F449656

General Info

Members Datasets Scaffolds Average Seq Length
466 246 464 297

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10580367|Ga0105248_105803671
Length 319
Sequence MPILSDGGSAMVGTRNAQASALAPEAPQPLTQDWIDQRVFDLYDEYCHGHIDRREFLARSAAVTIGGLAMAQALLPRYAQAQTISFTDPRIKARYVTYPSPGGTSGTMRGYLVQPNGPGPFATVLVIHENRGLNPYIEDVARRAAVGGFLAFAPDGLSPVGGYPGNDDDGRTLQAGLDQAKLRTDMINSARHLKGQPVSTGKLGVTGFCWGGSTTNFLAMTLGPEMHAGVPYYGAAAETAGVTKIKAPLLIQYAENDERINAMWPEYEKALKAAGVPHEMHMYPGTQHGFHNNSTPRYHEASAKLSWDRTIAFFKKHLA

Samples

Sample ID Description Type Environment
1 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
158 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
159 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
162 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
163 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
164 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
168 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
169 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
170 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
171 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
173 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
174 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
191 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
192 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
193 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
194 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
195 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
206 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
239 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
240 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
241 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
242 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
243 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.51
Nodule 0
Rhizoplane 0.64
Rhizosphere 90.56
Stem 0
Stem Tuber 0
Unclassified 1.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10021044 3300003911 Bacteria 1317
2 Ga0065715_10154919 3300005293 Bacteria 1685
3 Ga0065715_10212173 3300005293 Bacteria 1303
4 Ga0065707_10013126 3300005295 Bacteria 2003
5 Ga0070658_10133671 3300005327 Bacteria 2068
6 Ga0070676_10006343 3300005328 Bacteria 6318
7 Ga0070677_10014935 3300005333 Bacteria 2744
8 Ga0068869_100002645 3300005334 Bacteria 10823
9 Ga0068869_100079341 3300005334 Bacteria 2446
10 Ga0070666_10127298 3300005335 Bacteria 1768
11 Ga0070666_10211291 3300005335 Bacteria 1367
12 Ga0070680_100037811 3300005336 Bacteria 3901
13 Ga0070682_100004373 3300005337 Bacteria 7843
14 Ga0070682_100044543 3300005337 Bacteria 2748
15 Ga0070660_100380850 3300005339 Bacteria 1165
16 Ga0070689_100048233 3300005340 Bacteria 3284
17 Ga0070691_10021551 3300005341 Bacteria 2983
18 Ga0070661_100028127 3300005344 Bacteria 4054
19 Ga0070692_10032597 3300005345 Bacteria 2620
20 Ga0070692_10058200 3300005345 Bacteria 2029
21 Ga0070668_100250517 3300005347 Bacteria 1470
22 Ga0070669_100022628 3300005353 Bacteria 4494
23 Ga0070669_100328500 3300005353 Bacteria 1236
24 Ga0070675_100247709 3300005354 Bacteria 1558
25 Ga0070674_100352600 3300005356 Bacteria 1189
26 Ga0070673_100018625 3300005364 Bacteria 4965
27 Ga0070659_100001866 3300005366 Bacteria 15147
28 Ga0070659_100407438 3300005366 Bacteria 1149
