacteria	2405
40	Ga0070678_100049590	3300005456	Bacteria	3031
41	Ga0068867_100062454	3300005459	Bacteria	2768
42	Ga0070685_10050602	3300005466	Bacteria	2400
43	Ga0070706_100107311	3300005467	Bacteria	2598
44	Ga0070684_100076632	3300005535	Bacteria	2951
45	Ga0070672_100021279	3300005543	Bacteria	4744
46	Ga0070672_100075412	3300005543	Bacteria	2692
47	Ga0070686_100064064	3300005544	Bacteria	2383
48	Ga0070695_100040810	3300005545	Bacteria	2940
49	Ga0070696_100094293	3300005546	Bacteria	2136
50	Ga0070696_100141754	3300005546	Bacteria	1757
51	Ga0070693_100086912	3300005547	Bacteria	1877
52	Ga0070665_100006880	3300005548	Bacteria	11559
53	Ga0068857_100000853	3300005577	Bacteria	22869
54	Ga0070702_100085087	3300005615	Bacteria	1903
55	Ga0068866_10095551	3300005718	Bacteria	1628
56	Ga0068861_100188818	3300005719	Bacteria	1721
57	Ga0068851_10000025	3300005834	Bacteria	123782
58	Ga0081455_10012206	3300005937	Bacteria	8577
59	Ga0081538_10000415	3300005981	Bacteria	48044
60	Ga0081538_10000449	3300005981	Bacteria	46318
61	Ga0081538_10000469	3300005981	Bacteria	45269
62	Ga0081538_10003715	3300005981	Bacteria	14324
63	Ga0081538_10007061	3300005981	Bacteria	9767
64	Ga0081538_10014092	3300005981	Bacteria	6282
65	Ga0081539_10022545	3300005985	Bacteria	4162
66	Ga0075365_10003450	3300006038	Bacteria	8144
67	Ga0075365_10110168	3300006038	Bacteria	1891
68	Ga0075365_10177881	3300006038	Bacteria	1487
69	Ga0070712_100309062	3300006175	Bacteria	1282
70	Ga0097621_100036969	3300006237	Bacteria	3909
71	Ga0075431_100038508	3300006847	Bacteria	4923
72	Ga0075433_10010181	3300006852	Bacteria	7542
73	Ga0075434_100040521	3300006871	Bacteria	4612
74	Ga0075434_100115183	3300006871	Bacteria	2701
75	Ga0075434_100134404	3300006871	Bacteria	2493
76	Ga0075429_100015638	3300006880	Bacteria	6575
77	Ga0068865_100291645	3300006881	Bacteria	1302
78	Ga0068865_100298352	3300006881	Bacteria	1289
79	Ga0075436_100146474	3300006914	Bacteria	1661
80	Ga0097620_100233014	3300006931	Bacteria	1930
81	Ga0105251_10019669	3300009011	Bacteria	3560
82	Ga0105240_10009903	3300009093	Bacteria	13443
83	Ga0105240_10150075	3300009093	Bacteria	2777
84	Ga0111539_10025034	3300009094	Bacteria	7313
85	Ga0105245_10021961	3300009098	Bacteria	5601
86	Ga0105245_10029727	3300009098	Bacteria	4831
87	Ga0114129_10021913	3300009147	Bacteria	9067
88	Ga0114129_10028998	3300009147	Bacteria	7840
89	Ga0105243_10187091	3300009148	Bacteria	1806
90	Ga0105248_10000262	3300009177	Bacteria	61793
91	Ga0105248_10054304	3300009177	Bacteria	4493
92	Ga0105248_10249476	3300009177	Bacteria	1998
93	Ga0105237_10000270	3300009545	Bacteria	73136
94	Ga0105238_10024310	3300009551	Bacteria	6175
95	Ga0105249_10064058	3300009553	Bacteria	3379
96	Ga0105249_10106154	3300009553	Bacteria	2649
97	Ga0105249_10158714	3300009553	Bacteria	2184
98	Ga0105249_10170551	3300009553	Bacteria	2109
99	Ga0105239_10125154	3300010375	Bacteria	2856
100	Ga0157369_10168473	3300013105	Bacteria	2309
101	Ga0163162_10020386	3300013306	Bacteria	6514
102	Ga0163162_10043533	3300013306	Bacteria	4496
103	Ga0157372_10091630	3300013307	Bacteria	3457
104	Ga0157372_10178378	3300013307	Bacteria	2459
105	Ga0157375_10021045	3300013308	Bacteria	5973
106	Ga0157375_10055525	3300013308	Bacteria	3906
107	Ga0163163_10222179	3300014325	Bacteria	1938
108	Ga0163163_10351181	3300014325	Bacteria	1531
109	Ga0157380_10352701	3300014326	Bacteria	1377
110	Ga0157376_10091992	3300014969	Bacteria	2629
111	Ga0206353_11999121	3300020082	Bacteria	4209
112	Ga0213875_10000094	3300021388	Bacteria	102400
113	Ga0209566_100032	3300025225	Bacteria	338313
114	Ga0209674_100001	3300025226	Bacteria	4013750
115	Ga0209672_100003	3300025228	Bacteria	1560476
116	Ga0209147_101562	3300025229	Bacteria	7817
117	Ga0209563_100001	3300025230	Bacteria	4013775
118	Ga0209563_101227	3300025230	Bacteria	7113
119	Ga0207427_100039	3300025231	Bacteria	291576
120	Ga0209437_100471	3300025233	Bacteria	30810
121	Ga0209258_102715	3300025242	Bacteria	4308
122	Ga0209677_100001	3300025253	Bacteria	4013787
123	Ga0209677_101285	3300025253	Bacteria	11219
124	Ga0209148_1000004	3300025254	Bacteria	1844481
125	Ga0209148_1002434	3300025254	Bacteria	6419
126	Ga0209233_1000014	3300025261	Bacteria	996641
127	Ga0209455_1000046	3300025272	Bacteria	382681
128	Ga0209455_1001428	3300025272	Bacteria	10815
129	Ga0207656_10000001	3300025321	Bacteria	1323684
130	Ga0207653_10021629	3300025885	Bacteria	2040
131	Ga0207688_10014753	3300025901	Bacteria	4240
132	Ga0207645_10003550	3300025907	Bacteria	11807
133	Ga0207654_10000003	3300025911	Bacteria	1030378
134	Ga0207695_10000617	3300025913	Bacteria	71447
135	Ga0207671_10000001	3300025914	Bacteria	1318881
136	Ga0207693_10203655	3300025915	Bacteria	1556
137	Ga0207662_10018087	3300025918	Bacteria	3993
138	Ga0207681_10175395	3300025923	Bacteria	1628
139	Ga0207694_10000047	3300025924	Bacteria	163953
140	Ga0207650_10010795	3300025925	Bacteria	6273
141	Ga0207650_10035285	3300025925	Bacteria	3630
142	Ga0207659_10224294	3300025926	Bacteria	1513
143	Ga0207687_10050228	3300025927	Bacteria	2902
144	Ga0207706_10115747	3300025933	Bacteria	2358
145	Ga0207669_10047862	3300025937	Bacteria	2536
146	Ga0207691_10010771	3300025940	Bacteria	8777
147	Ga0207691_10042563	3300025940	Bacteria	4187
148	Ga0207711_10001508	3300025941	Bacteria	21662
149	Ga0207711_10090077	3300025941	Bacteria	2696
150	Ga0207689_10060653	3300025942	Bacteria	3110
151	Ga0207651_10255246	3300025960	Bacteria	1436
152	Ga0207677_10117013	3300026023	Bacteria	1997
153	Ga0207708_10005458	3300026075	Bacteria	9379
154	Ga0207641_10512118	3300026088	Bacteria	1166
155	Ga0207648_10032866	3300026089	Bacteria	4578
156	Ga0207676_10059363	3300026095	Bacteria	3020
157	Ga0207674_10004791	3300026116	Bacteria	16215
158	Ga0207674_10082720	3300026116	Bacteria	3211
159	Ga0207675_100101657	3300026118	Bacteria	2708
160	Ga0207675_100115789	3300026118	Bacteria	2533
161	Ga0207683_10067125	3300026121	Bacteria	3164
162	Ga0207698_10000292	3300026142	Bacteria	30336
163	Ga0207428_10002855	3300027907	Bacteria	17133
164	Ga0307408_100002120	3300031548	Bacteria	14247
