F449814

General Info

Members Datasets Scaffolds Average Seq Length
467 275 934 70

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_11240165|Ga0070685_112401651
Length 69
Sequence VAYIICEPCIGTKDTACVDVCPVDCIHPRKDEPEFANAEQLFIHPDECIDCGRDWASFIYKNAEYYDRD

Samples

Sample ID Description Type Environment
1 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
172 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
198 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
199 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
200 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
201 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
204 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
205 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
206 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
207 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
208 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
219 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
249 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
271 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 1.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.93
Nodule 0
Rhizoplane 1.71
Rhizosphere 91.86
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070685_11240165 3300005466 Bacteria 568
2 JGI24743J22301_10079976 3300001991 Bacteria 689
3 JGI24742J22300_10078238 3300002244 Bacteria 623
4 Ga0065714_10348226 3300005288 Bacteria 638
5 Ga0065712_10127016 3300005290 Bacteria 1595
6 Ga0065712_10358760 3300005290 Bacteria 778
7 Ga0065715_10027615 3300005293 Bacteria 1860
8 Ga0065715_10116146 3300005293 Bacteria 2390
9 Ga0065715_10463030 3300005293 Bacteria 814
10 Ga0065707_10336269 3300005295 Bacteria 941
11 Ga0070658_11370169 3300005327 Bacteria 614
12 Ga0070676_10450738 3300005328 Bacteria 905
13 Ga0070676_10606602 3300005328 Bacteria 790
14 Ga0070683_100080519 3300005329 Bacteria 3049
15 Ga0070690_100266121 3300005330 Bacteria 1218
16 Ga0070690_100519160 3300005330 Bacteria 894
17 Ga0070670_100019434 3300005331 Bacteria 5829
18 Ga0070670_100029360 3300005331 Bacteria 4734
19 Ga0070677_10013543 3300005333 Bacteria 2855
20 Ga0070677_10275365 3300005333 Bacteria 845
21 Ga0070677_10327356 3300005333 Bacteria 787
22 Ga0068869_100000871 3300005334 Bacteria 17376
23 Ga0068869_100593764 3300005334 Bacteria 935
24 Ga0070666_10051735 3300005335 Bacteria 2767
25 Ga0070666_10209099 3300005335 Bacteria 1374
26 Ga0070666_10350330 3300005335 Bacteria 1056
27 Ga0070666_11052843 3300005335 Unclassified 604
28 Ga0070680_100777604 3300005336 Bacteria 825
29 Ga0070680_100855974 3300005336 Bacteria 784
30 Ga0068868_100197641 3300005338 Bacteria 1675
31 Ga0070660_100164732 3300005339 Bacteria 1788
32 Ga0070689_100735536 3300005340 Bacteria 864
33 Ga0070687_101297145 3300005343 Bacteria 541
34 Ga0070692_10546880 3300005345 Bacteria 758
35 Ga0070669_100196682 3300005353 Bacteria 1584
36 Ga0070675_100007467 3300005354 Bacteria 8446
37 Ga0070675_100204110 3300005354 Bacteria 1716
38 Ga0070671_100735478 3300005355 Bacteria 857
39 Ga0070674_100052976 3300005356 Bacteria 2800
40 Ga0070674_100240242 3300005356 Bacteria 1418
41 Ga0070673_100020387 3300005364 Bacteria 4782
42 Ga0070673_100197140 3300005364 Bacteria 1732
43 Ga0070688_100055054 3300005365 Bacteria 2494
44 Ga0070688_100291560 3300005365 Bacteria 1176
45 Ga0070688_100463274 3300005365 Bacteria 950
46 Ga0070688_100505054 3300005365 Bacteria 913
47 Ga0070659_102067618 3300005366 Bacteria 512
48 Ga0070667_101521417 3300005367 Bacteria 629
49 Ga0070703_10239416 3300005406 Bacteria 731
50 Ga0070713_100503614 3300005436 Bacteria 1143
51 Ga0070713_101117858 3300005436 Bacteria 762
52 Ga0070711_100740720 3300005439 Bacteria 830
53 Ga0070705_100200829 3300005440 Bacteria 1367
54 Ga0070700_100086584 3300005441 Bacteria 2035
55 Ga0070700_100461285 3300005441 Bacteria 969
56 Ga0070694_100193206 3300005444 Bacteria 1513
57 Ga0070694_100224668 3300005444 Bacteria 1410
58 Ga0070694_101780574 3300005444 Bacteria 525
59 Ga0070663_100047446 3300005455 Bacteria 3042
60 Ga0070678_100476440 3300005456 Bacteria 1098
61 Ga0070678_101004876 3300005456 Bacteria 767
62 Ga0068867_100154328 3300005459 Bacteria 1806
63 Ga0068867_102246803 3300005459 Bacteria 518
64 Ga0070685_11078682 3300005466 Bacteria 606
65 Ga0070706_101273057 3300005467 Bacteria 675