29 Ga0070667_100075934 3300005367 Bacteria 2869
30 Ga0070701_10211000 3300005438 Bacteria 1153
31 Ga0070711_100011672 3300005439 Bacteria 5461
32 Ga0070711_100522791 3300005439 Bacteria 981
33 Ga0070705_100116396 3300005440 Bacteria 1718
34 Ga0070700_100033954 3300005441 Bacteria 3077
35 Ga0070700_100202582 3300005441 Bacteria 1395
36 Ga0070700_100447075 3300005441 Bacteria 982
37 Ga0070694_100008339 3300005444 Bacteria 6340
38 Ga0070694_100041630 3300005444 Bacteria 3066
39 Ga0070694_100050343 3300005444 Bacteria 2808
40 Ga0070694_100086132 3300005444 Bacteria 2195
41 Ga0070708_100017605 3300005445 Bacteria 5965
42 Ga0070663_100004072 3300005455 Bacteria 8537
43 Ga0070678_100024818 3300005456 Bacteria 4020
44 Ga0070678_100037914 3300005456 Bacteria 3389
45 Ga0070681_10153741 3300005458 Bacteria 2226
46 Ga0068867_100098594 3300005459 Bacteria 2228
47 Ga0070685_10078612 3300005466 Bacteria 1972
48 Ga0070706_100016515 3300005467 Bacteria 6819
49 Ga0070706_100025243 3300005467 Bacteria 5470
50 Ga0070707_100025168 3300005468 Bacteria 5644
51 Ga0070707_100039430 3300005468 Bacteria 4515
52 Ga0070707_100113784 3300005468 Bacteria 2625
53 Ga0070707_100533145 3300005468 Bacteria 1136
54 Ga0070698_100014147 3300005471 Bacteria 8436
55 Ga0070698_100019929 3300005471 Bacteria 7034
56 Ga0070698_100020542 3300005471 Bacteria 6923
57 Ga0070698_100311503 3300005471 Bacteria 1505
58 Ga0070699_100016378 3300005518 Bacteria 6366
59 Ga0070699_100086578 3300005518 Bacteria 2734
60 Ga0070684_100033985 3300005535 Bacteria 4357
61 Ga0070684_100081355 3300005535 Bacteria 2866
62 Ga0070684_100268298 3300005535 Bacteria 1562
63 Ga0070684_100344434 3300005535 Bacteria 1370
64 Ga0070697_100003357 3300005536 Bacteria 12299
65 Ga0070697_100036549 3300005536 Bacteria 3967
66 Ga0070697_100038602 3300005536 Bacteria 3859
67 Ga0070697_100061475 3300005536 Bacteria 3063
68 Ga0070697_100104117 3300005536 Bacteria 2360
69 Ga0070697_100323193 3300005536 Bacteria 1329
70 Ga0070697_100478124 3300005536 Bacteria 1088
71 Ga0070672_100049219 3300005543 Bacteria 3278
72 Ga0070672_100412179 3300005543 Bacteria 1159
73 Ga0070686_100079763 3300005544 Bacteria 2164
74 Ga0070686_100275454 3300005544 Bacteria 1239
75 Ga0070695_100003303 3300005545 Bacteria 9427
76 Ga0070695_100007273 3300005545 Bacteria 6563
77 Ga0070695_100011239 3300005545 Bacteria 5354
78 Ga0070696_100016271 3300005546 Bacteria 5004
79 Ga0070696_100077165 3300005546 Bacteria 2354
80 Ga0070693_100000843 3300005547 Bacteria 13653
81 Ga0070665_100003659 3300005548 Bacteria 16287
82 Ga0070665_100124813 3300005548 Bacteria 2576
83 Ga0070665_100331391 3300005548 Bacteria 1527
84 Ga0070704_100008491 3300005549 Bacteria 6161
85 Ga0070704_100012563 3300005549 Bacteria 5232
86 Ga0070704_100526211 3300005549 Bacteria 1030
87 Ga0068855_100001567 3300005563 Bacteria 28689
88 Ga0068855_100008997 3300005563 Bacteria 12064
89 Ga0070664_100477166 3300005564 Bacteria 1147
90 Ga0068856_100001093 3300005614 Bacteria 28597
91 Ga0068856_100330533 3300005614 Bacteria 1542
92 Ga0070702_100013611 3300005615 Bacteria 4111
93 Ga0068859_100054629 3300005617 Bacteria 4017
94 Ga0068859_100118691 3300005617 Bacteria 2711
95 Ga0068859_100148199 3300005617 Bacteria 2422
96 Ga0068859_100230549 3300005617 Bacteria 1940
97 Ga0068864_100067040 3300005618 Bacteria 3116
98 Ga0068866_10080481 3300005718 Bacteria 1748