165	Ga0316576_10039075	3300031727	Bacteria	3406
166	Ga0307405_10006610	3300031731	Bacteria	5718
167	Ga0307405_10010415	3300031731	Bacteria	4816
168	Ga0307405_10019132	3300031731	Bacteria	3796
169	Ga0307405_10081153	3300031731	Bacteria	2119
170	Ga0307405_10116955	3300031731	Bacteria	1817
171	Ga0307405_10141800	3300031731	Bacteria	1677
172	Ga0307413_10005231	3300031824	Bacteria	5759
173	Ga0307413_10010298	3300031824	Bacteria	4527
174	Ga0307410_10001987	3300031852	Bacteria	9627
175	Ga0307410_10013096	3300031852	Bacteria	4826
176	Ga0307406_10000246	3300031901	Bacteria	32799
177	Ga0307406_10013199	3300031901	Bacteria	4728
178	Ga0307407_10005115	3300031903	Bacteria	5655
179	Ga0307407_10026733	3300031903	Bacteria	3060
180	Ga0307407_10122117	3300031903	Bacteria	1653
181	Ga0307412_10004024	3300031911	Bacteria	8192
182	Ga0307412_10031927	3300031911	Bacteria	3331
183	Ga0307409_100022800	3300031995	Bacteria	4322
184	Ga0307409_100043313	3300031995	Bacteria	3378
185	Ga0307416_100000577	3300032002	Bacteria	18818
186	Ga0307416_100002752	3300032002	Bacteria	10206
187	Ga0307416_100002878	3300032002	Bacteria	10023
188	Ga0307416_100009993	3300032002	Bacteria	6245
189	Ga0307416_100217142	3300032002	Bacteria	1830
190	Ga0307414_10048799	3300032004	Bacteria	2923
191	Ga0307414_10143398	3300032004	Bacteria	1873
192	Ga0307411_10043999	3300032005	Bacteria	2860
193	Ga0307411_10110415	3300032005	Bacteria	1966
194	Ga0307415_100001508	3300032126	Bacteria	11171
195	Ga0307415_100002670	3300032126	Bacteria	8903
196	Ga0373947_0045858	3300035725	Bacteria	2616
197	Ga0373937_0035614	3300036401	Bacteria	4531
198	Ga0373925_0003129	3300037068	Bacteria	12993
199	Ga0395899_0001362	3300037312	Bacteria	20960
200	Ga0395899_0093478	3300037312	Bacteria	2177
201	Ga0395900_0002420	3300037418	Bacteria	20586
202	Ga0395900_0014292	3300037418	Bacteria	8102
203	Ga0395900_0189991	3300037418	Bacteria	2084
204	Ga0395898_0000611	3300037466	Bacteria	65932
205	Ga0395898_0003913	3300037466	Bacteria	16444
206	Ga0395898_0007607	3300037466	Bacteria	11499
207	Ga0395898_0050925	3300037466	Bacteria	4051
208	Ga0436364_1104800	3300037853	Bacteria	148674
209	Ga0395901_0015026	3300038443	Bacteria	7871
210	Ga0439436_0018773	3300041404	Bacteria	2067
211	Ga0439466_0031147	3300041411	Bacteria	1826
212	Ga0451791_0589260	3300041451	Bacteria	4502
213	Ga0451797_1285924	3300041453	Bacteria	3151
214	Ga0439433_0003505	3300041999	Bacteria	3371
215	Ga0439442_000157	3300042002	Bacteria	17057
216	Ga0439442_008056	3300042002	Bacteria	2130
217	Ga0439448_0001119	3300042005	Bacteria	6757
218	Ga0439449_0015257	3300042007	Bacteria	2886
219	Ga0439449_0072441	3300042007	Bacteria	1269
220	Ga0439454_000454	3300042011	Bacteria	3262
221	Ga0439455_0000565	3300042012	Bacteria	5277
222	Ga0439457_002692	3300042014	Bacteria	5004
223	Ga0439463_000252	3300042016	Bacteria	14850
224	Ga0439463_006938	3300042016	Bacteria	2794
225	Ga0450907_000239	3300042146	Bacteria	18900
226	Ga0439444_0002386	3300042437	Bacteria	2564
227	Ga0439464_0008591	3300042439	Bacteria	2677
228	Ga0439464_0034246	3300042439	Bacteria	1432
229	Ga0439460_0003225	3300042461	Bacteria	3941
230	Ga0439460_0034161	3300042461	Bacteria	1465
231	Ga0450918_000483	3300042531	Bacteria	8504
232	Ga0439440_0000493	3300042993	Bacteria	6600
233	Ga0466972_0009687	3300044658	Bacteria	4835
234	Ga0466972_0040515	3300044658	Bacteria	2269
235	Ga0466966_0038119	3300044684	Bacteria	3097
236	Ga0466961_0014939	3300044693	Bacteria	4986
237	Ga0466970_0007506	3300044765	Bacteria	5468
238	Ga0466970_0012715	3300044765	Bacteria	4305
239	Ga0466970_0015819	3300044765	Bacteria	3883
240	Ga0466970_0149984	3300044765	Bacteria	1287
241	Ga0466957_0050340	3300044842	Bacteria	2535
242	Ga0466960_0017211	3300044901	Bacteria	3146
243	Ga0466960_0049998	3300044901	Bacteria	2014
244	Ga0466960_0125673	3300044901	Bacteria	1348
245	Ga0466959_0026741	3300045049	Bacteria	4278
246	Ga0495592_0116240	3300046454	Bacteria	1888
247	Ga0495582_0096555	3300046473	Bacteria	1652
248	Ga0495639_0003868	3300046475	Bacteria	6428
249	Ga0495664_0009319	3300046477	Bacteria	5490
250	Ga0495584_0132255	3300046491	Bacteria	1266
251	Ga0495628_0261402	3300046516	Unclassified	1290
252	Ga0495665_0016215	3300046531	Bacteria	4014
253	Ga0495640_0143458	3300046533	Bacteria	1538
254	Ga0495587_0084062	3300046536	Bacteria	1843
255	Ga0495609_0084519	3300046538	Bacteria	1385
256	Ga0495656_0072773	3300046615	Bacteria	1531
257	Ga0495661_0159154	3300046665	Bacteria	1214
258	Ga0495624_0090843	3300046690	Bacteria	1884
259	Ga0495600_0043519	3300046809	Bacteria	2929
260	Ga0495600_0051350	3300046809	Bacteria	2691
261	Ga0495581_0000566	3300047315	Bacteria	19224
262	Ga0495581_0001465	3300047315	Bacteria	13112
263	Ga0495581_0020100	3300047315	Bacteria	3876
264	Ga0495593_0016479	3300047673	Bacteria	4167
265	Ga0496104_0015454	3300048907	Bacteria	6913
266	Ga0496104_0031616	3300048907	Bacteria	4923
267	Ga0496104_0174911	3300048907	Bacteria	2057
268	Ga0496105_0045622	3300048908	Bacteria	3616
269	Ga0496107_0116169	3300048910	Bacteria	1969
270	Ga0496108_0051968	3300048911	Bacteria	3433
271	Ga0496108_0216079	3300048911	Bacteria	1665
272	Ga0496109_0026636	3300048912	Bacteria	5158
273	Ga0496110_0011851	3300048913	Bacteria	7159
274	Ga0496110_0049442	3300048913	Bacteria	3689
275	Ga0496110_0076690	3300048913	Bacteria	2972
276	Ga0496111_0084950	3300048914	Bacteria	2314
277	Ga0496112_0031101	3300048915	Bacteria	5173
278	Ga0496113_0056715	3300048916	Bacteria	2942
279	Ga0496113_0081887	3300048916	Bacteria	2475
280	Ga0496113_0088391	3300048916	Bacteria	2384
281	Ga0496114_0034278	3300048917	Bacteria	4187
282	Ga0496114_0077141	3300048917	Bacteria	2809
283	Ga0496115_0163282	3300048918	Bacteria	1841
284	Ga0496117_0003416	3300048920	Bacteria	18472
285	Ga0496119_0000605	3300048922	Bacteria	48474
286	Ga0496120_0008629	3300048923	Bacteria	7361
287	Ga0496126_0066010	3300048929	Bacteria	3236
288	Ga0501031_0008894	3300049568	Bacteria	6529
289	Ga0501031_0009522	3300049568	Bacteria	6322
290	Ga0501031_0031374	3300049568	Bacteria	3466
291	Ga0501031_0040599	3300049568	Bacteria	3038
