F449908

General Info

Members Datasets Scaffolds Average Seq Length
467 300 934 548

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0002994|Ga0496105_0002994_8867_10783
Length 624
Sequence MHDAAGGDLFRPGGSLVLTLATRVPRWRVQMAMNCVAKWLGLLRCPAQNDKQASSAYDATDLSQRSCRAAPSVAEQPTSSDHWGNTMSYFDLGPYTRKITTSSPDAQLWFDRGLNWMFGFNHAEAIKCFKEALKHDPECAMAHWGISYASGPNYNLPWHLYDPQGRQMALSAAYDAMQIALGKAGKASAVEKAMIEALPARYPQRDMIDDMAPWDKAFTKAMRKVFEVYPDDLEVRAVFAESIMNETPWEMWDLRSGKAAEGAGTEECKTILEHAFNTMPAAWDHPGLLHLYVHLMEMSPFPQRALRVGDRLREIVPDSGHLIHMPTHLDVLCGQYHDVLVYNQKALARDRRFLAYSSDPGVYLVYVIHNFHFAIYGAMFLGQYQPAIAAAEELIATVPEAVLRIESPPMADFLEGYLTMKQHVLVRFGKWREIIAQKLPEDHQLYCSNAAMLHYAKAVAHSALGNVARVPESRRVHNNTMVDLLGVAEEMLKGELEYRKGNHDSAFAHLRKSVDLDDALPYDEPWGWMQPTRHALGALLLEQGRIDEAEAVYRSDLGLDGKLSRACQHPDNLWSLHGLHECLTRRGEKVEAALIRPRLDLAVARAEVPIKASCFCRRVAMAAE

Samples

Sample ID Description Type Environment
1 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
147 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
157 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
158 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
159 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
160 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
161 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
162 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
163 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
168 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
230 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
234 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
237 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
251 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
252 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
253 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
257 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
258 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
259 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
260 2643221647 Streptomyces sp. Root369 Isolate Unclassified
261 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
262 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
263 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
264 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
265 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
266 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
267 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
268 2808606448 Streptomyces sp. 193411 Isolate Unclassified
269 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
270 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
271 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
272 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
273 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
274 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
275 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
276 2867428634 Streptomyces sp. RP5T Isolate Unclassified
277 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
278 2904699407
279 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
280 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
281 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
282 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
283 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
284 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
285 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
286 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
287 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
288 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
289 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
290 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
291 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
292 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
293 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
294 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
295 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
296 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
297 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
298 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
299 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
300 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.77
Metatranscriptomes 0
Isolates 9.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.85
Nodule 1.07
Rhizoplane 3.85
Rhizosphere 80.73
Stem 0
Stem Tuber 0
Unclassified 0.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496105_0002994 3300048908 Bacteria 12424
2 JGI25153J46596_10005581 3300003215 Bacteria 6577
3 rootH2_10019759 3300003320 Bacteria 2143
4 rootL2_10129932 3300003322 Bacteria 3067
5 rootH1_10009247 3300003323 Bacteria 2784
6 Ga0055528_1001620 3300003790 Eukaryota 13292
7 Ga0065707_10099824 3300005295 Bacteria 2976