99 Ga0068861_100029904 3300005719 Bacteria 3988
100 Ga0068861_100167939 3300005719 Bacteria 1816
101 Ga0068861_100235102 3300005719 Bacteria 1556
102 Ga0068861_100505111 3300005719 Bacteria 1094
103 Ga0068863_100089551 3300005841 Bacteria 2918
104 Ga0068858_100032144 3300005842 Bacteria 4875
105 Ga0068858_100507466 3300005842 Bacteria 1165
106 Ga0068860_100208862 3300005843 Bacteria 1893
107 Ga0068860_100469487 3300005843 Bacteria 1253
108 Ga0068862_100007309 3300005844 Bacteria 9169
109 Ga0068862_100014790 3300005844 Bacteria 6481
110 Ga0081455_10003994 3300005937 Bacteria 16750
111 Ga0081455_10034530 3300005937 Bacteria 4530
112 Ga0081455_10092794 3300005937 Bacteria 2442
113 Ga0081455_10332278 3300005937 Bacteria 1078
114 Ga0081455_10374264 3300005937 Bacteria 997
115 Ga0081538_10112585 3300005981 Bacteria 1332
116 Ga0081540_1027752 3300005983 Bacteria 3198
117 Ga0081539_10050163 3300005985 Bacteria 2363
118 Ga0075365_10005019 3300006038 Bacteria 7094
119 Ga0075363_100000477 3300006048 Bacteria 12634
120 Ga0075363_100002454 3300006048 Bacteria 7580
121 Ga0075364_10027306 3300006051 Bacteria 3645
122 Ga0070715_10070464 3300006163 Bacteria 1561
123 Ga0070712_100057046 3300006175 Bacteria 2742
124 Ga0075362_10007144 3300006177 Bacteria 4210
125 Ga0075362_10032437 3300006177 Bacteria 2266
126 Ga0075362_10038216 3300006177 Bacteria 2108
127 Ga0075367_10000548 3300006178 Bacteria 14225
128 Ga0075369_10020935 3300006186 Bacteria 2682
129 Ga0075369_10022620 3300006186 Bacteria 2594
130 Ga0075366_10006657 3300006195 Bacteria 6340
131 Ga0075366_10059375 3300006195 Bacteria 2272
132 Ga0097621_100023702 3300006237 Bacteria 4782
133 Ga0068871_100022089 3300006358 Bacteria 4902
134 Ga0075428_100001050 3300006844 Bacteria 29326
135 Ga0075428_100003836 3300006844 Bacteria 16503
136 Ga0075428_100013571 3300006844 Bacteria 9072
137 Ga0075428_100013819 3300006844 Bacteria 8991
138 Ga0075428_100060795 3300006844 Bacteria 4138
139 Ga0075428_100088446 3300006844 Bacteria 3378
140 Ga0075430_100000034 3300006846 Bacteria 70046
141 Ga0075430_100024841 3300006846 Bacteria 5097
142 Ga0075430_100037587 3300006846 Bacteria 4104
143 Ga0075430_100171430 3300006846 Bacteria 1805
144 Ga0075430_100333542 3300006846 Bacteria 1253
145 Ga0075431_100000573 3300006847 Bacteria 31102
146 Ga0075431_100022483 3300006847 Bacteria 6447
147 Ga0075431_100064507 3300006847 Bacteria 3782
148 Ga0075431_100080205 3300006847 Bacteria 3369
149 Ga0075431_100119289 3300006847 Bacteria 2722
150 Ga0075431_100542638 3300006847 Bacteria 1151
151 Ga0075433_10005884 3300006852 Bacteria 9659
152 Ga0075433_10034170 3300006852 Bacteria 4365
153 Ga0075433_10128475 3300006852 Bacteria 2251
154 Ga0075434_100003396 3300006871 Bacteria 14259
155 Ga0075434_100008961 3300006871 Bacteria 9318
156 Ga0075434_100034293 3300006871 Bacteria 5012
157 Ga0075434_100227219 3300006871 Bacteria 1886
158 Ga0075429_100011045 3300006880 Bacteria 7816
159 Ga0075429_100137481 3300006880 Bacteria 2138
160 Ga0075436_100021750 3300006914 Bacteria 4402
161 Ga0075436_100313813 3300006914 Bacteria 1125
162 Ga0097620_100054634 3300006931 Bacteria 4017
163 Ga0097620_100118685 3300006931 Bacteria 2711
164 Ga0097620_100148200 3300006931 Bacteria 2422
165 Ga0097620_100230537 3300006931 Bacteria 1940
166 Ga0097620_100650386 3300006931 Bacteria 1146