292	Ga0501032_0007587	3300049569	Bacteria	7918
293	Ga0501032_0028187	3300049569	Bacteria	3859
294	Ga0501032_0184129	3300049569	Bacteria	1367
295	Ga0501033_0021113	3300049570	Bacteria	4915
296	Ga0501033_0052502	3300049570	Bacteria	3021
297	Ga0501033_0063982	3300049570	Bacteria	2707
298	Ga0501034_0191058	3300049571	Bacteria	2010
299	Ga0501034_0349262	3300049571	Bacteria	1408
300	Ga0501036_0002797	3300049572	Bacteria	13825
301	Ga0501036_0022750	3300049572	Bacteria	5277
302	Ga0501036_0058000	3300049572	Bacteria	3280
303	Ga0501036_0154830	3300049572	Bacteria	1933
304	Ga0501037_0016334	3300049573	Bacteria	5462
305	Ga0501037_0121478	3300049573	Bacteria	1878
306	Ga0501037_0339991	3300049573	Bacteria	1037
307	Ga0501038_0001168	3300049574	Bacteria	23828
308	Ga0501038_0007870	3300049574	Bacteria	9824
309	Ga0501038_0014186	3300049574	Bacteria	7259
310	Ga0501038_0039264	3300049574	Bacteria	4141
311	Ga0501039_0000854	3300049575	Bacteria	22023
312	Ga0501039_0015686	3300049575	Bacteria	5795
313	Ga0501039_0017535	3300049575	Bacteria	5492
314	Ga0501039_0017740	3300049575	Bacteria	5460
315	Ga0501039_0028965	3300049575	Bacteria	4265
316	Ga0501039_0070854	3300049575	Bacteria	2708
317	Ga0501039_0129561	3300049575	Bacteria	1980
318	Ga0501040_0000318	3300049576	Bacteria	28390
319	Ga0501040_0001469	3300049576	Bacteria	14949
320	Ga0501040_0130267	3300049576	Bacteria	1768
321	Ga0501041_0000132	3300049577	Bacteria	31908
322	Ga0501041_0001906	3300049577	Bacteria	11691
323	Ga0501042_0000071	3300049578	Bacteria	37532
324	Ga0501042_0005487	3300049578	Bacteria	8174
325	Ga0501042_0020713	3300049578	Bacteria	4577
326	Ga0501042_0134510	3300049578	Bacteria	1782
327	Ga0501042_0196848	3300049578	Bacteria	1454
328	Ga0501043_0009821	3300049579	Bacteria	7502
329	Ga0501043_0099034	3300049579	Bacteria	2291
330	Ga0501046_0000951	3300049580	Bacteria	28425
331	Ga0501046_0004007	3300049580	Bacteria	13451
332	Ga0501046_0096587	3300049580	Bacteria	2270
333	Ga0501048_0000073	3300049582	Bacteria	51904
334	Ga0501048_0000823	3300049582	Bacteria	22873
335	Ga0501048_0005798	3300049582	Bacteria	9391
336	Ga0501067_0056169	3300049583	Bacteria	2182
337	Ga0501070_0000470	3300049586	Bacteria	36645
338	Ga0501070_0037595	3300049586	Bacteria	4041
339	Ga0501071_0000418	3300049587	Bacteria	21141
340	Ga0501071_0005696	3300049587	Bacteria	8035
341	Ga0501071_0010831	3300049587	Bacteria	6117
342	Ga0501071_0057630	3300049587	Bacteria	2808
343	Ga0501071_0110080	3300049587	Bacteria	2035
344	Ga0501072_0000708	3300049588	Bacteria	24229
345	Ga0501072_0014638	3300049588	Bacteria	6012
346	Ga0501072_0025886	3300049588	Bacteria	4571
347	Ga0501072_0032791	3300049588	Bacteria	4068
348	Ga0501072_0081883	3300049588	Bacteria	2559
349	Ga0501073_0237669	3300049589	Bacteria	1258
350	Ga0501074_0000908	3300049590	Bacteria	18954
351	Ga0501074_0002540	3300049590	Bacteria	12724
352	Ga0501074_0005571	3300049590	Bacteria	9058
353	Ga0501074_0044927	3300049590	Bacteria	3196
354	Ga0501074_0148073	3300049590	Bacteria	1679
355	Ga0501075_0002140	3300049591	Bacteria	13070
356	Ga0501075_0004545	3300049591	Bacteria	9403
357	Ga0501075_0040893	3300049591	Bacteria	3473
358	Ga0501075_0049547	3300049591	Bacteria	3157
359	Ga0501075_0106352	3300049591	Bacteria	2133
360	Ga0501076_0000189	3300049592	Bacteria	36863
361	Ga0501076_0031535	3300049592	Bacteria	4134
362	Ga0501076_0046043	3300049592	Bacteria	3446
363	Ga0501076_0137571	3300049592	Bacteria	1983
364	Ga0501077_0000339	3300049593	Bacteria	27568
365	Ga0501077_0019434	3300049593	Bacteria	4297
366	Ga0501079_0000994	3300049741	Bacteria	19578
367	Ga0501079_0003187	3300049741	Bacteria	12017
368	Ga0501080_0011947	3300049742	Bacteria	7954
369	Ga0501081_0002125	3300049743	Bacteria	12397
370	Ga0501081_0003791	3300049743	Bacteria	9685
371	Ga0501081_0103383	3300049743	Bacteria	2016
372	Ga0501083_0000405	3300049744	Bacteria	27489
373	Ga0501083_0020780	3300049744	Bacteria	4564
374	Ga0501083_0024499	3300049744	Bacteria	4181
375	Ga0501083_0084577	3300049744	Bacteria	2100
376	Ga0501035_0008539	3300049822	Bacteria	9538
377	Ga0501044_0003918	3300049823	Bacteria	16685
378	Ga0501044_0016132	3300049823	Bacteria	8030
379	Ga0501044_0266096	3300049823	Bacteria	1652
380	Ga0501045_0000063	3300049824	Bacteria	48972
381	Ga0501045_0030116	3300049824	Bacteria	3927
382	Ga0501045_0032269	3300049824	Bacteria	3795
383	Ga0501045_0129199	3300049824	Bacteria	1878
384	nmdc:mga03n38_61245_c1	3300050490	Bacteria	1713
385	nmdc:mga00v17_33150_c1	3300050491	Bacteria	3058
386	nmdc:mga0yw44_117115_c1	3300050492	Bacteria	1713
387	nmdc:mga0yw44_78153_c1	3300050492	Bacteria	2069
388	nmdc:mga0yw44_92786_c1	3300050492	Bacteria	1911
389	nmdc:mga05p37_34197_c1	3300050507	Bacteria	6224
390	nmdc:mga05p37_39749_c1	3300050507	Bacteria	5776
391	nmdc:mga05p37_56167_c1	3300050507	Bacteria	4847
392	nmdc:mga09592_24797_c1	3300050508	Bacteria	4960
393	nmdc:mga0qj67_22487_c1	3300050509	Bacteria	4843
394	nmdc:mga08y16_4885_c1	3300050511	Bacteria	14001
395	nmdc:mga0n895_118912_c1	3300050512	Bacteria	2663
396	nmdc:mga0n895_431208_c1	3300050512	Bacteria	1332
397	nmdc:mga0n895_81779_c1	3300050512	Bacteria	3219
398	nmdc:mga0rr50_23693_c1	3300050513	Bacteria	4239
399	nmdc:mga0a205_45705_c1	3300050515	Bacteria	4223
400	nmdc:mga0a205_5517_c1	3300050515	Bacteria	11395
401	Ga0495601_0034234	3300053077	Bacteria	3168
402	Ga0495612_0024537	3300053078	Bacteria	2421
403	Ga0500635_0000056	3300053080	Bacteria	73518
404	Ga0500635_0010664	3300053080	Bacteria	2589
405	Ga0500556_0001697	3300053104	Bacteria	8412
406	Ga0500590_005896	3300053148	Bacteria	5934
407	Ga0501084_0000738	3300054114	Bacteria	24966
408	Ga0501084_0003736	3300054114	Bacteria	12361
409	Ga0501084_0010091	3300054114	Bacteria	7803
410	Ga0590075_008831	3300059424	Bacteria	2412
411	Ga0501082_0000289	3300060353	Bacteria	44378
412	Ga0501082_0003288	3300060353	Bacteria	14109
413	Ga0501082_0005371	3300060353	Bacteria	11117
414	Ga0466962_0021604	3300061719	Bacteria	3089
415	Ga0530510_0000375	3300061734	Bacteria	29049
416	Ga0530510_0009177	3300061734	Bacteria	6930
417	Ga0530510_0264941	3300061734	Bacteria	1282