66 Ga0070698_100056611 3300005471 Bacteria 3973
67 Ga0070699_100009598 3300005518 Bacteria 8386
68 Ga0070699_100238923 3300005518 Bacteria 1621
69 Ga0070684_100260663 3300005535 Bacteria 1586
70 Ga0070697_101753725 3300005536 Bacteria 555
71 Ga0070672_101433981 3300005543 Bacteria 618
72 Ga0070686_100196861 3300005544 Bacteria 1442
73 Ga0070686_100515925 3300005544 Bacteria 930
74 Ga0070686_101062137 3300005544 Bacteria 667
75 Ga0070695_100325520 3300005545 Bacteria 1144
76 Ga0070695_100762142 3300005545 Bacteria 773
77 Ga0070695_101880806 3300005545 Bacteria 503
78 Ga0070696_100106787 3300005546 Bacteria 2013
79 Ga0070696_100785541 3300005546 Bacteria 783
80 Ga0070696_100852970 3300005546 Bacteria 753
81 Ga0070696_100969839 3300005546 Bacteria 709
82 Ga0070693_100263334 3300005547 Bacteria 1148
83 Ga0070665_100011115 3300005548 Bacteria 9096
84 Ga0070704_100025812 3300005549 Bacteria 3873
85 Ga0070704_100085571 3300005549 Bacteria 2334
86 Ga0068855_100160726 3300005563 Bacteria 2550
87 Ga0068855_101460957 3300005563 Bacteria 703
88 Ga0068855_101758068 3300005563 Bacteria 631
89 Ga0070664_100631646 3300005564 Bacteria 994
90 Ga0068857_100443312 3300005577 Bacteria 1213
91 Ga0068854_100384969 3300005578 Bacteria 1157
92 Ga0070702_100409205 3300005615 Bacteria 973
93 Ga0068852_100047328 3300005616 Bacteria 3669
94 Ga0068852_101730392 3300005616 Bacteria 648
95 Ga0068859_100642635 3300005617 Bacteria 1153
96 Ga0068859_102132882 3300005617 Bacteria 619
97 Ga0068864_100187436 3300005618 Bacteria 1894
98 Ga0068864_100634857 3300005618 Bacteria 1039
99 Ga0068866_10108526 3300005718 Bacteria 1544
100 Ga0068866_10117458 3300005718 Bacteria 1494
101 Ga0068861_100483630 3300005719 Bacteria 1116
102 Ga0068861_100569718 3300005719 Bacteria 1035
103 Ga0068858_100337924 3300005842 Bacteria 1441
104 Ga0068860_100769020 3300005843 Bacteria 975
105 Ga0068860_100826170 3300005843 Bacteria 941
106 Ga0081455_10391912 3300005937 Bacteria 967
107 Ga0070717_10449984 3300006028 Bacteria 1160
108 Ga0075368_10004087 3300006042 Bacteria 4911
109 Ga0075368_10048690 3300006042 Bacteria 1680
110 Ga0075364_10000947 3300006051 Bacteria 15319
111 Ga0075364_10001809 3300006051 Bacteria 11848
112 Ga0075364_10017056 3300006051 Bacteria 4529
113 Ga0070715_10648693 3300006163 Bacteria 625
114 Ga0070712_100884334 3300006175 Bacteria 770
115 Ga0070712_101192951 3300006175 Bacteria 662
116 Ga0075362_10000638 3300006177 Bacteria 10295
117 Ga0075367_10004079 3300006178 Bacteria 7068
118 Ga0075369_10380774 3300006186 Bacteria 664
119 Ga0097621_100000758 3300006237 Bacteria 22671
120 Ga0097621_100040252 3300006237 Bacteria 3757
121 Ga0097621_100104635 3300006237 Bacteria 2385
122 Ga0097621_100345166 3300006237 Bacteria 1322
123 Ga0075370_10004108 3300006353 Bacteria 7014
124 Ga0068871_100002203 3300006358 Bacteria 13241
125 Ga0068871_100013281 3300006358 Bacteria 6110
126 Ga0068871_100241304 3300006358 Bacteria 1571
127 Ga0075428_100000377 3300006844 Bacteria 44160
128 Ga0075428_100160894 3300006844 Bacteria 2437
129 Ga0075430_100003207 3300006846 Bacteria 13694
130 Ga0075430_100098815 3300006846 Bacteria 2438
131 Ga0075430_101662037 3300006846 Bacteria 524
132 Ga0075431_100215048 3300006847 Bacteria 1962
133 Ga0075433_10001336 3300006852 Bacteria 18039
134 Ga0075434_100000517 3300006871 Bacteria 29347
135 Ga0075434_100001915 3300006871 Bacteria 18037
136 Ga0075434_100026033 3300006871 Bacteria 5727
137 Ga0075434_100640879 3300006871 Bacteria 1081
138 Ga0075434_101078195 3300006871 Bacteria 817
139 Ga0075434_101401443 3300006871 Bacteria 709
140 Ga0075429_100004661 3300006880 Bacteria 11801
141 Ga0075429_101512534 3300006880 Bacteria 584
142 Ga0075429_101578156 3300006880 Bacteria 571
143 Ga0068865_100178782 3300006881 Bacteria 1632
144 Ga0075436_100028314 3300006914 Bacteria 3854
145 Ga0097620_100642820 3300006931 Bacteria 1153
146 Ga0097620_102132588 3300006931 Bacteria 619
147 Ga0075435_100005469 3300007076 Bacteria 8874
148 Ga0075435_100008092 3300007076 Bacteria 7529
149 Ga0075435_100212720 3300007076 Bacteria 1641
150 Ga0075435_100267406 3300007076 Bacteria 1458
151 Ga0075435_100871342 3300007076 Bacteria 785
152 Ga0075435_100910507 3300007076 Bacteria 767
153 Ga0105250_10603508 3300009092 Bacteria 509
154 Ga0105240_10062160 3300009093 Bacteria 4650