167 Ga0075435_100031047 3300007076 Bacteria 4206
168 Ga0075435_100088529 3300007076 Bacteria 2552
169 Ga0075435_100269382 3300007076 Bacteria 1452
170 Ga0099794_10000380 3300007265 Bacteria 15214
171 Ga0099794_10029784 3300007265 Bacteria 2545
172 Ga0099794_10121554 3300007265 Bacteria 1314
173 Ga0105240_10014073 3300009093 Bacteria 10935
174 Ga0111539_10000922 3300009094 Bacteria 38445
175 Ga0111539_10014111 3300009094 Bacteria 9986
176 Ga0111539_10052717 3300009094 Bacteria 4842
177 Ga0111539_10078467 3300009094 Bacteria 3884
178 Ga0111539_10705235 3300009094 Bacteria 1175
179 Ga0105245_10020740 3300009098 Bacteria 5761
180 Ga0105245_10398916 3300009098 Bacteria 1374
181 Ga0105247_10034765 3300009101 Bacteria 3070
182 Ga0105247_10040026 3300009101 Bacteria 2864
183 Ga0114129_10000529 3300009147 Bacteria 46728
184 Ga0114129_10010980 3300009147 Bacteria 12903
185 Ga0114129_10020131 3300009147 Bacteria 9495
186 Ga0114129_10041202 3300009147 Bacteria 6508
187 Ga0114129_10093889 3300009147 Bacteria 4155
188 Ga0114129_10155903 3300009147 Bacteria 3123
189 Ga0114129_10168299 3300009147 Bacteria 2989
190 Ga0114129_10183325 3300009147 Bacteria 2847
191 Ga0114129_10249539 3300009147 Bacteria 2383
192 Ga0114129_10380917 3300009147 Bacteria 1863
193 Ga0114129_10388625 3300009147 Bacteria 1841
194 Ga0105243_10056127 3300009148 Bacteria 3130
195 Ga0105241_10025283 3300009174 Bacteria 4412
196 Ga0105242_10102816 3300009176 Bacteria 2423
197 Ga0105248_10580367 3300009177 Bacteria 1265
198 Ga0105238_10223765 3300009551 Bacteria 1858
199 Ga0105249_10105646 3300009553 Bacteria 2655
200 Ga0157373_10000631 3300013100 Bacteria 27594
201 Ga0157371_10066042 3300013102 Bacteria 2562
202 Ga0157378_10129534 3300013297 Bacteria 2334
203 Ga0157378_10148801 3300013297 Bacteria 2180
204 Ga0163162_10225411 3300013306 Bacteria 2004
205 Ga0157372_10000318 3300013307 Bacteria 52922
206 Ga0157375_10029384 3300013308 Bacteria 5168
207 Ga0157375_10200047 3300013308 Bacteria 2153
208 Ga0163163_10108350 3300014325 Bacteria 2805
209 Ga0163163_10248029 3300014325 Bacteria 1831
210 Ga0163163_10743972 3300014325 Bacteria 1044
211 Ga0157380_10007331 3300014326 Bacteria 7832
212 Ga0157380_10338998 3300014326 Unclassified 1401
213 Ga0157376_10078983 3300014969 Bacteria 2819
214 Ga0157376_10171164 3300014969 Bacteria 1978
215 Ga0163161_10454767 3300017792 Bacteria 1036
216 Ga0207426_1004450 3300025302 Bacteria 6832
217 Ga0207697_10033604 3300025315 Bacteria 2099
218 Ga0207682_10001624 3300025893 Bacteria 10323
219 Ga0207710_10019723 3300025900 Bacteria 2878
220 Ga0207680_10063128 3300025903 Bacteria 2266
221 Ga0207680_10265863 3300025903 Bacteria 1188
222 Ga0207647_10062989 3300025904 Bacteria 2257
223 Ga0207645_10000318 3300025907 Bacteria 40262
224 Ga0207645_10014878 3300025907 Bacteria 5190
225 Ga0207643_10000486 3300025908 Bacteria 25550
226 Ga0207643_10119725 3300025908 Bacteria 1558
227 Ga0207705_10167268 3300025909 Bacteria 1654
228 Ga0207684_10012430 3300025910 Bacteria 7406
229 Ga0207684_10016934 3300025910 Bacteria 6261
230 Ga0207684_10090792 3300025910 Bacteria 2603
231 Ga0207707_10064650 3300025912 Bacteria 3185
232 Ga0207695_10206186 3300025913 Bacteria 1879
233 Ga0207693_10060498 3300025915 Bacteria 2967
234 Ga0207693_10186352 3300025915 Bacteria 1633
235 Ga0207660_10079142 3300025917 Bacteria 2411
236 Ga0207662_10012539 3300025918 Bacteria 4722