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300009148	Ga0105243_10187091	Ga0105243_101870912	295
2	3300049573	Ga0501037_0339991	Ga0501037_0339991_11_943	304
3	3300050512	nmdc:mga0n895_431208_c1	nmdc:mga0n895_431208_c1_327_1307	322
4	3300009147	Ga0114129_10021913	Ga0114129_100219132	327
5	3300046536	Ga0495587_0084062	Ga0495587_0084062_373_1518	332
6	3300046809	Ga0495600_0051350	Ga0495600_0051350_182_1327	332
7	3300047315	Ga0495581_0020100	Ga0495581_0020100_833_1978	332
8	3300046491	Ga0495584_0132255	Ga0495584_0132255_201_1235	339
9	3300049586	Ga0501070_0037595	Ga0501070_0037595_44_1087	339
10	3300049590	Ga0501074_0148073	Ga0501074_0148073_173_1255	339
11	3300049591	Ga0501075_0049547	Ga0501075_0049547_26_1069	339
12	3300049744	Ga0501083_0084577	Ga0501083_0084577_1047_2081	339
13	3300032005	Ga0307411_10043999	Ga0307411_100439992	355
14	3300035725	Ga0373947_0045858	Ga0373947_0045858_535_1650	355
15	3300044901	Ga0466960_0049998	Ga0466960_0049998_29_1096	355
16	3300046533	Ga0495640_0143458	Ga0495640_0143458_359_1474	355
17	3300046690	Ga0495624_0090843	Ga0495624_0090843_443_1558	355
18	3300053077	Ga0495601_0034234	Ga0495601_0034234_103_1218	355
19	3300053078	Ga0495612_0024537	Ga0495612_0024537_1293_2408	355
20	3300006881	Ga0068865_100298352	Ga0068865_1002983521	356
21	3300009553	Ga0105249_10158714	Ga0105249_101587142	356
22	3300050513	nmdc:mga0rr50_23693_c1	nmdc:mga0rr50_23693_c1_711_1793	356
23	3300009177	Ga0105248_10249476	Ga0105248_102494762	357
24	3300041451	Ga0451791_0589260	Ga0451791_0589260_1597_2688	357
25	3300041453	Ga0451797_1285924	Ga0451797_1285924_1178_2269	357
26	3300005535	Ga0070684_100076632	Ga0070684_1000766321	359
27	3300025885	Ga0207653_10021629	Ga0207653_100216292	359
28	3300005981	Ga0081538_10007061	Ga0081538_100070614	360
29	3300049568	Ga0501031_0031374	Ga0501031_0031374_2095_3201	360
30	3300049571	Ga0501034_0191058	Ga0501034_0191058_891_1997	360
31	3300049573	Ga0501037_0121478	Ga0501037_0121478_471_1577	360
32	3300049576	Ga0501040_0130267	Ga0501040_0130267_192_1298	360
33	3300049578	Ga0501042_0134510	Ga0501042_0134510_408_1514	360
34	3300049587	Ga0501071_0005696	Ga0501071_0005696_6761_7867	360
35	3300049588	Ga0501072_0025886	Ga0501072_0025886_197_1303	360
36	3300061734	Ga0530510_0264941	Ga0530510_0264941_157_1263	360
37	3300005367	Ga0070667_100010206	Ga0070667_1000102066	361
38	3300005981	Ga0081538_10000449	Ga0081538_1000044937	361
39	3300044901	Ga0466960_0125673	Ga0466960_0125673_123_1301	361
40	3300005981	Ga0081538_10000415	Ga0081538_1000041527	362
41	3300005981	Ga0081538_10003715	Ga0081538_1000371513	364
42	3300005981	Ga0081538_10014092	Ga0081538_100140925	364
43	3300006038	Ga0075365_10177881	Ga0075365_101778812	365
44	3300036401	Ga0373937_0035614	Ga0373937_0035614_2031_3188	365
45	3300046454	Ga0495592_0116240	Ga0495592_0116240_308_1465	365
46	3300050490	nmdc:mga03n38_61245_c1	nmdc:mga03n38_61245_c1_374_1510	365
47	3300050492	nmdc:mga0yw44_92786_c1	nmdc:mga0yw44_92786_c1_606_1730	365
48	3300042002	Ga0439442_000157	Ga0439442_000157_130_1281	366
49	3300042007	Ga0439449_0015257	Ga0439449_0015257_1465_2616	366
50	3300042146	Ga0450907_000239	Ga0450907_000239_11045_12196	366
51	3300042531	Ga0450918_000483	Ga0450918_000483_809_1960	366
52	3300046477	Ga0495664_0009319	Ga0495664_0009319_479_1624	366
53	3300047315	Ga0495581_0001465	Ga0495581_0001465_63_1193	366
54	3300049823	Ga0501044_0003918	Ga0501044_0003918_13594_14853	366
55	3300005435	Ga0070714_100191361	Ga0070714_1001913612	367
56	3300049575	Ga0501039_0017535	Ga0501039_0017535_1165_2301	367
57	3300049587	Ga0501071_0110080	Ga0501071_0110080_508_1644	367
58	iso_pu_bacteria	8054609563	8054614428	367
59	3300003203	JGI25406J46586_10016359	JGI25406J46586_100163592	368
60	3300046665	Ga0495661_0159154	Ga0495661_0159154_28_1149	368
61	3300049572	Ga0501036_0058000	Ga0501036_0058000_55_1185	368
62	3300049574	Ga0501038_0039264	Ga0501038_0039264_2855_3985	368
63	3300049580	Ga0501046_0096587	Ga0501046_0096587_41_1171	368
64	3300049592	Ga0501076_0137571	Ga0501076_0137571_837_1967	368
65	3300049742	Ga0501080_0011947	Ga0501080_0011947_81_1211	368
66	3300049824	Ga0501045_0030116	Ga0501045_0030116_2491_3621	368
67	iso_pu_bacteria	2808606371	2808897166	368
68	3300005293	Ga0065715_10091184	Ga0065715_100911843	369
69	3300005334	Ga0068869_100246976	Ga0068869_1002469761	369
70	3300005355	Ga0070671_100156986	Ga0070671_1001569863	369
71	3300005356	Ga0070674_100007915	Ga0070674_1000079156	369
72	3300005455	Ga0070663_100079630	Ga0070663_1000796303	369
73	3300005467	Ga0070706_100107311	Ga0070706_1001073112	369
74	3300005545	Ga0070695_100040810	Ga0070695_1000408102	369
75	3300005546	Ga0070696_100141754	Ga0070696_1001417542	369
76	3300006038	Ga0075365_10003450	Ga0075365_100034508	369
77	3300006871	Ga0075434_100115183	Ga0075434_1001151832	369
78	3300009553	Ga0105249_10170551	Ga0105249_101705512	369
79	3300025925	Ga0207650_10035285	Ga0207650_100352854	369
80	3300037068	Ga0373925_0003129	Ga0373925_0003129_2248_3369	369
81	3300042461	Ga0439460_0034161	Ga0439460_0034161_129_1250	369
82	3300046516	Ga0495628_0261402	Ga0495628_0261402_119_1243	369
83	3300046809	Ga0495600_0043519	Ga0495600_0043519_1743_2867	369
84	3300048916	Ga0496113_0081887	Ga0496113_0081887_1199_2323	369
85	3300049568	Ga0501031_0040599	Ga0501031_0040599_1485_2630	369
86	3300049575	Ga0501039_0070854	Ga0501039_0070854_1212_2357	369
87	3300049575	Ga0501039_0129561	Ga0501039_0129561_390_1511	369
88	3300049587	Ga0501071_0057630	Ga0501071_0057630_942_2063	369
89	3300049588	Ga0501072_0032791	Ga0501072_0032791_1087_2208	369
90	3300049588	Ga0501072_0081883	Ga0501072_0081883_1428_2549	369
91	3300049591	Ga0501075_0106352	Ga0501075_0106352_352_1473	369
92	3300049592	Ga0501076_0046043	Ga0501076_0046043_146_1267	369
93	3300049743	Ga0501081_0103383	Ga0501081_0103383_725_1846	369
94	3300049824	Ga0501045_0032269	Ga0501045_0032269_366_1487	369
95	3300049824	Ga0501045_0129199	Ga0501045_0129199_170_1291	369
96	3300050492	nmdc:mga0yw44_117115_c1	nmdc:mga0yw44_117115_c1_452_1573	369
97	3300050512	nmdc:mga0n895_118912_c1	nmdc:mga0n895_118912_c1_443_1564	369
98	3300005288	Ga0065714_10134965	Ga0065714_101349651	370
99	3300005290	Ga0065712_10070108	Ga0065712_100701083	370
100	3300005290	Ga0065712_10102694	Ga0065712_101026941	370
101	3300005293	Ga0065715_10000761	Ga0065715_100007616	370
102	3300005293	Ga0065715_10161758	Ga0065715_101617582	370
103	3300005331	Ga0070670_100005842	Ga0070670_1000058423	370
104	3300005353	Ga0070669_100225850	Ga0070669_1002258501	370
105	3300005365	Ga0070688_100012579	Ga0070688_1000125793	370
106	3300005456	Ga0070678_100049590	Ga0070678_1000495903	370
107	3300005459	Ga0068867_100062454	Ga0068867_1000624542	370
108	3300005466	Ga0070685_10050602	Ga0070685_100506023	370
109	3300005543	Ga0070672_100021279	Ga0070672_1000212794	370
110	3300005548	Ga0070665_100006880	Ga0070665_1000068803	370
111	3300005719	Ga0068861_100188818	Ga0068861_1001888181	370
112	3300006175	Ga0070712_100309062	Ga0070712_1003090621	370
113	3300006237	Ga0097621_100036969	Ga0097621_1000369693	370
114	3300006881	Ga0068865_100291645	Ga0068865_1002916452	370