155 Ga0105240_10368295 3300009093 Bacteria 1625
156 Ga0111539_10195548 3300009094 Bacteria 2359
157 Ga0111539_10455932 3300009094 Bacteria 1489
158 Ga0111539_13392607 3300009094 Bacteria 512
159 Ga0105245_10011586 3300009098 Bacteria 7682
160 Ga0105245_10213214 3300009098 Bacteria 1860
161 Ga0105245_11738147 3300009098 Bacteria 676
162 Ga0105247_10872669 3300009101 Bacteria 693
163 Ga0114129_10027828 3300009147 Bacteria 8006
164 Ga0105243_10028882 3300009148 Bacteria 4261
165 Ga0105243_11067473 3300009148 Bacteria 814
166 Ga0105243_12609628 3300009148 Bacteria 545
167 Ga0105243_12816180 3300009148 Bacteria 527
168 Ga0105242_10053654 3300009176 Bacteria 3293
169 Ga0105242_10070190 3300009176 Bacteria 2904
170 Ga0105242_10084428 3300009176 Bacteria 2661
171 Ga0105242_10294022 3300009176 Bacteria 1480
172 Ga0105248_10501146 3300009177 Bacteria 1369
173 Ga0105248_10581044 3300009177 Bacteria 1264
174 Ga0105248_10707811 3300009177 Bacteria 1136
175 Ga0105238_11860085 3300009551 Bacteria 634
176 Ga0105249_10669661 3300009553 Bacteria 1096
177 Ga0157373_11272939 3300013100 Bacteria 556
178 Ga0157370_10317336 3300013104 Bacteria 1438
179 Ga0157370_11962400 3300013104 Bacteria 525
180 Ga0157374_10004598 3300013296 Bacteria 11573
181 Ga0157378_10434316 3300013297 Bacteria 1300
182 Ga0157378_10463032 3300013297 Bacteria 1260
183 Ga0163162_10616566 3300013306 Bacteria 1210
184 Ga0163162_13204191 3300013306 Bacteria 525
185 Ga0157372_11420030 3300013307 Bacteria 800
186 Ga0157372_11875257 3300013307 Bacteria 689
187 Ga0157375_10093983 3300013308 Bacteria 3066
188 Ga0157375_10751291 3300013308 Bacteria 1126
189 Ga0157375_12449778 3300013308 Bacteria 623
190 Ga0163163_10250804 3300014325 Bacteria 1820
191 Ga0163163_10442437 3300014325 Bacteria 1360
192 Ga0163163_13000779 3300014325 Bacteria 526
193 Ga0157380_10020882 3300014326 Bacteria 4903
194 Ga0157380_10148918 3300014326 Bacteria 2021
195 Ga0157380_10234319 3300014326 Bacteria 1651
196 Ga0157380_10450113 3300014326 Bacteria 1236
197 Ga0157380_11893295 3300014326 Bacteria 657
198 Ga0157380_13217925 3300014326 Bacteria 522
199 Ga0157377_10313911 3300014745 Bacteria 1039
200 Ga0157379_10020677 3300014968 Bacteria 5824
201 Ga0157379_11608468 3300014968 Bacteria 634
202 Ga0157376_10005217 3300014969 Bacteria 9067
203 Ga0157376_10072538 3300014969 Bacteria 2929
204 Ga0157376_10199953 3300014969 Bacteria 1838
205 Ga0157376_10511365 3300014969 Bacteria 1182
206 Ga0157376_10578449 3300014969 Bacteria 1115
207 Ga0163161_10404129 3300017792 Bacteria 1096
208 Ga0163161_11170662 3300017792 Bacteria 664
209 Ga0206356_10387088 3300020070 Bacteria 853
210 Ga0206356_11388378 3300020070 Bacteria 1052
211 Ga0206352_11007373 3300020078 Bacteria 526
212 Ga0206354_10686882 3300020081 Bacteria 712
213 Ga0206353_10498644 3300020082 Bacteria 718
214 Ga0213876_10091331 3300021384 Bacteria 1613
215 Ga0207697_10256310 3300025315 Bacteria 774
216 Ga0207656_10664729 3300025321 Bacteria 533
217 Ga0207682_10028372 3300025893 Bacteria 2233
218 Ga0207682_10049731 3300025893 Bacteria 1731
219 Ga0207682_10470988 3300025893 Bacteria 595
220 Ga0207642_10008816 3300025899 Bacteria 3481
221 Ga0207688_10016354 3300025901 Bacteria 4023
222 Ga0207680_11076995 3300025903 Unclassified 575
223 Ga0207699_10115458 3300025906 Bacteria 1728
224 Ga0207645_10147756 3300025907 Bacteria 1533
225 Ga0207643_10486339 3300025908 Bacteria 788
226 Ga0207684_10801209 3300025910 Bacteria 796
227 Ga0207654_10312881 3300025911 Bacteria 1071
228 Ga0207707_11370035 3300025912 Bacteria 565
229 Ga0207695_10127628 3300025913 Bacteria 2504
230 Ga0207693_10271834 3300025915 Bacteria 1328
231 Ga0207693_11046455 3300025915 Bacteria 622
232 Ga0207663_10162775 3300025916 Bacteria 1577
233 Ga0207660_10348865 3300025917 Bacteria 1186
234 Ga0207660_10814571 3300025917 Bacteria 762
235 Ga0207662_10376111 3300025918 Bacteria 959
236 Ga0207662_10650574 3300025918 Bacteria 736
237 Ga0207657_10673616 3300025919 Bacteria 804
238 Ga0207652_11310639 3300025921 Bacteria 627
239 Ga0207652_11643871 3300025921 Bacteria 547
240 Ga0207646_11154946 3300025922 Unclassified 680
241 Ga0207681_10005910 3300025923 Bacteria 7502
242 Ga0207681_10362227 3300025923 Bacteria 1163
243 Ga0207681_11054541 3300025923 Bacteria 682
244 Ga0207694_10536136 3300025924 Unclassified 982
245 Ga0207659_10007019 3300025926 Bacteria 6917