237 Ga0207662_10041569 3300025918 Bacteria 2707
238 Ga0207662_10253372 3300025918 Bacteria 1156
239 Ga0207649_10009872 3300025920 Bacteria 5232
240 Ga0207649_10034315 3300025920 Bacteria 3039
241 Ga0207652_10000863 3300025921 Bacteria 28662
242 Ga0207652_10252488 3300025921 Bacteria 1590
243 Ga0207646_10024506 3300025922 Bacteria 5527
244 Ga0207646_10031782 3300025922 Bacteria 4778
245 Ga0207646_10103243 3300025922 Bacteria 2557
246 Ga0207646_10175091 3300025922 Bacteria 1938
247 Ga0207681_10092824 3300025923 Bacteria 2159
248 Ga0207694_10309647 3300025924 Bacteria 1301
249 Ga0207650_10004253 3300025925 Bacteria 9771
250 Ga0207650_10132511 3300025925 Bacteria 1952
251 Ga0207659_10186338 3300025926 Bacteria 1648
252 Ga0207659_10441189 3300025926 Bacteria 1095
253 Ga0207700_10033618 3300025928 Bacteria 3671
254 Ga0207690_10003736 3300025932 Bacteria 9035
255 Ga0207706_10060859 3300025933 Bacteria 3325
256 Ga0207706_10067080 3300025933 Bacteria 3157
257 Ga0207706_10082080 3300025933 Bacteria 2833
258 Ga0207686_10205351 3300025934 Bacteria 1413
259 Ga0207686_10245730 3300025934 Bacteria 1305
260 Ga0207709_10210196 3300025935 Bacteria 1396
261 Ga0207709_10327821 3300025935 Bacteria 1148
262 Ga0207670_10025769 3300025936 Bacteria 3696
263 Ga0207670_10074967 3300025936 Bacteria 2350
264 Ga0207669_10015709 3300025937 Bacteria 3825
265 Ga0207669_10139162 3300025937 Bacteria 1682
266 Ga0207669_10229974 3300025937 Bacteria 1367
267 Ga0207691_10012117 3300025940 Bacteria 8265
268 Ga0207691_10035778 3300025940 Bacteria 4605
269 Ga0207689_10001438 3300025942 Bacteria 22757
270 Ga0207689_10055657 3300025942 Bacteria 3256
271 Ga0207689_10097645 3300025942 Bacteria 2413
272 Ga0207661_10178533 3300025944 Bacteria 1853
273 Ga0207667_10001363 3300025949 Bacteria 30642
274 Ga0207667_10449010 3300025949 Bacteria 1310
275 Ga0207651_10100199 3300025960 Bacteria 2147
276 Ga0207640_10342192 3300025981 Bacteria 1198
277 Ga0207703_10107274 3300026035 Bacteria 2377
278 Ga0207639_10017553 3300026041 Bacteria 5075
279 Ga0207678_10004914 3300026067 Bacteria 12006
280 Ga0207708_10002773 3300026075 Bacteria 12871
281 Ga0207708_10019628 3300026075 Bacteria 5097
282 Ga0207708_10250272 3300026075 Bacteria 1428
283 Ga0207708_10332187 3300026075 Bacteria 1243
284 Ga0207702_10004262 3300026078 Bacteria 12762
285 Ga0207702_10366493 3300026078 Bacteria 1382
286 Ga0207641_10211198 3300026088 Bacteria 1795
287 Ga0207648_10026702 3300026089 Bacteria 5129
288 Ga0207648_10043528 3300026089 Bacteria 3941
289 Ga0207648_10084039 3300026089 Bacteria 2776
290 Ga0207648_10281212 3300026089 Bacteria 1488
291 Ga0207676_10063638 3300026095 Bacteria 2930
292 Ga0207674_10002237 3300026116 Bacteria 24500
293 Ga0207675_100021157 3300026118 Bacteria 6060
294 Ga0207675_100067570 3300026118 Bacteria 3341
295 Ga0207675_100071879 3300026118 Bacteria 3235
296 Ga0207675_100164351 3300026118 Bacteria 2119
297 Ga0207683_10016495 3300026121 Bacteria 6287
298 Ga0207683_10084020 3300026121 Bacteria 2830
299 Ga0207683_10249756 3300026121 Bacteria 1619
300 Ga0209588_1002985 3300027671 Bacteria 4658
301 Ga0209588_1027658 3300027671 Bacteria 1805
302 Ga0207428_10001697 3300027907 Bacteria 22616
303 Ga0207428_10022968 3300027907 Bacteria 5253
304 Ga0207428_10198741 3300027907 Bacteria 1509
305 Ga0207428_10231621 3300027907 Bacteria 1382