115	3300006931	Ga0097620_100233014	Ga0097620_1002330142	370
116	3300009177	Ga0105248_10054304	Ga0105248_100543043	370
117	3300013306	Ga0163162_10043533	Ga0163162_100435334	370
118	3300014969	Ga0157376_10091992	Ga0157376_100919923	370
119	3300025923	Ga0207681_10175395	Ga0207681_101753952	370
120	3300025925	Ga0207650_10010795	Ga0207650_100107954	370
121	3300025933	Ga0207706_10115747	Ga0207706_101157472	370
122	3300025940	Ga0207691_10042563	Ga0207691_100425634	370
123	3300025941	Ga0207711_10090077	Ga0207711_100900773	370
124	3300026088	Ga0207641_10512118	Ga0207641_105121181	370
125	3300026095	Ga0207676_10059363	Ga0207676_100593632	370
126	3300026118	Ga0207675_100101657	Ga0207675_1001016572	370
127	3300026121	Ga0207683_10067125	Ga0207683_100671252	370
128	3300031731	Ga0307405_10116955	Ga0307405_101169552	370
129	3300048907	Ga0496104_0015454	Ga0496104_0015454_3520_4644	370
130	3300048912	Ga0496109_0026636	Ga0496109_0026636_2946_4070	370
131	3300048913	Ga0496110_0076690	Ga0496110_0076690_119_1243	370
132	3300048915	Ga0496112_0031101	Ga0496112_0031101_1500_2624	370
133	3300049572	Ga0501036_0154830	Ga0501036_0154830_65_1258	370
134	3300049574	Ga0501038_0001168	Ga0501038_0001168_17558_18751	370
135	3300049576	Ga0501040_0001469	Ga0501040_0001469_7416_8609	370
136	3300049587	Ga0501071_0010831	Ga0501071_0010831_3994_5187	370
137	3300049590	Ga0501074_0005571	Ga0501074_0005571_2462_3655	370
138	3300049591	Ga0501075_0040893	Ga0501075_0040893_1174_2367	370
139	3300049592	Ga0501076_0031535	Ga0501076_0031535_2477_3670	370
140	3300054114	Ga0501084_0003736	Ga0501084_0003736_8033_9226	370
141	3300060353	Ga0501082_0005371	Ga0501082_0005371_3083_4276	370
142	3300005290	Ga0065712_10076426	Ga0065712_100764264	371
143	3300005295	Ga0065707_10003867	Ga0065707_100038676	371
144	3300005354	Ga0070675_100091582	Ga0070675_1000915822	371
145	3300005364	Ga0070673_100004563	Ga0070673_1000045632	371
146	3300005438	Ga0070701_10028877	Ga0070701_100288773	371
147	3300005543	Ga0070672_100075412	Ga0070672_1000754122	371
148	3300005544	Ga0070686_100064064	Ga0070686_1000640642	371
149	3300005546	Ga0070696_100094293	Ga0070696_1000942933	371
150	3300005547	Ga0070693_100086912	Ga0070693_1000869122	371
151	3300005615	Ga0070702_100085087	Ga0070702_1000850872	371
152	3300005718	Ga0068866_10095551	Ga0068866_100955512	371
153	3300006871	Ga0075434_100134404	Ga0075434_1001344042	371
154	3300006914	Ga0075436_100146474	Ga0075436_1001464742	371
155	3300010375	Ga0105239_10125154	Ga0105239_101251543	371
156	3300025901	Ga0207688_10014753	Ga0207688_100147534	371
157	3300025907	Ga0207645_10003550	Ga0207645_100035501	371
158	3300025918	Ga0207662_10018087	Ga0207662_100180874	371
159	3300025940	Ga0207691_10010771	Ga0207691_100107716	371
160	3300025960	Ga0207651_10255246	Ga0207651_102552462	371
161	3300026075	Ga0207708_10005458	Ga0207708_100054586	371
162	3300026089	Ga0207648_10032866	Ga0207648_100328664	371
163	3300026118	Ga0207675_100115789	Ga0207675_1001157892	371
164	3300031731	Ga0307405_10019132	Ga0307405_100191323	371
165	3300031903	Ga0307407_10122117	Ga0307407_101221172	371
166	3300031995	Ga0307409_100022800	Ga0307409_1000228004	371
167	3300032002	Ga0307416_100002752	Ga0307416_1000027525	371
168	3300032126	Ga0307415_100001508	Ga0307415_10000150812	371
169	3300049568	Ga0501031_0009522	Ga0501031_0009522_2268_3419	371
170	3300049569	Ga0501032_0028187	Ga0501032_0028187_2261_3412	371
171	3300049570	Ga0501033_0021113	Ga0501033_0021113_2742_3893	371
172	3300049572	Ga0501036_0002797	Ga0501036_0002797_11656_12807	371
173	3300049574	Ga0501038_0007870	Ga0501038_0007870_5625_6776	371
174	3300049575	Ga0501039_0000854	Ga0501039_0000854_12065_13216	371
175	3300049576	Ga0501040_0000318	Ga0501040_0000318_15333_16484	371
176	3300049577	Ga0501041_0001906	Ga0501041_0001906_3147_4298	371
177	3300049578	Ga0501042_0000071	Ga0501042_0000071_6138_7289	371
178	3300049580	Ga0501046_0004007	Ga0501046_0004007_7717_8868	371
179	3300049582	Ga0501048_0000823	Ga0501048_0000823_4812_5963	371
180	3300049583	Ga0501067_0056169	Ga0501067_0056169_114_1262	371
181	3300049587	Ga0501071_0000418	Ga0501071_0000418_11561_12712	371
182	3300049588	Ga0501072_0000708	Ga0501072_0000708_15299_16450	371
183	3300049589	Ga0501073_0237669	Ga0501073_0237669_26_1204	371
184	3300049590	Ga0501074_0002540	Ga0501074_0002540_2865_4016	371
185	3300049591	Ga0501075_0004545	Ga0501075_0004545_3147_4298	371
186	3300049593	Ga0501077_0000339	Ga0501077_0000339_9605_10756	371
187	3300049741	Ga0501079_0000994	Ga0501079_0000994_12461_13612	371
188	3300049743	Ga0501081_0002125	Ga0501081_0002125_2284_3435	371
189	3300049744	Ga0501083_0024499	Ga0501083_0024499_2551_3702	371
190	3300049824	Ga0501045_0000063	Ga0501045_0000063_3147_4298	371
191	3300050507	nmdc:mga05p37_56167_c1	nmdc:mga05p37_56167_c1_231_1376	371
192	3300050515	nmdc:mga0a205_45705_c1	nmdc:mga0a205_45705_c1_2837_3982	371
193	3300054114	Ga0501084_0000738	Ga0501084_0000738_11502_12653	371
194	3300060353	Ga0501082_0003288	Ga0501082_0003288_3147_4298	371
195	3300061734	Ga0530510_0000375	Ga0530510_0000375_11698_12849	371
196	3300003373	JGI25407J50210_10006374	JGI25407J50210_100063743	372
197	3300005329	Ga0070683_100051384	Ga0070683_1000513842	372
198	3300005366	Ga0070659_100062576	Ga0070659_1000625762	372
199	3300005937	Ga0081455_10012206	Ga0081455_100122065	372
200	3300005981	Ga0081538_10000449	Ga0081538_1000044920	372
201	3300005981	Ga0081538_10000469	Ga0081538_1000046940	372
202	3300005985	Ga0081539_10022545	Ga0081539_100225454	372
203	3300006847	Ga0075431_100038508	Ga0075431_1000385084	372
204	3300006852	Ga0075433_10010181	Ga0075433_100101812	372
205	3300006871	Ga0075434_100040521	Ga0075434_1000405212	372
206	3300006880	Ga0075429_100015638	Ga0075429_1000156386	372
207	3300009094	Ga0111539_10025034	Ga0111539_100250343	372
208	3300009553	Ga0105249_10064058	Ga0105249_100640583	372
209	3300025926	Ga0207659_10224294	Ga0207659_102242941	372
210	3300027907	Ga0207428_10002855	Ga0207428_1000285515	372
211	3300031548	Ga0307408_100002120	Ga0307408_1000021203	372
212	3300031731	Ga0307405_10006610	Ga0307405_100066101	372
213	3300031731	Ga0307405_10010415	Ga0307405_100104153	372
214	3300031824	Ga0307413_10005231	Ga0307413_100052314	372
215	3300031824	Ga0307413_10010298	Ga0307413_100102984	372
216	3300031852	Ga0307410_10001987	Ga0307410_100019872	372
217	3300031852	Ga0307410_10013096	Ga0307410_100130963	372
218	3300031901	Ga0307406_10000246	Ga0307406_100002462	372
219	3300031901	Ga0307406_10013199	Ga0307406_100131993	372
220	3300031903	Ga0307407_10005115	Ga0307407_100051152	372
221	3300031903	Ga0307407_10026733	Ga0307407_100267333	372
222	3300031911	Ga0307412_10004024	Ga0307412_100040246	372
223	3300031995	Ga0307409_100043313	Ga0307409_1000433133	372
224	3300032002	Ga0307416_100000577	Ga0307416_1000005773	372
225	3300032002	Ga0307416_100002878	Ga0307416_1000028788	372
226	3300032002	Ga0307416_100217142	Ga0307416_1002171421	372
227	3300032004	Ga0307414_10048799	Ga0307414_100487992	372
228	3300032004	Ga0307414_10143398	Ga0307414_101433982	372
229	3300032005	Ga0307411_10110415	Ga0307411_101104152	372