8 Ga0070658_10029819 3300005327 Unclassified 4382
9 Ga0070676_10013176 3300005328 Bacteria 4529
10 Ga0070683_100021297 3300005329 Bacteria 5784
11 Ga0070683_100037449 3300005329 Bacteria 4440
12 Ga0070683_100059727 3300005329 Bacteria 3543
13 Ga0068869_100009405 3300005334 Bacteria 6342
14 Ga0068869_100017870 3300005334 Bacteria 4818
15 Ga0070680_100094249 3300005336 Bacteria 2481
16 Ga0070682_100004932 3300005337 Bacteria 7409
17 Ga0070660_100020868 3300005339 Bacteria 4822
18 Ga0070661_100014715 3300005344 Bacteria 5517
19 Ga0070692_10023916 3300005345 Bacteria 2998
20 Ga0070668_100008936 3300005347 Bacteria 7438
21 Ga0070659_100071699 3300005366 Bacteria 2755
22 Ga0070703_10013351 3300005406 Bacteria 2332
23 Ga0070709_10002018 3300005434 Bacteria 11030
24 Ga0070714_100105296 3300005435 Bacteria 2490
25 Ga0070713_100002399 3300005436 Bacteria 12218
26 Ga0070713_100008582 3300005436 Bacteria 7255
27 Ga0070710_10000254 3300005437 Bacteria 25267
28 Ga0070711_100017900 3300005439 Bacteria 4516
29 Ga0070705_100002562 3300005440 Bacteria 9134
30 Ga0070708_100173418 3300005445 Bacteria 2014
31 Ga0070663_100026826 3300005455 Bacteria 3905
32 Ga0070663_100104788 3300005455 Bacteria 2116
33 Ga0070678_100017616 3300005456 Bacteria 4607
34 Ga0070678_100053627 3300005456 Bacteria 2933
35 Ga0070662_100051591 3300005457 Bacteria 2971
36 Ga0070706_100035266 3300005467 Bacteria 4620
37 Ga0070706_100112959 3300005467 Bacteria 2530
38 Ga0070698_100000532 3300005471 Bacteria 40626
39 Ga0070684_100010326 3300005535 Bacteria 7396
40 Ga0070697_100025217 3300005536 Bacteria 4741
41 Ga0068853_100048756 3300005539 Bacteria 3639
42 Ga0070695_100000923 3300005545 Bacteria 15827
43 Ga0070695_100009112 3300005545 Bacteria 5901
44 Ga0070695_100049573 3300005545 Bacteria 2688
45 Ga0070696_100020908 3300005546 Bacteria 4435
46 Ga0070696_100094137 3300005546 Bacteria 2137
47 Ga0070693_100083961 3300005547 Bacteria 1905
48 Ga0070665_100021001 3300005548 Bacteria 6564
49 Ga0070665_100054172 3300005548 Bacteria 4023
50 Ga0070665_100144928 3300005548 Bacteria 2378
51 Ga0070704_100004354 3300005549 Bacteria 8177
52 Ga0068855_100015073 3300005563 Bacteria 9308
53 Ga0068855_100071599 3300005563 Bacteria 4031
54 Ga0068855_100082506 3300005563 Bacteria 3725
55 Ga0068855_100146332 3300005563 Bacteria 2689
56 Ga0068855_100188418 3300005563 Bacteria 2328
57 Ga0070664_100009896 3300005564 Bacteria 7727
58 Ga0070664_100078652 3300005564 Bacteria 2837
59 Ga0070664_100110520 3300005564 Bacteria 2398
60 Ga0070664_100113211 3300005564 Bacteria 2370
61 Ga0070664_100121266 3300005564 Bacteria 2290
62 Ga0068857_100008822 3300005577 Bacteria 8734
63 Ga0068857_100013062 3300005577 Bacteria 7235
64 Ga0068854_100022423 3300005578 Bacteria 4301
65 Ga0068856_100002141 3300005614 Bacteria 20471
66 Ga0068856_100059802 3300005614 Bacteria 3764
67 Ga0068856_100080046 3300005614 Bacteria 3240
68 Ga0068852_100056186 3300005616 Bacteria 3400
69 Ga0068864_100010052 3300005618 Bacteria 7813
70 Ga0068861_100013725 3300005719 Bacteria 5672
71 Ga0068858_100090443 3300005842 Bacteria 2848
72 Ga0068858_100162050 3300005842 Bacteria 2106
73 Ga0068860_100044380 3300005843 Bacteria 4237
74 Ga0068862_100053250 3300005844 Bacteria 3464
75 Ga0068862_100089674 3300005844 Bacteria 2676
76 Ga0081455_10000034 3300005937 Bacteria 138695
77 Ga0081455_10000824 3300005937 Bacteria 39882
78 Ga0081455_10002830 3300005937 Bacteria 20425
79 Ga0081455_10006841 3300005937 Bacteria 12149
80 Ga0081455_10012605 3300005937 Bacteria 8426
81 Ga0081455_10020915 3300005937 Bacteria 6149
82 Ga0081455_10061749 3300005937 Bacteria 3152
83 Ga0081540_1001552 3300005983 Bacteria 19684
84 Ga0081539_10005890 3300005985 Bacteria 12133
85 Ga0081539_10009393 3300005985 Bacteria 8186
86 Ga0070717_10034400 3300006028 Bacteria 4096
87 Ga0075365_10016332 3300006038 Bacteria 4513
88 Ga0075365_10027549 3300006038 Bacteria 3617
89 Ga0075365_10044483 3300006038 Bacteria 2909
90 Ga0075363_100003330 3300006048 Bacteria 6816
91 Ga0075363_100029458 3300006048 Bacteria 2834
92 Ga0075364_10026574 3300006051 Bacteria 3693
93 Ga0075367_10001395 3300006178 Bacteria 10345
94 Ga0075367_10013417 3300006178 Bacteria 4403
95 Ga0075367_10071442 3300006178 Bacteria 2088
96 Ga0075367_10086120 3300006178 Bacteria 1907
97 Ga0075370_10015789 3300006353 Bacteria 4051
98 Ga0075370_10018211 3300006353 Bacteria 3807
99 Ga0075428_100020349 3300006844 Bacteria 7349
100 Ga0075428_100026757 3300006844 Bacteria 6387
101 Ga0075428_100065471 3300006844 Bacteria 3980
102 Ga0075431_100017734 3300006847 Bacteria 7238
103 Ga0075431_100033983 3300006847 Bacteria 5255
104 Ga0075431_100087196 3300006847 Bacteria 3221
105 Ga0075431_100105489 3300006847 Bacteria 2908
106 Ga0075434_100032903 3300006871 Bacteria 5114
107 Ga0075434_100036634 3300006871 Bacteria 4853
108 Ga0075434_100052054 3300006871 Bacteria 4068