306 Ga0207428_10415481 3300027907 Bacteria 984
307 Ga0268266_10078644 3300028379 Bacteria 2870
308 Ga0268266_10436421 3300028379 Bacteria 1243
309 Ga0268265_10051064 3300028380 Bacteria 3119
310 Ga0268265_10098859 3300028380 Bacteria 2351
311 Ga0268265_10208132 3300028380 Bacteria 1702
312 Ga0268265_10244732 3300028380 Bacteria 1585
313 Ga0268265_10378702 3300028380 Bacteria 1301
314 Ga0268264_10011071 3300028381 Bacteria 7449
315 Ga0265318_10006928 3300028577 Bacteria 5167
316 Ga0265320_10029129 3300031240 Bacteria 2859
317 Ga0265340_10002924 3300031247 Bacteria 9729
318 Ga0265340_10023654 3300031247 Bacteria 3131
319 Ga0307513_10058214 3300031456 Bacteria 4110
320 Ga0265313_10008906 3300031595 Bacteria 6598
321 Ga0316579_10002462 3300031691 Bacteria 6997
322 Ga0316576_10009465 3300031727 Bacteria 6290
323 Ga0316577_10184817 3300031733 Bacteria 1178
324 Ga0307416_100205219 3300032002 Bacteria 1874
325 Ga0307411_10035096 3300032005 Bacteria 3128
326 Ga0307411_10142727 3300032005 Bacteria 1768
327 Ga0316583_10012027 3300032133 Bacteria 3122
328 Ga0373928_0032361 3300035084 Bacteria 1166
329 Ga0373929_0026106 3300035085 Bacteria 1218
330 Ga0373949_0050146 3300035090 Bacteria 1049
331 Ga0373936_0017340 3300035113 Bacteria 2772
332 Ga0373939_0044336 3300035114 Bacteria 1353
333 Ga0373939_0081373 3300035114 Bacteria 1076
334 Ga0373941_0025017 3300035115 Bacteria 1720
335 Ga0373960_0025119 3300035121 Bacteria 1617
336 Ga0373960_0077348 3300035121 Bacteria 1041
337 Ga0373946_0062882 3300035171 Bacteria 1584
338 Ga0373942_0028525 3300035207 Bacteria 1459
339 Ga0373961_0002345 3300035241 Bacteria 4939
340 Ga0373961_0048697 3300035241 Bacteria 1250
341 Ga0316574_0136247 3300035398 Bacteria 1581
342 Ga0373931_0029962 3300035691 Bacteria 2798
343 Ga0373935_0001211 3300035692 Bacteria 14226
344 Ga0373935_0145303 3300035692 Bacteria 1605
345 Ga0373927_0136237 3300035695 Bacteria 1605
346 Ga0373937_0407239 3300036401 Bacteria 1290
347 Ga0316584_0136874 3300036712 Bacteria 1828
348 Ga0316584_0172385 3300036712 Bacteria 1604
349 Ga0395899_0020889 3300037312 Bacteria 4965
350 Ga0395899_0048564 3300037312 Bacteria 3158
351 Ga0395900_0004115 3300037418 Bacteria 15497
352 Ga0395898_0008227 3300037466 Bacteria 11028
353 Ga0316581_0012903 3300037588 Bacteria 2360
354 Ga0395901_0007155 3300038443 Bacteria 11264
355 Ga0436365_1330721 3300039437 Bacteria 5249
356 Ga0436365_1780730 3300039437 Bacteria 8644
357 Ga0436360_0779635 3300039438 Bacteria 10519
358 Ga0436361_0471899 3300039447 Bacteria 1637
359 Ga0436362_0220062 3300039453 Bacteria 1013
360 Ga0439441_004980 3300042001 Bacteria 2040
361 Ga0439448_0004758 3300042005 Bacteria 3841
362 Ga0439448_0010438 3300042005 Bacteria 2756
363 Ga0439459_0000039 3300042438 Bacteria 10840
364 Ga0451577_0083684 3300042876 Bacteria 2846
365 Ga0466963_0028204 3300044694 Bacteria 3602
366 Ga0451576_0000946 3300045051 Bacteria 54478
367 Ga0451576_0014576 3300045051 Bacteria 8737
368 Ga0451576_0044026 3300045051 Bacteria 4707
369 Ga0466967_0260382 3300045976 Bacteria 1659
370 Ga0495580_0027241 3300046472 Bacteria 4159
371 Ga0495580_0167794 3300046472 Bacteria 1518
372 Ga0495580_0240313 3300046472 Bacteria 1242
373 Ga0495594_0016795 3300046499 Bacteria 3861
374 Ga0495594_0118334 3300046499 Bacteria 1497
375 Ga0495656_0065295 3300046615 Bacteria 1600