246 Ga0207659_10834058 3300025926 Bacteria 792
247 Ga0207687_10671589 3300025927 Bacteria 878
248 Ga0207700_10873442 3300025928 Bacteria 805
249 Ga0207700_11940947 3300025928 Bacteria 515
250 Ga0207690_10869785 3300025932 Bacteria 747
251 Ga0207690_11529342 3300025932 Bacteria 558
252 Ga0207690_11774125 3300025932 Bacteria 515
253 Ga0207686_10013561 3300025934 Bacteria 4512
254 Ga0207686_10071937 3300025934 Bacteria 2227
255 Ga0207709_10017940 3300025935 Bacteria 3959
256 Ga0207669_10032080 3300025937 Bacteria 2945
257 Ga0207669_10094373 3300025937 Bacteria 1957
258 Ga0207669_10420344 3300025937 Bacteria 1052
259 Ga0207669_10534595 3300025937 Bacteria 943
260 Ga0207669_10539749 3300025937 Bacteria 939
261 Ga0207704_10017165 3300025938 Bacteria 3744
262 Ga0207704_10087580 3300025938 Bacteria 2034
263 Ga0207704_11370265 3300025938 Bacteria 606
264 Ga0207691_10437679 3300025940 Unclassified 1113
265 Ga0207711_10777816 3300025941 Bacteria 892
266 Ga0207711_11014850 3300025941 Bacteria 769
267 Ga0207689_10008287 3300025942 Bacteria 9058
268 Ga0207661_10015620 3300025944 Bacteria 5592
269 Ga0207679_10222209 3300025945 Bacteria 1590
270 Ga0207667_10254260 3300025949 Bacteria 1797
271 Ga0207651_10009597 3300025960 Bacteria 5310
272 Ga0207712_12019334 3300025961 Bacteria 516
273 Ga0207658_11348935 3300025986 Bacteria 652
274 Ga0207677_10653645 3300026023 Bacteria 928
275 Ga0207677_11980555 3300026023 Bacteria 541
276 Ga0207677_11994084 3300026023 Bacteria 540
277 Ga0207703_10010548 3300026035 Bacteria 7226
278 Ga0207678_10012209 3300026067 Bacteria 7544
279 Ga0207678_11621013 3300026067 Bacteria 569
280 Ga0207708_10006094 3300026075 Bacteria 8942
281 Ga0207708_10117773 3300026075 Bacteria 2067
282 Ga0207708_10443741 3300026075 Bacteria 1080
283 Ga0207641_10041282 3300026088 Bacteria 3866
284 Ga0207641_10674961 3300026088 Bacteria 1016
285 Ga0207648_10010085 3300026089 Bacteria 8982
286 Ga0207648_10046392 3300026089 Bacteria 3809
287 Ga0207648_10308045 3300026089 Bacteria 1421
288 Ga0207648_12239642 3300026089 Bacteria 507
289 Ga0207676_10072010 3300026095 Bacteria 2777
290 Ga0207676_10180013 3300026095 Bacteria 1850
291 Ga0207676_10554437 3300026095 Bacteria 1098
292 Ga0207674_10723649 3300026116 Bacteria 960
293 Ga0207675_100221690 3300026118 Bacteria 1822
294 Ga0207675_100506737 3300026118 Bacteria 1202
295 Ga0207683_10068111 3300026121 Bacteria 3141
296 Ga0207683_10270023 3300026121 Bacteria 1554
297 Ga0207683_11246007 3300026121 Bacteria 689
298 Ga0207683_11452101 3300026121 Bacteria 634
299 Ga0207698_10536030 3300026142 Bacteria 1145
300 Ga0207698_12468269 3300026142 Bacteria 530
301 Ga0209813_10057345 3300027866 Bacteria 1235
302 Ga0209974_10223554 3300027876 Bacteria 702
303 Ga0268266_10010925 3300028379 Bacteria 7902
304 Ga0268265_10405359 3300028380 Bacteria 1262
305 Ga0268264_11502502 3300028381 Bacteria 684
306 Ga0265336_10174197 3300028666 Bacteria 640
307 Ga0265338_10974835 3300028800 Bacteria 575
308 Ga0265330_10217660 3300031235 Bacteria 806
309 Ga0265332_10317532 3300031238 Bacteria 643
310 Ga0265316_10695120 3300031344 Bacteria 717
311 Ga0307408_100029177 3300031548 Bacteria 3819
312 Ga0307408_100267401 3300031548 Unclassified 1418
313 Ga0265314_10015825 3300031711 Bacteria 5973
314 Ga0265314_10067188 3300031711 Bacteria 2416
315 Ga0265342_10437676 3300031712 Bacteria 672
316 Ga0307410_10446226 3300031852 Bacteria 1054
317 Ga0307410_11202634 3300031852 Bacteria 660
318 Ga0307406_10020295 3300031901 Bacteria 3912
319 Ga0307407_10099768 3300031903 Bacteria 1799
320 Ga0307407_10389760 3300031903 Bacteria 997
321 Ga0307412_10279087 3300031911 Bacteria 1311
322 Ga0307409_100997265 3300031995 Bacteria 855
323 Ga0307409_101128132 3300031995 Bacteria 806
324 Ga0307409_102773155 3300031995 Bacteria 518
325 Ga0307416_100093027 3300032002 Bacteria 2596
326 Ga0307416_100183669 3300032002 Bacteria 1963
327 Ga0307416_100580616 3300032002 Bacteria 1198
328 Ga0307416_101259009 3300032002 Bacteria 845
329 Ga0307414_10304454 3300032004 Bacteria 1350
330 Ga0307414_10351886 3300032004 Bacteria 1265
331 Ga0307411_10011492 3300032005 Bacteria 4782
332 Ga0307411_10244053 3300032005 Bacteria 1408
333 Ga0307411_10648985 3300032005 Bacteria 913
334 Ga0307415_100023733 3300032126 Bacteria 3815
335 Ga0373939_0541231 3300035114 Bacteria 502