109 Ga0075429_100020205 3300006880 Bacteria 5775
110 Ga0075429_100061823 3300006880 Bacteria 3263
111 Ga0075429_100068322 3300006880 Bacteria 3092
112 Ga0068865_100024028 3300006881 Bacteria 3995
113 Ga0075435_100008679 3300007076 Bacteria 7308
114 Ga0105240_10006825 3300009093 Bacteria 16697
115 Ga0105240_10008006 3300009093 Bacteria 15223
116 Ga0105240_10036879 3300009093 Bacteria 6285
117 Ga0111539_10017581 3300009094 Bacteria 8849
118 Ga0111539_10091029 3300009094 Bacteria 3584
119 Ga0105247_10037026 3300009101 Bacteria 2976
120 Ga0114129_10032016 3300009147 Bacteria 7433
121 Ga0114129_10045315 3300009147 Bacteria 6183
122 Ga0114129_10074782 3300009147 Bacteria 4718
123 Ga0114129_10095150 3300009147 Bacteria 4125
124 Ga0114129_10173729 3300009147 Bacteria 2936
125 Ga0105241_10047876 3300009174 Bacteria 3252
126 Ga0105242_10012954 3300009176 Bacteria 6430
127 Ga0105248_10198296 3300009177 Bacteria 2262
128 Ga0105237_10034150 3300009545 Bacteria 5152
129 Ga0105237_10072339 3300009545 Bacteria 3442
130 Ga0105237_10145115 3300009545 Bacteria 2368
131 Ga0105238_10073720 3300009551 Bacteria 3408
132 Ga0105239_10000035 3300010375 Eukaryota 213997
133 Ga0105239_10019786 3300010375 Bacteria 7430
134 Ga0105239_10030387 3300010375 Bacteria 5940
135 Ga0105239_10126485 3300010375 Bacteria 2841
136 Ga0105239_10157134 3300010375 Bacteria 2540
137 Ga0105246_10024677 3300011119 Bacteria 3909
138 Ga0105246_10057772 3300011119 Bacteria 2686
139 Ga0105246_10075447 3300011119 Bacteria 2387
140 Ga0157373_10053685 3300013100 Bacteria 2865
141 Ga0157370_10046941 3300013104 Bacteria 4140
142 Ga0157369_10009628 3300013105 Bacteria 11049
143 Ga0157372_10070197 3300013307 Bacteria 3941
144 Ga0157372_10117290 3300013307 Bacteria 3053
145 Ga0157380_10095613 3300014326 Bacteria 2462
146 Ga0157377_10063804 3300014745 Bacteria 2111
147 Ga0163161_10098613 3300017792 Bacteria 2172
148 Ga0213876_10013498 3300021384 Bacteria 4335
149 Ga0213875_10050861 3300021388 Unclassified 1941
150 Ga0209673_1000349 3300025273 Eukaryota 84880
151 Ga0207710_10030631 3300025900 Bacteria 2348
152 Ga0207688_10081129 3300025901 Bacteria 1852
153 Ga0207647_10046108 3300025904 Bacteria 2717
154 Ga0207699_10000301 3300025906 Bacteria 26519
155 Ga0207699_10006892 3300025906 Bacteria 5528
156 Ga0207645_10022952 3300025907 Bacteria 4054
157 Ga0207643_10062299 3300025908 Bacteria 2131
158 Ga0207684_10113362 3300025910 Bacteria 2321
159 Ga0207654_10002057 3300025911 Bacteria 10321
160 Ga0207654_10028154 3300025911 Bacteria 3062
161 Ga0207707_10001103 3300025912 Bacteria 25698
162 Ga0207695_10005593 3300025913 Bacteria 16599
163 Ga0207695_10013621 3300025913 Bacteria 9683
164 Ga0207695_10127834 3300025913 Bacteria 2501
165 Ga0207671_10021235 3300025914 Bacteria 4930
166 Ga0207693_10003773 3300025915 Bacteria 12907
167 Ga0207663_10017094 3300025916 Bacteria 4035
168 Ga0207657_10000061 3300025919 Bacteria 100578
169 Ga0207649_10018550 3300025920 Bacteria 3960
170 Ga0207646_10059761 3300025922 Bacteria 3404
171 Ga0207646_10224686 3300025922 Bacteria 1696
172 Ga0207650_10049526 3300025925 Bacteria 3102
173 Ga0207687_10010511 3300025927 Bacteria 6047
174 Ga0207700_10012805 3300025928 Bacteria 5424
175 Ga0207700_10071908 3300025928 Bacteria 2665
176 Ga0207664_10002373 3300025929 Bacteria 12445
177 Ga0207664_10018427 3300025929 Bacteria 5139
178 Ga0207664_10031317 3300025929 Bacteria 4069
179 Ga0207644_10127144 3300025931 Bacteria 1947
180 Ga0207706_10049292 3300025933 Bacteria 3722
181 Ga0207686_10029723 3300025934 Bacteria 3227
182 Ga0207709_10043731 3300025935 Bacteria 2702
183 Ga0207665_10002744 3300025939 Bacteria 11806
184 Ga0207665_10030666 3300025939 Bacteria 3555
185 Ga0207711_10016718 3300025941 Bacteria 6092
186 Ga0207689_10020942 3300025942 Bacteria 5497
187 Ga0207689_10109965 3300025942 Bacteria 2265
188 Ga0207661_10001258 3300025944 Bacteria 16948
189 Ga0207661_10021820 3300025944 Bacteria 4806
190 Ga0207679_10043635 3300025945 Bacteria 3230
191 Ga0207679_10128253 3300025945 Bacteria 2031
192 Ga0207667_10013799 3300025949 Bacteria 9230
193 Ga0207667_10033608 3300025949 Bacteria 5512
194 Ga0207640_10018927 3300025981 Bacteria 4057
195 Ga0207677_10021883 3300026023 Bacteria 3918
196 Ga0207703_10104929 3300026035 Bacteria 2402
197 Ga0207639_10002394 3300026041 Bacteria 12579
198 Ga0207678_10003579 3300026067 Bacteria 13970
199 Ga0207678_10049981 3300026067 Bacteria 3612
200 Ga0207708_10012256 3300026075 Bacteria 6391
201 Ga0207708_10086951 3300026075 Bacteria 2406
202 Ga0207702_10000325 3300026078 Bacteria 54690
203 Ga0207702_10025792 3300026078 Bacteria 4880
204 Ga0207702_10117573 3300026078 Bacteria 2374
205 Ga0207648_10042925 3300026089 Bacteria 3971
206 Ga0207674_10003985 3300026116 Bacteria 17948
207 Ga0207674_10007388 3300026116 Bacteria 12800
208 Ga0207674_10019619 3300026116 Bacteria 7321