230	3300032126	Ga0307415_100002670	Ga0307415_1000026706	372
231	3300037466	Ga0395898_0050925	Ga0395898_0050925_277_1431	372
232	3300042005	Ga0439448_0001119	Ga0439448_0001119_2266_3420	372
233	3300042011	Ga0439454_000454	Ga0439454_000454_839_1993	372
234	3300042012	Ga0439455_0000565	Ga0439455_0000565_3087_4241	372
235	3300042016	Ga0439463_000252	Ga0439463_000252_3917_5071	372
236	3300042016	Ga0439463_006938	Ga0439463_006938_1060_2229	372
237	3300042437	Ga0439444_0002386	Ga0439444_0002386_716_1870	372
238	3300042439	Ga0439464_0008591	Ga0439464_0008591_748_1902	372
239	3300042439	Ga0439464_0034246	Ga0439464_0034246_41_1195	372
240	3300042461	Ga0439460_0003225	Ga0439460_0003225_2773_3927	372
241	3300042993	Ga0439440_0000493	Ga0439440_0000493_2552_3706	372
242	3300046538	Ga0495609_0084519	Ga0495609_0084519_172_1326	372
243	3300049568	Ga0501031_0008894	Ga0501031_0008894_1591_2745	372
244	3300049574	Ga0501038_0014186	Ga0501038_0014186_1591_2745	372
245	3300049575	Ga0501039_0017740	Ga0501039_0017740_1304_2458	372
246	3300049577	Ga0501041_0000132	Ga0501041_0000132_3166_4320	372
247	3300049578	Ga0501042_0005487	Ga0501042_0005487_3855_5009	372
248	3300049578	Ga0501042_0196848	Ga0501042_0196848_156_1316	372
249	3300049580	Ga0501046_0000951	Ga0501046_0000951_2998_4152	372
250	3300049582	Ga0501048_0000073	Ga0501048_0000073_39210_40364	372
251	3300049588	Ga0501072_0014638	Ga0501072_0014638_1809_2963	372
252	3300049590	Ga0501074_0000908	Ga0501074_0000908_14748_15902	372
253	3300049591	Ga0501075_0002140	Ga0501075_0002140_2013_3167	372
254	3300049592	Ga0501076_0000189	Ga0501076_0000189_8436_9590	372
255	3300049593	Ga0501077_0019434	Ga0501077_0019434_2478_3632	372
256	3300049741	Ga0501079_0003187	Ga0501079_0003187_6672_7826	372
257	3300049743	Ga0501081_0003791	Ga0501081_0003791_5019_6173	372
258	3300050507	nmdc:mga05p37_39749_c1	nmdc:mga05p37_39749_c1_4494_5648	372
259	3300050508	nmdc:mga09592_24797_c1	nmdc:mga09592_24797_c1_3356_4510	372
260	3300050509	nmdc:mga0qj67_22487_c1	nmdc:mga0qj67_22487_c1_3033_4187	372
261	3300050511	nmdc:mga08y16_4885_c1	nmdc:mga08y16_4885_c1_7029_8183	372
262	3300050512	nmdc:mga0n895_81779_c1	nmdc:mga0n895_81779_c1_1393_2547	372
263	3300050515	nmdc:mga0a205_5517_c1	nmdc:mga0a205_5517_c1_7005_8159	372
264	3300054114	Ga0501084_0010091	Ga0501084_0010091_3484_4638	372
265	3300059424	Ga0590075_008831	Ga0590075_008831_370_1527	372
266	3300060353	Ga0501082_0000289	Ga0501082_0000289_3142_4296	372
267	3300061734	Ga0530510_0009177	Ga0530510_0009177_2327_3481	372
268	3300025937	Ga0207669_10047862	Ga0207669_100478622	373
269	3300031731	Ga0307405_10141800	Ga0307405_101418001	373
270	iso_pu_bacteria	2946024296	2946025937	373
271	iso_pu_bacteria	3002998708	3002999686	373
272	3300005367	Ga0070667_100012184	Ga0070667_1000121844	374
273	3300009147	Ga0114129_10028998	Ga0114129_100289983	374
274	3300037466	Ga0395898_0003913	Ga0395898_0003913_686_1942	374
275	3300041404	Ga0439436_0018773	Ga0439436_0018773_465_1661	374
276	3300049570	Ga0501033_0052502	Ga0501033_0052502_262_1515	374
277	3300050507	nmdc:mga05p37_34197_c1	nmdc:mga05p37_34197_c1_1515_2681	374
278	3300025915	Ga0207693_10203655	Ga0207693_102036552	375
279	3300031731	Ga0307405_10081153	Ga0307405_100811532	375
280	3300032002	Ga0307416_100009993	Ga0307416_1000099933	375
281	3300046473	Ga0495582_0096555	Ga0495582_0096555_425_1618	375
282	3300046475	Ga0495639_0003868	Ga0495639_0003868_4398_5591	375
283	3300046531	Ga0495665_0016215	Ga0495665_0016215_2714_3907	375
284	3300047315	Ga0495581_0000566	Ga0495581_0000566_820_2013	375
285	3300047673	Ga0495593_0016479	Ga0495593_0016479_2016_3209	375
286	iso_pu_bacteria	2808606370	2808894093	375
287	iso_pu_bacteria	2884693830	2884702703	375
288	iso_pu_bacteria	2895427314	2895436415	375
289	iso_pu_bacteria	2895442618	2895452203	375
290	3300044658	Ga0466972_0040515	Ga0466972_0040515_357_1613	376
291	3300048911	Ga0496108_0051968	Ga0496108_0051968_1103_2266	376
292	3300048913	Ga0496110_0011851	Ga0496110_0011851_312_1475	376
293	3300053104	Ga0500556_0001697	Ga0500556_0001697_7205_8353	376
294	iso_pu_bacteria	2582580736	2583151637	376
295	iso_pu_bacteria	2974294766	2974295672	376
296	iso_pu_bacteria	2974324384	2974324525	376
297	iso_pu_bacteria	8004021418	8004022375	376
298	3300041999	Ga0439433_0003505	Ga0439433_0003505_16_1164	377
299	3300042002	Ga0439442_008056	Ga0439442_008056_50_1198	377
300	3300042007	Ga0439449_0072441	Ga0439449_0072441_110_1258	377
301	iso_pu_bacteria	2554235227	2555230629	377
302	iso_pu_bacteria	2654587600	2655031988	377
303	3300044765	Ga0466970_0007506	Ga0466970_0007506_44_1195	378
304	3300044765	Ga0466970_0149984	Ga0466970_0149984_20_1204	378
305	3300009553	Ga0105249_10106154	Ga0105249_101061542	379
306	3300013307	Ga0157372_10091630	Ga0157372_100916304	379
307	3300021388	Ga0213875_10000094	Ga0213875_1000009412	379
308	3300037853	Ga0436364_1104800	Ga0436364_1104800_126067_127236	379
309	3300049572	Ga0501036_0022750	Ga0501036_0022750_2634_3818	379
310	3300049573	Ga0501037_0016334	Ga0501037_0016334_3419_4603	379
311	3300049575	Ga0501039_0028965	Ga0501039_0028965_846_2030	379
312	3300049579	Ga0501043_0009821	Ga0501043_0009821_2860_4044	379
313	3300049582	Ga0501048_0005798	Ga0501048_0005798_530_1714	379
314	3300049590	Ga0501074_0044927	Ga0501074_0044927_1807_2991	379
315	3300049823	Ga0501044_0016132	Ga0501044_0016132_4056_5240	379
316	3300005329	Ga0070683_100364559	Ga0070683_1003645591	380
317	3300005330	Ga0070690_100162040	Ga0070690_1001620402	380
318	3300009093	Ga0105240_10009903	Ga0105240_100099038	380
319	3300009098	Ga0105245_10029727	Ga0105245_100297274	380
320	3300013308	Ga0157375_10055525	Ga0157375_100555254	380
321	3300014325	Ga0163163_10222179	Ga0163163_102221792	380
322	3300025254	Ga0209148_1002434	Ga0209148_10024342	380
323	3300025911	Ga0207654_10000003	Ga0207654_10000003971	380
324	3300025913	Ga0207695_10000617	Ga0207695_1000061743	380
325	3300025927	Ga0207687_10050228	Ga0207687_100502283	380
326	3300026116	Ga0207674_10082720	Ga0207674_100827202	380
327	3300037418	Ga0395900_0014292	Ga0395900_0014292_3625_4821	380
328	3300037466	Ga0395898_0007607	Ga0395898_0007607_5608_6804	380
329	3300038443	Ga0395901_0015026	Ga0395901_0015026_23_1219	380
330	3300048911	Ga0496108_0216079	Ga0496108_0216079_86_1240	380
331	3300048923	Ga0496120_0008629	Ga0496120_0008629_5069_6226	380
332	3300049569	Ga0501032_0007587	Ga0501032_0007587_1757_2992	380
333	3300049569	Ga0501032_0184129	Ga0501032_0184129_17_1159	380
334	3300049570	Ga0501033_0063982	Ga0501033_0063982_178_1320	380
335	3300049575	Ga0501039_0015686	Ga0501039_0015686_77_1312	380
336	3300049579	Ga0501043_0099034	Ga0501043_0099034_201_1436	380
337	3300049744	Ga0501083_0020780	Ga0501083_0020780_2002_3144	380
338	3300031911	Ga0307412_10031927	Ga0307412_100319273	381
339	iso_pu_bacteria	2891395885	2891403195	381
340	iso_pu_bacteria	2870721527	2870723221	382
341	3300003760	Ga0055527_1000003	Ga0055527_1000003160	384
342	3300003762	Ga0055542_1000005	Ga0055542_100000524	384
343	3300003763	Ga0055529_1000006	Ga0055529_1000006160	384
344	3300009011	Ga0105251_10019669	Ga0105251_100196692	384