336 Ga0373945_0161065 3300035116 Bacteria 915
337 Ga0373943_0482723 3300035170 Bacteria 723
338 Ga0373946_0039775 3300035171 Bacteria 1921
339 Ga0373946_0265322 3300035171 Bacteria 841
340 Ga0373955_0225844 3300035172 Bacteria 1119
341 Ga0373935_0318374 3300035692 Bacteria 1103
342 Ga0373935_1008795 3300035692 Bacteria 618
343 Ga0373947_0309951 3300035725 Bacteria 1054
344 Ga0373937_0014151 3300036401 Bacteria 7036
345 Ga0373937_0889801 3300036401 Bacteria 839
346 Ga0373937_0899031 3300036401 Bacteria 834
347 Ga0373925_0052215 3300037068 Bacteria 3054
348 Ga0373925_0249509 3300037068 Bacteria 1423
349 Ga0373925_1106658 3300037068 Bacteria 652
350 Ga0436365_0066771 3300039437 Bacteria 742
351 Ga0436365_0676370 3300039437 Bacteria 634
352 Ga0436365_1762974 3300039437 Bacteria 2742
353 Ga0436363_1476449 3300039450 Bacteria 726
354 Ga0439453_0006901 3300041408 Bacteria 1784
355 Ga0451787_530025 3300041441 Bacteria 837
356 Ga0451800_0405471 3300041459 Bacteria 1149
357 Ga0451807_0471799 3300041486 Bacteria 863
358 Ga0451851_0535874 3300041507 Bacteria 659
359 Ga0451853_3075205 3300041512 Bacteria 663
360 Ga0439454_020878 3300042011 Bacteria 964
361 Ga0450923_176545 3300042125 Bacteria 525
362 Ga0439435_0204456 3300042436 Bacteria 652
363 Ga0451577_0542744 3300042876 Bacteria 1056
364 Ga0439440_0205218 3300042993 Bacteria 586
365 Ga0453683_1184799 3300044673 Bacteria 511
366 Ga0453684_1528221 3300044712 Bacteria 688
367 Ga0451576_0037954 3300045051 Bacteria 5100
368 Ga0466958_0307573 3300045836 Bacteria 1018
369 Ga0466967_2064745 3300045976 Bacteria 566
370 Ga0495603_0235465 3300046455 Bacteria 1055
371 Ga0495629_0105276 3300046459 Bacteria 1967
372 Ga0495629_1046816 3300046459 Bacteria 529
373 Ga0495628_1036949 3300046516 Bacteria 563
374 Ga0495640_0529186 3300046533 Bacteria 716
375 Ga0495586_0081359 3300046535 Bacteria 1780
376 Ga0495586_0379971 3300046535 Bacteria 812
377 Ga0495621_0095256 3300046539 Bacteria 1127
378 Ga0495633_0501002 3300046558 Bacteria 547
379 Ga0495634_0755005 3300046642 Bacteria 557
380 Ga0495635_0078956 3300046663 Bacteria 2253
381 Ga0495635_0096019 3300046663 Bacteria 2026
382 Ga0495588_0504856 3300046674 Bacteria 634
383 Ga0495647_0037043 3300046681 Bacteria 1839
384 Ga0495647_0242472 3300046681 Bacteria 801
385 Ga0495658_0019223 3300046683 Bacteria 3563
386 Ga0495658_0053912 3300046683 Bacteria 2286
387 Ga0495658_0159337 3300046683 Bacteria 1391
388 Ga0495669_0001480 3300046684 Bacteria 9684
389 Ga0495613_0465564 3300046689 Bacteria 855
390 Ga0495674_0401504 3300047319 Bacteria 1106
391 Ga0495676_0548113 3300047321 Bacteria 756
392 Ga0496104_0327993 3300048907 Bacteria 1444
393 Ga0496104_0888833 3300048907 Bacteria 796
394 Ga0496105_0523506 3300048908 Bacteria 928
395 Ga0496105_0923268 3300048908 Bacteria 657
396 Ga0496115_0088340 3300048918 Bacteria 2531
397 Ga0501034_0035726 3300049571 Bacteria 5037
398 Ga0501034_0896771 3300049571 Bacteria 775
399 Ga0501036_0716140 3300049572 Bacteria 827
400 Ga0501040_0311843 3300049576 Bacteria 1125
401 Ga0501042_0379575 3300049578 Bacteria 1023
402 Ga0501042_1022989 3300049578 Bacteria 602
403 Ga0501047_0298709 3300049581 Bacteria 1453
404 Ga0501047_0566248 3300049581 Bacteria 960
405 Ga0501048_1361458 3300049582 Bacteria 510
406 Ga0501068_0686357 3300049584 Bacteria 669
407 Ga0501070_0800206 3300049586 Bacteria 740
408 Ga0501071_0481503 3300049587 Bacteria 951
409 Ga0501071_0752221 3300049587 Unclassified 751
410 Ga0501072_0280594 3300049588 Bacteria 1325
411 Ga0501074_0424478 3300049590 Bacteria 943
412 Ga0501074_0776494 3300049590 Bacteria 675
413 Ga0501074_0994495 3300049590 Bacteria 590
414 Ga0501075_0245384 3300049591 Bacteria 1365
415 Ga0501075_0471893 3300049591 Bacteria 957
416 Ga0501075_0788909 3300049591 Bacteria 723
417 Ga0501076_0538979 3300049592 Bacteria 962
418 Ga0501076_0623692 3300049592 Bacteria 890
419 Ga0501080_0780684 3300049742 Bacteria 839
420 Ga0501081_0684440 3300049743 Bacteria 770
421 Ga0501083_0594548 3300049744 Bacteria 720
422 nmdc:mga03683_1670_c1 3300050489 Bacteria 6681
423 nmdc:mga03n38_45084_c1 3300050490 Bacteria 1940
424 nmdc:mga00v17_1673_c1 3300050491 Bacteria 11537
425 nmdc:mga00v17_242811_c1 3300050491 Bacteria 1168
426 nmdc:mga00v17_292527_c1 3300050491 Bacteria 1058
427 nmdc:mga00v17_548460_c1 3300050491 Bacteria 748
428 nmdc:mga0yw44_154455_c1 3300050492 Bacteria 1499