209 Ga0207675_100012665 3300026118 Bacteria 7879
210 Ga0207683_10046878 3300026121 Bacteria 3784
211 Ga0207683_10116380 3300026121 Bacteria 2396
212 Ga0207683_10126231 3300026121 Bacteria 2299
213 Ga0207698_10011368 3300026142 Bacteria 5769
214 Ga0209996_1000596 3300027395 Bacteria 4363
215 Ga0209970_1000343 3300027614 Bacteria 7823
216 Ga0209971_1000307 3300027682 Bacteria 13611
217 Ga0209966_1000300 3300027695 Bacteria 16287
218 Ga0209998_10000039 3300027717 Bacteria 52864
219 Ga0209974_10001134 3300027876 Bacteria 9470
220 Ga0268266_10001236 3300028379 Bacteria 31292
221 Ga0268266_10004650 3300028379 Bacteria 13084
222 Ga0268266_10005691 3300028379 Bacteria 11554
223 Ga0268266_10089984 3300028379 Bacteria 2689
224 Ga0268266_10090294 3300028379 Bacteria 2685
225 Ga0268265_10034285 3300028380 Bacteria 3698
226 Ga0268265_10072630 3300028380 Bacteria 2684
227 Ga0268265_10084621 3300028380 Bacteria 2514
228 Ga0268264_10032071 3300028381 Bacteria 4310
229 Ga0268264_10045233 3300028381 Bacteria 3654
230 Ga0265334_10013945 3300028573 Bacteria 3357
231 Ga0265339_10003365 3300031249 Bacteria 11189
232 Ga0265331_10014422 3300031250 Bacteria 4209
233 Ga0307513_10033070 3300031456 Bacteria 5819
234 Ga0307508_10020528 3300031616 Bacteria 6000
235 Ga0307516_10008723 3300031730 Bacteria 11404
236 Ga0373949_0005732 3300035090 Bacteria 2763
237 Ga0373954_0066942 3300035118 Bacteria 1701
238 Ga0373960_0008874 3300035121 Bacteria 2422
239 Ga0373924_0018050 3300035410 Bacteria 2715
240 Ga0373924_0030848 3300035410 Bacteria 2151
241 Ga0373931_0000711 3300035691 Bacteria 13770
242 Ga0373933_0005913 3300035724 Bacteria 6656
243 Ga0373937_0015788 3300036401 Bacteria 6691
244 Ga0373937_0029450 3300036401 Bacteria 4972
245 Ga0395899_0038398 3300037312 Bacteria 3586
246 Ga0395899_0084646 3300037312 Bacteria 2305
247 Ga0395900_0026013 3300037418 Bacteria 5992
248 Ga0395900_0068776 3300037418 Bacteria 3639
249 Ga0395900_0099631 3300037418 Bacteria 2985
250 Ga0395898_0018669 3300037466 Bacteria 7069
251 Ga0395898_0090070 3300037466 Bacteria 2952
252 Ga0436364_1246682 3300037853 Bacteria 4170
253 Ga0395901_0050724 3300038443 Bacteria 4310
254 Ga0395901_0055017 3300038443 Bacteria 4137
255 Ga0395901_0091003 3300038443 Bacteria 3193
256 Ga0400483_022607 3300039062 Bacteria 11893
257 Ga0400483_278617 3300039062 Bacteria 8675
258 Ga0439448_0003671 3300042005 Bacteria 4271
259 Ga0439448_0014876 3300042005 Bacteria 2352
260 Ga0439449_0001959 3300042007 Bacteria 8083
261 Ga0439455_0008491 3300042012 Bacteria 2204
262 Ga0450903_000052 3300042138 Bacteria 23517
263 Ga0439458_0000503 3300042157 Bacteria 9994
264 Ga0439458_0002672 3300042157 Bacteria 4300
265 Ga0439459_0001827 3300042438 Bacteria 3206
266 Ga0439464_0002535 3300042439 Bacteria 4510
267 Ga0466963_0039531 3300044694 Bacteria 3089
268 Ga0451576_0010364 3300045051 Bacteria 10700
269 Ga0451576_0056307 3300045051 Bacteria 4112
270 Ga0466967_0047789 3300045976 Bacteria 3733
271 Ga0495617_005493 3300046452 Bacteria 4488
272 Ga0495603_0018041 3300046455 Bacteria 4269
273 Ga0495653_0036382 3300046463 Eukaryota 3878
274 Ga0495608_0000761 3300046511 Eukaryota 22550
275 Ga0495608_0007696 3300046511 Bacteria 7593
276 Ga0495618_0010211 3300046514 Eukaryota 5679
277 Ga0495628_0045207 3300046516 Eukaryota 3502
278 Ga0495628_0052255 3300046516 Bacteria 3228
279 Ga0495630_0104695 3300046517 Bacteria 2142
280 Ga0495630_0191177 3300046517 Bacteria 1562
281 Ga0495632_0027374 3300046519 Bacteria 2987
282 Ga0495642_0002782 3300046528 Bacteria 7009
283 Ga0495652_0000245 3300046529 Eukaryota 63888
284 Ga0495652_0073975 3300046529 Eukaryota 2835
285 Ga0495652_0077680 3300046529 Bacteria 2751
286 Ga0495652_0086140 3300046529 Eukaryota 2580
287 Ga0495640_0065382 3300046533 Bacteria 2456
288 Ga0495587_0016779 3300046536 Bacteria 4554
289 Ga0495645_0015195 3300046543 Eukaryota 5474
290 Ga0495667_0015957 3300046559 Bacteria 5076
291 Ga0495668_0023867 3300046616 Bacteria 3482
292 Ga0495634_0036661 3300046642 Eukaryota 3352
293 Ga0495625_0044673 3300046660 Bacteria 3206
294 Ga0495657_0002723 3300046675 Eukaryota 14753
295 Ga0495599_0019048 3300046678 Bacteria 4279
296 Ga0495599_0037958 3300046678 Eukaryota 3026
297 Ga0495623_0000299 3300046679 Eukaryota 32400
298 Ga0495646_0002899 3300046680 Eukaryota 10630
299 Ga0495669_0003255 3300046684 Bacteria 6681
300 Ga0495624_0010784 3300046690 Eukaryota 6298
301 Ga0495624_0017276 3300046690 Eukaryota 4846
302 Ga0495600_0080471 3300046809 Eukaryota 2127
303 Ga0495604_0013784 3300047317 Eukaryota 6445
304 Ga0495604_0121141 3300047317 Bacteria 1894
305 Ga0495674_0019779 3300047319 Eukaryota 6243
306 Ga0495676_0000738 3300047321 Eukaryota 27244
307 Ga0495676_0025644 3300047321 Eukaryota 5087
308 Ga0495676_0055857 3300047321 Eukaryota 3127
309 Ga0495685_012412 3300047447 Bacteria 2887