376 Ga0495656_0103313 3300046615 Bacteria 1321
377 Ga0495669_0084462 3300046684 Bacteria 1460
378 Ga0495604_0178545 3300047317 Bacteria 1487
379 Ga0495636_0068495 3300047318 Bacteria 1511
380 Ga0495615_0003747 3300048090 Bacteria 2579
381 Ga0496102_0028850 3300048905 Bacteria 4961
382 Ga0496102_0146793 3300048905 Bacteria 2214
383 Ga0496112_0092248 3300048915 Bacteria 2998
384 Ga0496126_0030413 3300048929 Bacteria 5116
385 Ga0501034_0000826 3300049571 Bacteria 46024
386 Ga0501034_0008942 3300049571 Bacteria 10531
387 Ga0501040_0126453 3300049576 Bacteria 1796
388 Ga0501047_0108416 3300049581 Bacteria 2659
389 Ga0501067_0028908 3300049583 Bacteria 3073
390 Ga0501071_0213164 3300049587 Bacteria 1452
391 Ga0501072_0109602 3300049588 Bacteria 2197
392 Ga0501074_0289151 3300049590 Bacteria 1165
393 Ga0501075_0015687 3300049591 Bacteria 5442
394 Ga0501076_0095972 3300049592 Bacteria 2388
395 Ga0501077_0167185 3300049593 Bacteria 1397
396 Ga0501081_0058617 3300049743 Bacteria 2665
397 Ga0501044_0015489 3300049823 Bacteria 8212
398 Ga0501045_0402442 3300049824 Bacteria 1019
399 nmdc:mga03n38_10735_c1 3300050490 Bacteria 3384
400 nmdc:mga03n38_9393_c1 3300050490 Bacteria 3557
401 nmdc:mga0yw44_123546_c1 3300050492 Bacteria 1669
402 nmdc:mga0yw44_127114_c1 3300050492 Bacteria 1647
403 nmdc:mga0yw44_13106_c1 3300050492 Bacteria 4351
404 nmdc:mga0yw44_220181_c1 3300050492 Bacteria 1258
405 nmdc:mga0yw44_30085_c1 3300050492 Bacteria 3143
406 nmdc:mga0k408_6009_c1 3300050493 Bacteria 6478
407 nmdc:mga06z11_1071_c1 3300050494 Bacteria 9953
408 nmdc:mga06z11_1346_c1 3300050494 Bacteria 9089
409 nmdc:mga06z11_336182_c1 3300050494 Bacteria 902
410 nmdc:mga06z11_72849_c1 3300050494 Bacteria 1822
411 nmdc:mga04h51_19226_c1 3300050495 Bacteria 2023
412 nmdc:mga04h51_71440_c1 3300050495 Bacteria 1212
413 nmdc:mga07m45_149707_c1 3300050496 Bacteria 1353
414 nmdc:mga05p37_241108_c1 3300050507 Bacteria 2174
415 nmdc:mga05p37_286814_c1 3300050507 Bacteria 1961
416 nmdc:mga05p37_32136_c2 3300050507 Bacteria 5266
417 nmdc:mga05p37_4023_c1 3300050507 Bacteria 17188
418 nmdc:mga05p37_515_c1 3300050507 Bacteria 42751
419 nmdc:mga05p37_65258_c1 3300050507 Bacteria 4480
420 nmdc:mga05p37_81437_c1 3300050507 Bacteria 3987
421 nmdc:mga05p37_98434_c1 3300050507 Bacteria 3602
422 nmdc:mga09592_217980_c1 3300050508 Bacteria 1653
423 nmdc:mga09592_25423_c1 3300050508 Bacteria 4901
424 nmdc:mga09592_41553_c1 3300050508 Bacteria 3866
425 nmdc:mga09592_59291_c1 3300050508 Bacteria 3236
426 nmdc:mga09592_96297_c1 3300050508 Bacteria 2531
427 nmdc:mga0qj67_119004_c1 3300050509 Bacteria 2136
428 nmdc:mga0qj67_1580_c1 3300050509 Bacteria 16011
429 nmdc:mga0qj67_20214_c1 3300050509 Bacteria 5097
430 nmdc:mga0qj67_46050_c1 3300050509 Bacteria 3442
431 nmdc:mga06r32_128552_c1 3300050510 Bacteria 2503
432 nmdc:mga06r32_2324_c1 3300050510 Bacteria 17027
433 nmdc:mga06r32_23611_c1 3300050510 Bacteria 5693
434 nmdc:mga06r32_28_c1 3300050510 Bacteria 87379
435 nmdc:mga06r32_586073_c1 3300050510 Bacteria 1087
436 nmdc:mga06r32_7255_c1 3300050510 Bacteria 9986
437 nmdc:mga08y16_124_c2 3300050511 Bacteria 38531
438 nmdc:mga08y16_13540_c1 3300050511 Bacteria 8585
439 nmdc:mga08y16_14351_c1 3300050511 Bacteria 8339
440 nmdc:mga08y16_247363_c1 3300050511 Bacteria 1843
441 nmdc:mga08y16_263524_c1 3300050511 Bacteria 1780
442 nmdc:mga08y16_74284_c1 3300050511 Bacteria 3542