429 nmdc:mga0k408_41098_c1 3300050493 Bacteria 2662
430 nmdc:mga0k408_8072_c1 3300050493 Bacteria 5643
431 nmdc:mga06z11_2638_c1 3300050494 Bacteria 6871
432 nmdc:mga06z11_38893_c1 3300050494 Bacteria 2365
433 nmdc:mga04h51_186436_c1 3300050495 Bacteria 810
434 nmdc:mga07m45_12447_c1 3300050496 Bacteria 4497
435 nmdc:mga05p37_123037_c1 3300050507 Bacteria 3187
436 nmdc:mga05p37_13843_c1 3300050507 Bacteria 9664
437 nmdc:mga05p37_47324_c1 3300050507 Bacteria 5289
438 nmdc:mga09592_1275827_c1 3300050508 Bacteria 605
439 nmdc:mga09592_46648_c1 3300050508 Bacteria 3650
440 nmdc:mga09592_688212_c1 3300050508 Bacteria 871
441 nmdc:mga0qj67_1278498_c1 3300050509 Bacteria 569
442 nmdc:mga0qj67_35620_c1 3300050509 Bacteria 3892
443 nmdc:mga0qj67_508821_c1 3300050509 Bacteria 968
444 nmdc:mga06r32_128110_c1 3300050510 Bacteria 2508
445 nmdc:mga06r32_373128_c1 3300050510 Unclassified 1410
446 nmdc:mga08y16_444849_c1 3300050511 Bacteria 1322
447 nmdc:mga08y16_511334_c1 3300050511 Bacteria 1219
448 nmdc:mga0n895_1156861_c1 3300050512 Bacteria 749
449 nmdc:mga0n895_1648819_c1 3300050512 Bacteria 605
450 nmdc:mga0n895_225821_c1 3300050512 Bacteria 1901
451 nmdc:mga0rr50_15768_c1 3300050513 Bacteria 4997
452 nmdc:mga0rr50_176678_c1 3300050513 Bacteria 1743
453 nmdc:mga08x19_230455_c1 3300050514 Bacteria 1275
454 nmdc:mga08x19_64698_c1 3300050514 Bacteria 2374
455 nmdc:mga0a205_225149_c1 3300050515 Bacteria 1760
456 Ga0495595_0471647 3300053084 Bacteria 639
457 Ga0495619_0106141 3300053085 Bacteria 1915
458 Ga0501084_0722461 3300054114 Bacteria 840
459 Ga0590071_015878 3300059421 Bacteria 1766
460 Ga0590075_012885 3300059424 Bacteria 2034
461 Ga0590077_035499 3300059426 Bacteria 1098
462 Ga0587073_0290013 3300059492 Bacteria 528
463 Ga0587091_219154 3300059511 Bacteria 519
464 Ga0587062_112099 3300059639 Bacteria 543
465 Ga0501082_0222919 3300060353 Bacteria 1641
466 Ga0501082_0594872 3300060353 Bacteria 968
467 Ga0530510_1550047 3300061734 Bacteria 509
468 Ga0070685_11240165
469 JGI24743J22301_10079976
470 JGI24742J22300_10078238
471 Ga0065714_10348226
472 Ga0065712_10127016
473 Ga0065712_10358760
474 Ga0065715_10027615
475 Ga0065715_10116146
476 Ga0065715_10463030
477 Ga0065707_10336269
478 Ga0070658_11370169
479 Ga0070676_10450738
480 Ga0070676_10606602
481 Ga0070683_100080519
482 Ga0070690_100266121
483 Ga0070690_100519160
484 Ga0070670_100019434
485 Ga0070670_100029360
486 Ga0070677_10013543
487 Ga0070677_10275365
488 Ga0070677_10327356
489 Ga0068869_100000871
490 Ga0068869_100593764
491 Ga0070666_10051735
492 Ga0070666_10209099
493 Ga0070666_10350330
494 Ga0070666_11052843
495 Ga0070680_100777604
496 Ga0070680_100855974
497 Ga0068868_100197641
498 Ga0070660_100164732
499 Ga0070689_100735536
500 Ga0070687_101297145
501 Ga0070692_10546880
502 Ga0070669_100196682
503 Ga0070675_100007467
504 Ga0070675_100204110
505 Ga0070671_100735478
506 Ga0070674_100052976
507 Ga0070674_100240242
508 Ga0070673_100020387
509 Ga0070673_100197140
510 Ga0070688_100055054
511 Ga0070688_100291560
512 Ga0070688_100463274
513 Ga0070688_100505054
514 Ga0070659_102067618
515 Ga0070667_101521417
516 Ga0070703_10239416
517 Ga0070713_100503614
518 Ga0070713_101117858
519 Ga0070711_100740720
520 Ga0070705_100200829
521 Ga0070700_100086584
522 Ga0070700_100461285
523 Ga0070694_100193206
524 Ga0070694_100224668
525 Ga0070694_101780574
526 Ga0070663_100047446
527 Ga0070678_100476440
528 Ga0070678_101004876
529 Ga0068867_100154328
530 Ga0068867_102246803
531 Ga0070685_11078682
532 Ga0070706_101273057
533 Ga0070698_100056611
534 Ga0070699_100009598
535 Ga0070699_100238923
536 Ga0070684_100260663
537 Ga0070697_101753725
538 Ga0070672_101433981
539 Ga0070686_100196861
540 Ga0070686_100515925
541 Ga0070686_101062137
542 Ga0070695_100325520
543 Ga0070695_100762142
544 Ga0070695_101880806
545 Ga0070696_100106787
546 Ga0070696_100785541
547 Ga0070696_100852970
548 Ga0070696_100969839
549 Ga0070693_100263334
550 Ga0070665_100011115
551 Ga0070704_100025812
552 Ga0070704_100085571
553 Ga0068855_100160726
554 Ga0068855_101460957
555 Ga0068855_101758068
556 Ga0070664_100631646
557 Ga0068857_100443312
558 Ga0068854_100384969
559 Ga0070702_100409205
560 Ga0068852_100047328
561 Ga0068852_101730392
562 Ga0068859_100642635
563 Ga0068859_102132882
564 Ga0068864_100187436
565 Ga0068864_100634857