310 Ga0495684_0027525 3300047471 Eukaryota 4365
311 Ga0495686_0072343 3300047472 Bacteria 2120
312 Ga0495602_0024547 3300048088 Bacteria 5848
313 Ga0495626_0058399 3300048091 Bacteria 1763
314 Ga0496100_0063485 3300048903 Bacteria 2441
315 Ga0496101_0049908 3300048904 Bacteria 3011
316 Ga0496102_0032728 3300048905 Bacteria 4672
317 Ga0496102_0107691 3300048905 Bacteria 2595
318 Ga0496103_0046238 3300048906 Bacteria 2687
319 Ga0496103_0047907 3300048906 Bacteria 2641
320 Ga0496104_0034189 3300048907 Bacteria 4738
321 Ga0496106_0000032 3300048909 Bacteria 134707
322 Ga0496108_0006706 3300048911 Bacteria 9322
323 Ga0496108_0056578 3300048911 Bacteria 3296
324 Ga0496109_0004511 3300048912 Bacteria 11636
325 Ga0496109_0144736 3300048912 Bacteria 2223
326 Ga0496112_0050148 3300048915 Bacteria 4092
327 Ga0496112_0057663 3300048915 Bacteria 3824
328 Ga0496114_0032479 3300048917 Bacteria 4296
329 Ga0496114_0041333 3300048917 Bacteria 3820
330 Ga0496114_0079207 3300048917 Bacteria 2773
331 Ga0496121_0033449 3300048924 Bacteria 4651
332 Ga0496121_0066088 3300048924 Bacteria 2938
333 Ga0496126_0002888 3300048929 Bacteria 22406
334 Ga0496126_0102363 3300048929 Bacteria 2504
335 Ga0501033_0053630 3300049570 Bacteria 2986
336 Ga0501034_0002257 3300049571 Bacteria 23650
337 Ga0501034_0002694 3300049571 Bacteria 20912
338 Ga0501036_0000593 3300049572 Bacteria 26259
339 Ga0501036_0046071 3300049572 Bacteria 3693
340 Ga0501038_0027038 3300049574 Bacteria 5107
341 Ga0501039_0024620 3300049575 Bacteria 4624
342 Ga0501039_0043208 3300049575 Bacteria 3482
343 Ga0501039_0118447 3300049575 Bacteria 2074
344 Ga0501040_0001205 3300049576 Bacteria 16463
345 Ga0501040_0059628 3300049576 Bacteria 2622
346 Ga0501040_0118328 3300049576 Bacteria 1858
347 Ga0501041_0004673 3300049577 Bacteria 7944
348 Ga0501041_0052128 3300049577 Bacteria 2494
349 Ga0501042_0010573 3300049578 Bacteria 6196
350 Ga0501042_0026552 3300049578 Bacteria 4068
351 Ga0501042_0095132 3300049578 Unclassified 2140
352 Ga0501046_0007282 3300049580 Bacteria 9734
353 Ga0501046_0029813 3300049580 Bacteria 4433
354 Ga0501046_0059417 3300049580 Bacteria 2995
355 Ga0501047_0028439 3300049581 Bacteria 5390
356 Ga0501048_0016838 3300049582 Bacteria 5389
357 Ga0501071_0012145 3300049587 Bacteria 5828
358 Ga0501071_0028130 3300049587 Bacteria 3960
359 Ga0501072_0006244 3300049588 Bacteria 9081
360 Ga0501072_0020777 3300049588 Bacteria 5089
361 Ga0501072_0063721 3300049588 Bacteria 2908
362 Ga0501075_0000136 3300049591 Bacteria 36442
363 Ga0501075_0034486 3300049591 Bacteria 3769
364 Ga0501076_0000016 3300049592 Bacteria 94865
365 Ga0501076_0020406 3300049592 Bacteria 5073
366 Ga0501077_0017158 3300049593 Bacteria 4566
367 Ga0501077_0060199 3300049593 Bacteria 2410
368 Ga0501079_0001520 3300049741 Bacteria 16418
369 Ga0501079_0001841 3300049741 Bacteria 15186
370 Ga0501079_0052950 3300049741 Bacteria 3131
371 Ga0501080_0030114 3300049742 Bacteria 5056
372 Ga0501080_0075365 3300049742 Bacteria 3138
373 Ga0501080_0105717 3300049742 Bacteria 2610
374 Ga0501081_0005862 3300049743 Bacteria 7952
375 Ga0501081_0045663 3300049743 Bacteria 3008
376 Ga0501081_0067544 3300049743 Bacteria 2489
377 Ga0501081_0071045 3300049743 Bacteria 2426
378 Ga0501081_0115687 3300049743 Bacteria 1906
379 Ga0501083_0046224 3300049744 Bacteria 2944
380 Ga0501044_0002918 3300049823 Bacteria 19457
381 Ga0501045_0008092 3300049824 Bacteria 7323
382 Ga0501045_0030899 3300049824 Bacteria 3878
383 nmdc:mga03683_24312_c1 3300050489 Bacteria 2369
384 nmdc:mga03683_3807_c1 3300050489 Bacteria 4925
385 nmdc:mga03n38_4208_c1 3300050490 Bacteria 4736
386 nmdc:mga03n38_8910_c1 3300050490 Bacteria 3622
387 nmdc:mga00v17_20956_c1 3300050491 Bacteria 3752
388 nmdc:mga0yw44_22212_c1 3300050492 Bacteria 3554
389 nmdc:mga0yw44_34664_c1 3300050492 Bacteria 2959
390 nmdc:mga06z11_939_c1 3300050494 Bacteria 10595
391 nmdc:mga07m45_2414_c1 3300050496 Bacteria 7110
392 nmdc:mga07m45_28837_c1 3300050496 Bacteria 3065
393 nmdc:mga07m45_29552_c1 3300050496 Bacteria 3032
394 nmdc:mga07m45_55474_c1 3300050496 Bacteria 2240
395 nmdc:mga05p37_16142_c1 3300050507 Bacteria 8992
396 nmdc:mga05p37_41033_c1 3300050507 Bacteria 5683
397 nmdc:mga05p37_42365_c1 3300050507 Bacteria 5594
398 nmdc:mga05p37_75139_c1 3300050507 Unclassified 4160
399 nmdc:mga09592_16827_c1 3300050508 Bacteria 5985
400 nmdc:mga09592_61670_c1 3300050508 Bacteria 3172
401 nmdc:mga0qj67_125152_c1 3300050509 Bacteria 2080
402 nmdc:mga06r32_15788_c1 3300050510 Bacteria 6865
403 nmdc:mga06r32_178155_c1 3300050510 Bacteria 2111
404 nmdc:mga06r32_66512_c1 3300050510 Bacteria 3478
405 nmdc:mga0rr50_1488_c1 3300050513 Bacteria 12864
406 nmdc:mga0rr50_17352_c1 3300050513 Bacteria 4804
407 nmdc:mga08x19_121245_c1 3300050514 Bacteria 1753
408 nmdc:mga0a205_10215_c1 3300050515 Bacteria 8623
409 nmdc:mga0a205_186259_c1 3300050515 Bacteria 1968