345	3300025228	Ga0209672_100003	Ga0209672_100003999	384
346	3300025229	Ga0209147_101562	Ga0209147_1015623	384
347	3300025242	Ga0209258_102715	Ga0209258_1027152	384
348	3300025254	Ga0209148_1000004	Ga0209148_10000041294	384
349	3300025272	Ga0209455_1000046	Ga0209455_1000046313	384
350	iso_pu_bacteria	2582581313	2585307917	384
351	iso_pu_bacteria	2643221647	2644268588	384
352	iso_pu_bacteria	2837268691	2837275588	384
353	iso_pu_bacteria	2954691527	2954700961	384
354	iso_pu_bacteria	2954701450	2954706377	384
355	3300006038	Ga0075365_10110168	Ga0075365_101101681	385
356	3300014325	Ga0163163_10351181	Ga0163163_103511812	385
357	3300025942	Ga0207689_10060653	Ga0207689_100606532	385
358	3300026023	Ga0207677_10117013	Ga0207677_101170132	385
359	3300048913	Ga0496110_0049442	Ga0496110_0049442_1787_2968	385
360	3300048914	Ga0496111_0084950	Ga0496111_0084950_256_1419	385
361	3300048917	Ga0496114_0077141	Ga0496114_0077141_801_2015	385
362	3300050491	nmdc:mga00v17_33150_c1	nmdc:mga00v17_33150_c1_666_1850	385
363	3300050492	nmdc:mga0yw44_78153_c1	nmdc:mga0yw44_78153_c1_193_1377	385
364	iso_pu_bacteria	2852643534	2852646451	385
365	iso_pu_bacteria	2939660829	2939662138	385
366	3300031727	Ga0316576_10039075	Ga0316576_100390752	386
367	3300041411	Ga0439466_0031147	Ga0439466_0031147_31_1266	386
368	3300048907	Ga0496104_0174911	Ga0496104_0174911_601_1785	386
369	3300048908	Ga0496105_0045622	Ga0496105_0045622_1968_3152	386
370	3300048916	Ga0496113_0056715	Ga0496113_0056715_672_1856	386
371	3300049823	Ga0501044_0266096	Ga0501044_0266096_105_1382	386
372	3300053148	Ga0500590_005896	Ga0500590_005896_4023_5234	386
373	iso_pu_bacteria	2739367654	2739609750	386
374	iso_pu_bacteria	2808606394	2809029994	386
375	iso_pu_bacteria	2977264416	2977264822	386
376	3300042014	Ga0439457_002692	Ga0439457_002692_2136_3383	387
377	iso_pu_bacteria	2791355406	2793983964	387
378	iso_pu_bacteria	2808606359	2808845090	387
379	iso_pu_bacteria	2811994879	2812354604	387
380	iso_pu_bacteria	2852635781	2852636222	387
381	iso_pu_bacteria	2946064051	2946071065	387
382	iso_pu_bacteria	2947224130	2947225657	387
383	iso_pu_bacteria	8047893842	8047895191	387
384	iso_pu_bacteria	8048127548	8048136616	387
385	iso_pu_bacteria	8048356638	8048363760	387
386	iso_pu_bacteria	8048369669	8048372217	387
387	iso_pu_bacteria	8048379754	8048381151	387
388	3300013306	Ga0163162_10020386	Ga0163162_100203862	388
389	3300013308	Ga0157375_10021045	Ga0157375_100210453	388
390	3300014326	Ga0157380_10352701	Ga0157380_103527011	388
391	3300048910	Ga0496107_0116169	Ga0496107_0116169_618_1850	388
392	iso_pu_bacteria	2643221711	2644611743	388
393	iso_pu_bacteria	2818991458	2819664608	388
394	iso_pu_bacteria	2868088558	2868092460	388
395	iso_pu_bacteria	2868088558	2868093908	388
396	3300046615	Ga0495656_0072773	Ga0495656_0072773_143_1324	389
397	3300048922	Ga0496119_0000605	Ga0496119_0000605_46684_47865	389
398	iso_pu_bacteria	2643221616	2644094816	389
399	3300049578	Ga0501042_0020713	Ga0501042_0020713_2785_3957	390
400	3300049744	Ga0501083_0000405	Ga0501083_0000405_10639_11811	390
401	iso_pu_bacteria	2808606306	2808629755	390
402	iso_pu_bacteria	2919523602	2919527062	390
403	3300005327	Ga0070658_10012281	Ga0070658_100122814	391
404	3300005577	Ga0068857_100000853	Ga0068857_1000008539	391
405	3300005834	Ga0068851_10000025	Ga0068851_1000002547	391
406	3300009093	Ga0105240_10150075	Ga0105240_101500751	391
407	3300009098	Ga0105245_10021961	Ga0105245_100219613	391
408	3300009177	Ga0105248_10000262	Ga0105248_1000026240	391
409	3300009545	Ga0105237_10000270	Ga0105237_1000027043	391
410	3300009551	Ga0105238_10024310	Ga0105238_100243103	391
411	3300025321	Ga0207656_10000001	Ga0207656_10000001668	391
412	3300025914	Ga0207671_10000001	Ga0207671_10000001667	391
413	3300025924	Ga0207694_10000047	Ga0207694_10000047111	391
414	3300025941	Ga0207711_10001508	Ga0207711_1000150814	391
415	3300026116	Ga0207674_10004791	Ga0207674_1000479110	391
416	3300026142	Ga0207698_10000292	Ga0207698_100002928	391
417	3300048929	Ga0496126_0066010	Ga0496126_0066010_1735_2934	391
418	3300053080	Ga0500635_0010664	Ga0500635_0010664_1073_2263	391
419	iso_pu_bacteria	2844841374	2844845212	391
420	iso_pu_bacteria	2884763398	2884764175	391
421	iso_pu_bacteria	2919055335	2919057004	391
422	iso_pu_bacteria	2928153084	2928154760	391
423	iso_pu_bacteria	2928121344	2928124050	392
424	3300044842	Ga0466957_0050340	Ga0466957_0050340_1011_2195	394
425	3300049571	Ga0501034_0349262	Ga0501034_0349262_65_1249	394
426	3300053080	Ga0500635_0000056	Ga0500635_0000056_67168_68355	394
427	3300002067	JGI24735J21928_10000896	JGI24735J21928_100008964	395
428	3300002772	JGI25164J39214_1000209	JGI25164J39214_10002097	395
429	3300003214	JGI25165J46597_1000125	JGI25165J46597_1000125105	395
430	3300003578	Ga0006562J51391_1039374	Ga0006562J51391_10393745	395
431	3300003578	Ga0006562J51391_1039375	Ga0006562J51391_10393751	395
432	3300003752	Ga0055539_1000135	Ga0055539_100013569	395
433	3300003756	Ga0055533_1000002	Ga0055533_100000216	395
434	3300003759	Ga0055525_1000303	Ga0055525_100030331	395
435	3300013105	Ga0157369_10168473	Ga0157369_101684732	395
436	3300013307	Ga0157372_10178378	Ga0157372_101783782	395
437	3300020082	Ga0206353_11999121	Ga0206353_119991214	395
438	3300025225	Ga0209566_100032	Ga0209566_10003216	395
439	3300025226	Ga0209674_100001	Ga0209674_1000013550	395
440	3300025230	Ga0209563_100001	Ga0209563_1000013550	395
441	3300025230	Ga0209563_101227	Ga0209563_1012272	395
442	3300025231	Ga0207427_100039	Ga0207427_100039152	395
443	3300025233	Ga0209437_100471	Ga0209437_1004717	395
444	3300025253	Ga0209677_100001	Ga0209677_1000013550	395
445	3300025253	Ga0209677_101285	Ga0209677_1012855	395
446	3300025261	Ga0209233_1000014	Ga0209233_1000014366	395
447	3300025272	Ga0209455_1001428	Ga0209455_10014288	395
448	3300037312	Ga0395899_0001362	Ga0395899_0001362_2067_3254	395
449	3300037312	Ga0395899_0093478	Ga0395899_0093478_472_1659	395
450	3300037418	Ga0395900_0002420	Ga0395900_0002420_829_2016	395
451	3300037418	Ga0395900_0189991	Ga0395900_0189991_880_2073	395
452	3300037466	Ga0395898_0000611	Ga0395898_0000611_27053_28240	395
453	3300044658	Ga0466972_0009687	Ga0466972_0009687_3210_4397	395
454	3300044684	Ga0466966_0038119	Ga0466966_0038119_149_1336	395
455	3300044693	Ga0466961_0014939	Ga0466961_0014939_844_2031	395
456	3300044765	Ga0466970_0012715	Ga0466970_0012715_981_2168	395
457	3300044765	Ga0466970_0015819	Ga0466970_0015819_1561_2748	395
458	3300044901	Ga0466960_0017211	Ga0466960_0017211_1566_2753	395
459	3300045049	Ga0466959_0026741	Ga0466959_0026741_2391_3578	395
460	3300048907	Ga0496104_0031616	Ga0496104_0031616_2100_3287	395
461	3300048916	Ga0496113_0088391	Ga0496113_0088391_410_1597	395
462	3300048917	Ga0496114_0034278	Ga0496114_0034278_1876_3063	395
463	3300048918	Ga0496115_0163282	Ga0496115_0163282_174_1361	395
464	3300048920	Ga0496117_0003416	Ga0496117_0003416_13804_14991	395
465	3300049586	Ga0501070_0000470	Ga0501070_0000470_10095_11282	395
466	3300049822	Ga0501035_0008539	Ga0501035_0008539_3808_4995	395
467	3300061719	Ga0466962_0021604	Ga0466962_0021604_1141_2328	395