566 Ga0068866_10108526
567 Ga0068866_10117458
568 Ga0068861_100483630
569 Ga0068861_100569718
570 Ga0068858_100337924
571 Ga0068860_100769020
572 Ga0068860_100826170
573 Ga0081455_10391912
574 Ga0070717_10449984
575 Ga0075368_10004087
576 Ga0075368_10048690
577 Ga0075364_10000947
578 Ga0075364_10001809
579 Ga0075364_10017056
580 Ga0070715_10648693
581 Ga0070712_100884334
582 Ga0070712_101192951
583 Ga0075362_10000638
584 Ga0075367_10004079
585 Ga0075369_10380774
586 Ga0097621_100000758
587 Ga0097621_100040252
588 Ga0097621_100104635
589 Ga0097621_100345166
590 Ga0075370_10004108
591 Ga0068871_100002203
592 Ga0068871_100013281
593 Ga0068871_100241304
594 Ga0075428_100000377
595 Ga0075428_100160894
596 Ga0075430_100003207
597 Ga0075430_100098815
598 Ga0075430_101662037
599 Ga0075431_100215048
600 Ga0075433_10001336
601 Ga0075434_100000517
602 Ga0075434_100001915
603 Ga0075434_100026033
604 Ga0075434_100640879
605 Ga0075434_101078195
606 Ga0075434_101401443
607 Ga0075429_100004661
608 Ga0075429_101512534
609 Ga0075429_101578156
610 Ga0068865_100178782
611 Ga0075436_100028314
612 Ga0097620_100642820
613 Ga0097620_102132588
614 Ga0075435_100005469
615 Ga0075435_100008092
616 Ga0075435_100212720
617 Ga0075435_100267406
618 Ga0075435_100871342
619 Ga0075435_100910507
620 Ga0105250_10603508
621 Ga0105240_10062160
622 Ga0105240_10368295
623 Ga0111539_10195548
624 Ga0111539_10455932
625 Ga0111539_13392607
626 Ga0105245_10011586
627 Ga0105245_10213214
628 Ga0105245_11738147
629 Ga0105247_10872669
630 Ga0114129_10027828
631 Ga0105243_10028882
632 Ga0105243_11067473
633 Ga0105243_12609628
634 Ga0105243_12816180
635 Ga0105242_10053654
636 Ga0105242_10070190
637 Ga0105242_10084428
638 Ga0105242_10294022
639 Ga0105248_10501146
640 Ga0105248_10581044
641 Ga0105248_10707811
642 Ga0105238_11860085
643 Ga0105249_10669661
644 Ga0157373_11272939
645 Ga0157370_10317336
646 Ga0157370_11962400
647 Ga0157374_10004598
648 Ga0157378_10434316
649 Ga0157378_10463032
650 Ga0163162_10616566
651 Ga0163162_13204191
652 Ga0157372_11420030
653 Ga0157372_11875257
654 Ga0157375_10093983
655 Ga0157375_10751291
656 Ga0157375_12449778
657 Ga0163163_10250804
658 Ga0163163_10442437
659 Ga0163163_13000779
660 Ga0157380_10020882
661 Ga0157380_10148918
662 Ga0157380_10234319
663 Ga0157380_10450113
664 Ga0157380_11893295
665 Ga0157380_13217925
666 Ga0157377_10313911
667 Ga0157379_10020677
668 Ga0157379_11608468
669 Ga0157376_10005217
670 Ga0157376_10072538
671 Ga0157376_10199953
672 Ga0157376_10511365
673 Ga0157376_10578449
674 Ga0163161_10404129
675 Ga0163161_11170662
676 Ga0206356_10387088
677 Ga0206356_11388378
678 Ga0206352_11007373
679 Ga0206354_10686882
680 Ga0206353_10498644
681 Ga0213876_10091331
682 Ga0207697_10256310
683 Ga0207656_10664729
684 Ga0207682_10028372
685 Ga0207682_10049731
686 Ga0207682_10470988
687 Ga0207642_10008816
688 Ga0207688_10016354
689 Ga0207680_11076995
690 Ga0207699_10115458
691 Ga0207645_10147756
692 Ga0207643_10486339
693 Ga0207684_10801209
694 Ga0207654_10312881
695 Ga0207707_11370035
696 Ga0207695_10127628
697 Ga0207693_10271834
698 Ga0207693_11046455
699 Ga0207663_10162775
700 Ga0207660_10348865
701 Ga0207660_10814571
702 Ga0207662_10376111
703 Ga0207662_10650574
704 Ga0207657_10673616
705 Ga0207652_11310639
706 Ga0207652_11643871
707 Ga0207646_11154946
708 Ga0207681_10005910
709 Ga0207681_10362227
710 Ga0207681_11054541
711 Ga0207694_10536136
712 Ga0207659_10007019
713 Ga0207659_10834058
714 Ga0207687_10671589
715 Ga0207700_10873442
716 Ga0207700_11940947
717 Ga0207690_10869785
718 Ga0207690_11529342
719 Ga0207690_11774125
720 Ga0207686_10013561
721 Ga0207686_10071937
722 Ga0207709_10017940
723 Ga0207669_10032080
724 Ga0207669_10094373
725 Ga0207669_10420344
726 Ga0207669_10534595
727 Ga0207669_10539749
728 Ga0207704_10017165
729 Ga0207704_10087580
730 Ga0207704_11370265
731 Ga0207691_10437679
732 Ga0207711_10777816
733 Ga0207711_11014850
734 Ga0207689_10008287
735 Ga0207661_10015620
736 Ga0207679_10222209
737 Ga0207667_10254260
738 Ga0207651_10009597
739 Ga0207712_12019334
740 Ga0207658_11348935
741 Ga0207677_10653645
742 Ga0207677_11980555
743 Ga0207677_11994084
744 Ga0207703_10010548
745 Ga0207678_10012209
746 Ga0207678_11621013
747 Ga0207708_10006094
748 Ga0207708_10117773
749 Ga0207708_10443741
750 Ga0207641_10041282
751 Ga0207641_10674961