410 nmdc:mga0sz30_2751_c1 3300050516 Bacteria 6274
411 Ga0495601_0003323 3300053077 Bacteria 9204
412 Ga0495612_0020398 3300053078 Bacteria 2656
413 Ga0495619_0125969 3300053085 Bacteria 1758
414 Ga0500641_0013935 3300053096 Bacteria 2960
415 Ga0500595_002714 3300053119 Bacteria 8575
416 Ga0500568_0003380 3300053139 Bacteria 8920
417 Ga0500616_0003398 3300053153 Bacteria 12214
418 Ga0501084_0002834 3300054114 Bacteria 13995
419 Ga0501084_0005311 3300054114 Bacteria 10546
420 Ga0501082_0002498 3300060353 Bacteria 16106
421 Ga0501082_0005428 3300060353 Bacteria 11065
422 Ga0530510_0000214 3300061734 Bacteria 35923
423 Ga0530510_0026837 3300061734 Bacteria 4125
424 2524534510 2524023228 Bacteria 10118060
425 2547409477 2547132111 Bacteria 8013147
426 2585303101 2582581313 Bacteria 10042643
427 2644266951 2643221647 Bacteria 10741251
428 2644443548 2643221678 Bacteria 9540101
429 2728747585 2728368998 Bacteria 8720350
430 2776266985 2775506902 Bacteria 6208009
431 2776283047 2775506904 Bacteria 5954060
432 2785373928 2784746768 Bacteria 10036182
433 2786674174 2786546132 Bacteria 10419719
434 2808845974 2808606359 Bacteria 9866990
435 2809236063 2808606448 Bacteria 8656184
436 2812353638 2811994879 Bacteria 9313447
437 2824737375 2824732956 Bacteria 7810675
438 2824751436 2824746037 Bacteria 7911610
439 2840879626 2840878972 Bacteria 5483153
440 2844318479 2844315083 Bacteria 8138177
441 2852638911 2852635781 Bacteria 8251373
442 2854683082 2854681122 Bacteria 4548679
443 2867428967 2867428634 Bacteria 9590268
444 2877677112 2877676314 Bacteria 9512378
445 2904705895
446 2906603541 2906602504 Bacteria 8295279
447 2919470863 2919468124 Bacteria 9133025
448 2922388541 2922386360 Bacteria 7017218
449 2946072054 2946064051 Bacteria 8957905
450 2954009160 2954002825 Bacteria 9173742
451 2954681237 2954673503 Bacteria 9685905
452 2954682920 2954682443 Bacteria 9862841
453 2954692636 2954691527 Bacteria 10720516
454 2954707709 2954701450 Bacteria 10834262
455 2954712295 2954711539 Bacteria 10867210
456 2954722241 2954721474 Bacteria 10456478
457 2954739609 2954731030 Bacteria 10243860
458 2954741129 2954740390 Bacteria 10229294
459 2954758435 2954749733 Bacteria 10366972
460 2954760140 2954759201 Bacteria 9358192
461 3005511987 3005506211 Bacteria 6943378
462 3006499103 3006493962 Bacteria 8825450
463 8006933634 8006933436 Bacteria 10410654
464 8006983306 8006973647 Bacteria 10679141
465 8006991051 8006984368 Bacteria 9651211
466 8056676085 8056673599 Bacteria 7871253
467 8056830822 8056829672 Bacteria 9045328
468 Ga0496105_0002994
469 JGI25153J46596_10005581
470 rootH2_10019759
471 rootL2_10129932
472 rootH1_10009247
473 Ga0055528_1001620
474 Ga0065707_10099824
475 Ga0070658_10029819
476 Ga0070676_10013176
477 Ga0070683_100021297
478 Ga0070683_100037449
479 Ga0070683_100059727
480 Ga0068869_100009405
481 Ga0068869_100017870
482 Ga0070680_100094249
483 Ga0070682_100004932
484 Ga0070660_100020868
485 Ga0070661_100014715
486 Ga0070692_10023916
487 Ga0070668_100008936
488 Ga0070659_100071699
489 Ga0070703_10013351
490 Ga0070709_10002018
491 Ga0070714_100105296
492 Ga0070713_100002399
493 Ga0070713_100008582
494 Ga0070710_10000254
495 Ga0070711_100017900
496 Ga0070705_100002562
497 Ga0070708_100173418
498 Ga0070663_100026826
499 Ga0070663_100104788
500 Ga0070678_100017616
501 Ga0070678_100053627
502 Ga0070662_100051591
503 Ga0070706_100035266
504 Ga0070706_100112959
505 Ga0070698_100000532
506 Ga0070684_100010326
507 Ga0070697_100025217
508 Ga0068853_100048756
509 Ga0070695_100000923
510 Ga0070695_100009112
511 Ga0070695_100049573
512 Ga0070696_100020908
513 Ga0070696_100094137
514 Ga0070693_100083961
515 Ga0070665_100021001
516 Ga0070665_100054172
517 Ga0070665_100144928
518 Ga0070704_100004354
519 Ga0068855_100015073
520 Ga0068855_100071599
521 Ga0068855_100082506
522 Ga0068855_100146332
523 Ga0068855_100188418
524 Ga0070664_100009896
525 Ga0070664_100078652
526 Ga0070664_100110520
527 Ga0070664_100113211
528 Ga0070664_100121266
529 Ga0068857_100008822
530 Ga0068857_100013062
531 Ga0068854_100022423
532 Ga0068856_100002141
533 Ga0068856_100059802
534 Ga0068856_100080046
535 Ga0068852_100056186
536 Ga0068864_100010052
537 Ga0068861_100013725
538 Ga0068858_100090443
539 Ga0068858_100162050
540 Ga0068860_100044380
541 Ga0068862_100053250
542 Ga0068862_100089674
543 Ga0081455_10000034
544 Ga0081455_10000824
545 Ga0081455_10002830
546 Ga0081455_10006841
547 Ga0081455_10012605
548 Ga0081455_10020915
549 Ga0081455_10061749
550 Ga0081540_1001552
551 Ga0081539_10005890
552 Ga0081539_10009393
553 Ga0070717_10034400
554 Ga0075365_10016332
555 Ga0075365_10027549
556 Ga0075365_10044483
557 Ga0075363_100003330
558 Ga0075363_100029458
559 Ga0075364_10026574
560 Ga0075367_10001395
561 Ga0075367_10013417
562 Ga0075367_10071442
563 Ga0075367_10086120
564 Ga0075370_10015789