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

147

295

0.98 PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

10

139

0.83 PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

151

394

0.77 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4h3v-assembly1.cif.gz_B	crystal structure of oxidoreductase domain protein from kribbella flavida	0.9821	6	395
6a3j-assembly1.cif.gz_D	levoglucosan dehydrogenase, complex with nadh and l-sorbose	0.9773	6	395
6a3g-assembly1.cif.gz_B	levoglucosan dehydrogenase, complex with nadh	0.976	7	395
6a3i-assembly1.cif.gz_B	levoglucosan dehydrogenase, complex with nadh and levoglucosan	0.9754	7	395
6a3i-assembly1.cif.gz_C	levoglucosan dehydrogenase, complex with nadh and levoglucosan	0.9748	7	395

ID	Description	Score	Start	End	Superfamily
4h3vB01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9866	7	141	3.40.50.720
4h3vB02	Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2	0.9771	142	395	3.30.360.10
4h3vB01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.972	7	141	3.40.50.720
4h3vB02	Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2	0.969	142	395	3.30.360.10
6a3iB02	Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2	0.9686	143	395	3.30.360.10

ID	Description	Score	Start	End	GO Terms
AF-A0A1Q2CRU2-F1-model_v4	Dehydrogenase	0.9854	5	394	GO:0000166 GO:0016491
AF-A0A2E0QS28-F1-model_v4	Dehydrogenase	0.9848	6	395	GO:0000166 GO:0016491
AF-A0A429PCB5-F1-model_v4	deleted	0.9838	244	395
AF-A0A351ACE2-F1-model_v4	Dehydrogenase	0.982	5	296	GO:0000166 GO:0016491
AF-A0A363TCZ5-F1-model_v4	Dehydrogenase	0.9815	6	394	GO:0000166 GO:0016491

Feature Viewer

pLDDT	pTM	Quality
94.58	0.92	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F449927

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

147

295

0.98

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

10

139

0.83

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

151

394

0.77

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map