752 Ga0207648_10010085
753 Ga0207648_10046392
754 Ga0207648_10308045
755 Ga0207648_12239642
756 Ga0207676_10072010
757 Ga0207676_10180013
758 Ga0207676_10554437
759 Ga0207674_10723649
760 Ga0207675_100221690
761 Ga0207675_100506737
762 Ga0207683_10068111
763 Ga0207683_10270023
764 Ga0207683_11246007
765 Ga0207683_11452101
766 Ga0207698_10536030
767 Ga0207698_12468269
768 Ga0209813_10057345
769 Ga0209974_10223554
770 Ga0268266_10010925
771 Ga0268265_10405359
772 Ga0268264_11502502
773 Ga0265336_10174197
774 Ga0265338_10974835
775 Ga0265330_10217660
776 Ga0265332_10317532
777 Ga0265316_10695120
778 Ga0307408_100029177
779 Ga0307408_100267401
780 Ga0265314_10015825
781 Ga0265314_10067188
782 Ga0265342_10437676
783 Ga0307410_10446226
784 Ga0307410_11202634
785 Ga0307406_10020295
786 Ga0307407_10099768
787 Ga0307407_10389760
788 Ga0307412_10279087
789 Ga0307409_100997265
790 Ga0307409_101128132
791 Ga0307409_102773155
792 Ga0307416_100093027
793 Ga0307416_100183669
794 Ga0307416_100580616
795 Ga0307416_101259009
796 Ga0307414_10304454
797 Ga0307414_10351886
798 Ga0307411_10011492
799 Ga0307411_10244053
800 Ga0307411_10648985
801 Ga0307415_100023733
802 Ga0373939_0541231
803 Ga0373945_0161065
804 Ga0373943_0482723
805 Ga0373946_0039775
806 Ga0373946_0265322
807 Ga0373955_0225844
808 Ga0373935_0318374
809 Ga0373935_1008795
810 Ga0373947_0309951
811 Ga0373937_0014151
812 Ga0373937_0889801
813 Ga0373937_0899031
814 Ga0373925_0052215
815 Ga0373925_0249509
816 Ga0373925_1106658
817 Ga0436365_0066771
818 Ga0436365_0676370
819 Ga0436365_1762974
820 Ga0436363_1476449
821 Ga0439453_0006901
822 Ga0451787_530025
823 Ga0451800_0405471
824 Ga0451807_0471799
825 Ga0451851_0535874
826 Ga0451853_3075205
827 Ga0439454_020878
828 Ga0450923_176545
829 Ga0439435_0204456
830 Ga0451577_0542744
831 Ga0439440_0205218
832 Ga0453683_1184799
833 Ga0453684_1528221
834 Ga0451576_0037954
835 Ga0466958_0307573
836 Ga0466967_2064745
837 Ga0495603_0235465
838 Ga0495629_0105276
839 Ga0495629_1046816
840 Ga0495628_1036949
841 Ga0495640_0529186
842 Ga0495586_0081359
843 Ga0495586_0379971
844 Ga0495621_0095256
845 Ga0495633_0501002
846 Ga0495634_0755005
847 Ga0495635_0078956
848 Ga0495635_0096019
849 Ga0495588_0504856
850 Ga0495647_0037043
851 Ga0495647_0242472
852 Ga0495658_0019223
853 Ga0495658_0053912
854 Ga0495658_0159337
855 Ga0495669_0001480
856 Ga0495613_0465564
857 Ga0495674_0401504
858 Ga0495676_0548113
859 Ga0496104_0327993
860 Ga0496104_0888833
861 Ga0496105_0523506
862 Ga0496105_0923268
863 Ga0496115_0088340
864 Ga0501034_0035726
865 Ga0501034_0896771
866 Ga0501036_0716140
867 Ga0501040_0311843
868 Ga0501042_0379575
869 Ga0501042_1022989
870 Ga0501047_0298709
871 Ga0501047_0566248
872 Ga0501048_1361458
873 Ga0501068_0686357
874 Ga0501070_0800206
875 Ga0501071_0481503
876 Ga0501071_0752221
877 Ga0501072_0280594
878 Ga0501074_0424478
879 Ga0501074_0776494
880 Ga0501074_0994495
881 Ga0501075_0245384
882 Ga0501075_0471893
883 Ga0501075_0788909
884 Ga0501076_0538979
885 Ga0501076_0623692
886 Ga0501080_0780684
887 Ga0501081_0684440
888 Ga0501083_0594548
889 nmdc:mga03683_1670_c1
890 nmdc:mga03n38_45084_c1
891 nmdc:mga00v17_1673_c1
892 nmdc:mga00v17_242811_c1
893 nmdc:mga00v17_292527_c1
894 nmdc:mga00v17_548460_c1
895 nmdc:mga0yw44_154455_c1
896 nmdc:mga0k408_41098_c1
897 nmdc:mga0k408_8072_c1
898 nmdc:mga06z11_2638_c1
899 nmdc:mga06z11_38893_c1
900 nmdc:mga04h51_186436_c1
901 nmdc:mga07m45_12447_c1
902 nmdc:mga05p37_123037_c1
903 nmdc:mga05p37_13843_c1
904 nmdc:mga05p37_47324_c1
905 nmdc:mga09592_1275827_c1
906 nmdc:mga09592_46648_c1
907 nmdc:mga09592_688212_c1
908 nmdc:mga0qj67_1278498_c1
909 nmdc:mga0qj67_35620_c1
910 nmdc:mga0qj67_508821_c1
911 nmdc:mga06r32_128110_c1
912 nmdc:mga06r32_373128_c1
913 nmdc:mga08y16_444849_c1
914 nmdc:mga08y16_511334_c1
915 nmdc:mga0n895_1156861_c1
916 nmdc:mga0n895_1648819_c1
917 nmdc:mga0n895_225821_c1
918 nmdc:mga0rr50_15768_c1
919 nmdc:mga0rr50_176678_c1
920 nmdc:mga08x19_230455_c1
921 nmdc:mga08x19_64698_c1
922 nmdc:mga0a205_225149_c1
923 Ga0495595_0471647
924 Ga0495619_0106141
925 Ga0501084_0722461
926 Ga0590071_015878
927 Ga0590075_012885
928 Ga0590077_035499
929 Ga0587073_0290013
930 Ga0587091_219154
931 Ga0587062_112099
932 Ga0501082_0222919
933 Ga0501082_0594872
934 Ga0530510_1550047

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map