565 Ga0075370_10018211
566 Ga0075428_100020349
567 Ga0075428_100026757
568 Ga0075428_100065471
569 Ga0075431_100017734
570 Ga0075431_100033983
571 Ga0075431_100087196
572 Ga0075431_100105489
573 Ga0075434_100032903
574 Ga0075434_100036634
575 Ga0075434_100052054
576 Ga0075429_100020205
577 Ga0075429_100061823
578 Ga0075429_100068322
579 Ga0068865_100024028
580 Ga0075435_100008679
581 Ga0105240_10006825
582 Ga0105240_10008006
583 Ga0105240_10036879
584 Ga0111539_10017581
585 Ga0111539_10091029
586 Ga0105247_10037026
587 Ga0114129_10032016
588 Ga0114129_10045315
589 Ga0114129_10074782
590 Ga0114129_10095150
591 Ga0114129_10173729
592 Ga0105241_10047876
593 Ga0105242_10012954
594 Ga0105248_10198296
595 Ga0105237_10034150
596 Ga0105237_10072339
597 Ga0105237_10145115
598 Ga0105238_10073720
599 Ga0105239_10000035
600 Ga0105239_10019786
601 Ga0105239_10030387
602 Ga0105239_10126485
603 Ga0105239_10157134
604 Ga0105246_10024677
605 Ga0105246_10057772
606 Ga0105246_10075447
607 Ga0157373_10053685
608 Ga0157370_10046941
609 Ga0157369_10009628
610 Ga0157372_10070197
611 Ga0157372_10117290
612 Ga0157380_10095613
613 Ga0157377_10063804
614 Ga0163161_10098613
615 Ga0213876_10013498
616 Ga0213875_10050861
617 Ga0209673_1000349
618 Ga0207710_10030631
619 Ga0207688_10081129
620 Ga0207647_10046108
621 Ga0207699_10000301
622 Ga0207699_10006892
623 Ga0207645_10022952
624 Ga0207643_10062299
625 Ga0207684_10113362
626 Ga0207654_10002057
627 Ga0207654_10028154
628 Ga0207707_10001103
629 Ga0207695_10005593
630 Ga0207695_10013621
631 Ga0207695_10127834
632 Ga0207671_10021235
633 Ga0207693_10003773
634 Ga0207663_10017094
635 Ga0207657_10000061
636 Ga0207649_10018550
637 Ga0207646_10059761
638 Ga0207646_10224686
639 Ga0207650_10049526
640 Ga0207687_10010511
641 Ga0207700_10012805
642 Ga0207700_10071908
643 Ga0207664_10002373
644 Ga0207664_10018427
645 Ga0207664_10031317
646 Ga0207644_10127144
647 Ga0207706_10049292
648 Ga0207686_10029723
649 Ga0207709_10043731
650 Ga0207665_10002744
651 Ga0207665_10030666
652 Ga0207711_10016718
653 Ga0207689_10020942
654 Ga0207689_10109965
655 Ga0207661_10001258
656 Ga0207661_10021820
657 Ga0207679_10043635
658 Ga0207679_10128253
659 Ga0207667_10013799
660 Ga0207667_10033608
661 Ga0207640_10018927
662 Ga0207677_10021883
663 Ga0207703_10104929
664 Ga0207639_10002394
665 Ga0207678_10003579
666 Ga0207678_10049981
667 Ga0207708_10012256
668 Ga0207708_10086951
669 Ga0207702_10000325
670 Ga0207702_10025792
671 Ga0207702_10117573
672 Ga0207648_10042925
673 Ga0207674_10003985
674 Ga0207674_10007388
675 Ga0207674_10019619
676 Ga0207675_100012665
677 Ga0207683_10046878
678 Ga0207683_10116380
679 Ga0207683_10126231
680 Ga0207698_10011368
681 Ga0209996_1000596
682 Ga0209970_1000343
683 Ga0209971_1000307
684 Ga0209966_1000300
685 Ga0209998_10000039
686 Ga0209974_10001134
687 Ga0268266_10001236
688 Ga0268266_10004650
689 Ga0268266_10005691
690 Ga0268266_10089984
691 Ga0268266_10090294
692 Ga0268265_10034285
693 Ga0268265_10072630
694 Ga0268265_10084621
695 Ga0268264_10032071
696 Ga0268264_10045233
697 Ga0265334_10013945
698 Ga0265339_10003365
699 Ga0265331_10014422
700 Ga0307513_10033070
701 Ga0307508_10020528
702 Ga0307516_10008723
703 Ga0373949_0005732
704 Ga0373954_0066942
705 Ga0373960_0008874
706 Ga0373924_0018050
707 Ga0373924_0030848
708 Ga0373931_0000711
709 Ga0373933_0005913
710 Ga0373937_0015788
711 Ga0373937_0029450
712 Ga0395899_0038398
713 Ga0395899_0084646
714 Ga0395900_0026013
715 Ga0395900_0068776
716 Ga0395900_0099631
717 Ga0395898_0018669
718 Ga0395898_0090070
719 Ga0436364_1246682
720 Ga0395901_0050724
721 Ga0395901_0055017
722 Ga0395901_0091003
723 Ga0400483_022607
724 Ga0400483_278617
725 Ga0439448_0003671
726 Ga0439448_0014876
727 Ga0439449_0001959
728 Ga0439455_0008491
729 Ga0450903_000052
730 Ga0439458_0000503
731 Ga0439458_0002672
732 Ga0439459_0001827
733 Ga0439464_0002535
734 Ga0466963_0039531
735 Ga0451576_0010364
736 Ga0451576_0056307
737 Ga0466967_0047789
738 Ga0495617_005493
739 Ga0495603_0018041
740 Ga0495653_0036382
741 Ga0495608_0000761
742 Ga0495608_0007696
743 Ga0495618_0010211
744 Ga0495628_0045207
745 Ga0495628_0052255
746 Ga0495630_0104695
747 Ga0495630_0191177
748 Ga0495632_0027374
749 Ga0495642_0002782
750 Ga0495652_0000245
751 Ga0495652_0073975
752 Ga0495652_0077680
753 Ga0495652_0086140
754 Ga0495640_0065382
755 Ga0495587_0016779
756 Ga0495645_0015195
757 Ga0495667_0015957
758 Ga0495668_0023867
759 Ga0495634_0036661
760 Ga0495625_0044673
761 Ga0495657_0002723
762 Ga0495599_0019048
763 Ga0495599_0037958
764 Ga0495623_0000299
765 Ga0495646_0002899
766 Ga0495669_0003255
767 Ga0495624_0010784
768 Ga0495624_0017276
769 Ga0495600_0080471
770 Ga0495604_0013784
771 Ga0495604_0121141
772 Ga0495674_0019779
773 Ga0495676_0000738
774 Ga0495676_0025644
775 Ga0495676_0055857
776 Ga0495685_012412
777 Ga0495684_0027525
778 Ga0495686_0072343
779 Ga0495602_0024547
780 Ga0495626_0058399
781 Ga0496100_0063485
782 Ga0496101_0049908
783 Ga0496102_0032728
784 Ga0496102_0107691
785 Ga0496103_0046238
786 Ga0496103_0047907
787 Ga0496104_0034189
788 Ga0496106_0000032
789 Ga0496108_0006706
790 Ga0496108_0056578
791 Ga0496109_0004511
792 Ga0496109_0144736
793 Ga0496112_0050148
794 Ga0496112_0057663
795 Ga0496114_0032479
796 Ga0496114_0041333
797 Ga0496114_0079207
798 Ga0496121_0033449
799 Ga0496121_0066088
800 Ga0496126_0002888
801 Ga0496126_0102363
802 Ga0501033_0053630
803 Ga0501034_0002257
804 Ga0501034_0002694
805 Ga0501036_0000593
806 Ga0501036_0046071
807 Ga0501038_0027038
808 Ga0501039_0024620
809 Ga0501039_0043208
810 Ga0501039_0118447
811 Ga0501040_0001205
812 Ga0501040_0059628
813 Ga0501040_0118328
814 Ga0501041_0004673
815 Ga0501041_0052128
816 Ga0501042_0010573
817 Ga0501042_0026552
818 Ga0501042_0095132
819 Ga0501046_0007282
820 Ga0501046_0029813
821 Ga0501046_0059417
822 Ga0501047_0028439
823 Ga0501048_0016838
824 Ga0501071_0012145
825 Ga0501071_0028130
826 Ga0501072_0006244
827 Ga0501072_0020777
828 Ga0501072_0063721
829 Ga0501075_0000136
830 Ga0501075_0034486
831 Ga0501076_0000016
832 Ga0501076_0020406
833 Ga0501077_0017158
834 Ga0501077_0060199
835 Ga0501079_0001520
836 Ga0501079_0001841
837 Ga0501079_0052950
838 Ga0501080_0030114
839 Ga0501080_0075365
840 Ga0501080_0105717
841 Ga0501081_0005862
842 Ga0501081_0045663
843 Ga0501081_0067544
844 Ga0501081_0071045
845 Ga0501081_0115687
846 Ga0501083_0046224
847 Ga0501044_0002918
848 Ga0501045_0008092
849 Ga0501045_0030899
850 nmdc:mga03683_24312_c1
851 nmdc:mga03683_3807_c1
852 nmdc:mga03n38_4208_c1
853 nmdc:mga03n38_8910_c1
854 nmdc:mga00v17_20956_c1
855 nmdc:mga0yw44_22212_c1
856 nmdc:mga0yw44_34664_c1
857 nmdc:mga06z11_939_c1
858 nmdc:mga07m45_2414_c1
859 nmdc:mga07m45_28837_c1
860 nmdc:mga07m45_29552_c1
861 nmdc:mga07m45_55474_c1
862 nmdc:mga05p37_16142_c1
863 nmdc:mga05p37_41033_c1
864 nmdc:mga05p37_42365_c1
865 nmdc:mga05p37_75139_c1
866 nmdc:mga09592_16827_c1
867 nmdc:mga09592_61670_c1
868 nmdc:mga0qj67_125152_c1
869 nmdc:mga06r32_15788_c1
870 nmdc:mga06r32_178155_c1
871 nmdc:mga06r32_66512_c1
872 nmdc:mga0rr50_1488_c1
873 nmdc:mga0rr50_17352_c1
874 nmdc:mga08x19_121245_c1
875 nmdc:mga0a205_10215_c1
876 nmdc:mga0a205_186259_c1
877 nmdc:mga0sz30_2751_c1
878 Ga0495601_0003323
879 Ga0495612_0020398
880 Ga0495619_0125969
881 Ga0500641_0013935
882 Ga0500595_002714
883 Ga0500568_0003380
884 Ga0500616_0003398
885 Ga0501084_0002834
886 Ga0501084_0005311
887 Ga0501082_0002498
888 Ga0501082_0005428
889 Ga0530510_0000214
890 Ga0530510_0026837
891 2524534510
892 2547409477
893 2585303101
894 2644266951
895 2644443548
896 2728747585
897 2776266985
898 2776283047
899 2785373928
900 2786674174
901 2808845974
902 2809236063
903 2812353638
904 2824737375
905 2824751436
906 2840879626
907 2844318479
908 2852638911
909 2854683082
910 2867428967
911 2877677112
912 2904705895
913 2906603541
914 2919470863
915 2922388541
916 2946072054
917 2954009160
918 2954681237
919 2954682920
920 2954692636
921 2954707709
922 2954712295
923 2954722241
924 2954739609
925 2954741129
926 2954758435
927 2954760140
928 3005511987
929 3006499103
930 8006933634
931 8006983306
932 8006991051
933 8056676085
934 8056830822

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07719

TPR_2

Tetratricopeptide repeat

106

139

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1elw-assembly1.cif.gz_A crystal structure of the tpr1 domain of hop in complex with a hsc70 peptide 0.8345 415 532
1elw-assembly2.cif.gz_B crystal structure of the tpr1 domain of hop in complex with a hsc70 peptide 0.8298 413 532
5fzr-assembly1.cif.gz_B designed tpr protein m4n delta c (cf i) 0.8251 415 533
5fzr-assembly2.cif.gz_D designed tpr protein m4n delta c (cf i) 0.8246 415 533
2xcc-assembly1.cif.gz_B crystal structure of pcrh from pseudomonas aeruginosa 0.8213 415 532
ID Description Score Start End Superfamily
af_P38042_638_741_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8587 413 533 1.25.40.10
af_Q9VHW4_10_137_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8482 413 532 1.25.40.10
af_A0A1D6KX99_106_219_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8458 179 265 1.25.40.10
3pe4A01 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8449 415 532 1.25.40.10
af_A0A368UI47_479_586_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8435 411 531 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A4Q4ZH89-F1-model_v4 MalT-like TPR region domain-containing protein 0.9975 345 448
AF-A0A7K3GQK1-F1-model_v4 Tetratricopeptide repeat protein 0.9924 1 498
AF-C5PFP4-F1-model_v4 Tetratricopeptide repeat domain containing protein 0.9917 3 546
AF-A0A5N7EUP8-F1-model_v4 deleted 0.9914 3 542
AF-A0A3C1B945-F1-model_v4 Tetratricopeptide repeat protein 0.9913 1 468

Map