443 nmdc:mga0n895_17440_c1 3300050512 Bacteria 6616
444 nmdc:mga0n895_21138_c1 3300050512 Bacteria 6082
445 nmdc:mga0rr50_49646_c1 3300050513 Bacteria 3107
446 nmdc:mga08x19_162563_c1 3300050514 Bacteria 1517
447 nmdc:mga08x19_21892_c1 3300050514 Bacteria 3952
448 nmdc:mga08x19_30143_c1 3300050514 Bacteria 3406
449 nmdc:mga08x19_46866_c1 3300050514 Bacteria 2766
450 nmdc:mga0a205_137952_c1 3300050515 Bacteria 2339
451 nmdc:mga0a205_3634_c1 3300050515 Bacteria 13810
452 nmdc:mga0a205_5781_c1 3300050515 Bacteria 11151
453 nmdc:mga0a205_58820_c1 3300050515 Bacteria 3713
454 nmdc:mga0sz30_4470_c1 3300050516 Bacteria 2618
455 nmdc:mga0sz30_76758_c1 3300050516 Bacteria 1443
456 Ga0500610_0058965 3300053079 Bacteria 2003
457 Ga0500641_0005144 3300053096 Bacteria 4636
458 Ga0500658_0059027 3300053134 Bacteria 1590
459 Ga0500568_0041495 3300053139 Bacteria 1848
460 Ga0500616_0002472 3300053153 Bacteria 15337
461 Ga0501084_0046612 3300054114 Bacteria 3632
462 Ga0501084_0201905 3300054114 Bacteria 1677
463 Ga0501082_0083172 3300060353 Bacteria 2762
464 Ga0501082_0164199 3300060353 Bacteria 1930

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035114 Ga0373939_0081373 Ga0373939_0081373_26_949 253
2 3300005440 Ga0070705_100116396 Ga0070705_1001163962 254
3 3300005444 Ga0070694_100008339 Ga0070694_1000083392 254
4 3300005545 Ga0070695_100003303 Ga0070695_1000033038 254
5 3300049593 Ga0501077_0167185 Ga0501077_0167185_562_1344 257
6 3300032005 Ga0307411_10142727 Ga0307411_101427271 258
7 3300037312 Ga0395899_0020889 Ga0395899_0020889_576_1460 262
8 3300050494 nmdc:mga06z11_336182_c1 nmdc:mga06z11_336182_c1_77_868 263
9 3300005327 Ga0070658_10133671 Ga0070658_101336712 265
10 3300005336 Ga0070680_100037811 Ga0070680_1000378113 265
11 3300005341 Ga0070691_10021551 Ga0070691_100215512 265
12 3300005458 Ga0070681_10153741 Ga0070681_101537413 265
13 3300005563 Ga0068855_100008997 Ga0068855_1000089973 265
14 3300005614 Ga0068856_100330533 Ga0068856_1003305331 265
15 3300009093 Ga0105240_10014073 Ga0105240_1001407311 265
16 3300009551 Ga0105238_10223765 Ga0105238_102237652 265
17 3300025909 Ga0207705_10167268 Ga0207705_101672682 265
18 3300025912 Ga0207707_10064650 Ga0207707_100646503 265
19 3300025913 Ga0207695_10206186 Ga0207695_102061862 265
20 3300025924 Ga0207694_10309647 Ga0207694_103096472 265
21 3300025949 Ga0207667_10449010 Ga0207667_104490102 265
22 3300026078 Ga0207702_10366493 Ga0207702_103664932 265
23 3300044694 Ga0466963_0028204 Ga0466963_0028204_1058_1942 266
24 3300045976 Ga0466967_0260382 Ga0466967_0260382_628_1512 266
25 3300035207 Ga0373942_0028525 Ga0373942_0028525_153_1067 267
26 3300036401 Ga0373937_0407239 Ga0373937_0407239_281_1171 268
27 3300035084 Ga0373928_0032361 Ga0373928_0032361_342_1151 269
28 3300005518 Ga0070699_100086578 Ga0070699_1000865783 277
29 3300005545 Ga0070695_100011239 Ga0070695_1000112395 281
30 3300026075 Ga0207708_10019628 Ga0207708_100196286 281
31 3300035695 Ga0373927_0136237 Ga0373927_0136237_709_1554 281
32 3300005467 Ga0070706_100016515 Ga0070706_1000165154 283
33 3300025910 Ga0207684_10012430 Ga0207684_100124305 283
34 3300025918 Ga0207662_10041569 Ga0207662_100415692 285
35 3300005339 Ga0070660_100380850 Ga0070660_1003808502 286
36 3300005366 Ga0070659_100407438 Ga0070659_1004074382 286
37 3300005535 Ga0070684_100344434 Ga0070684_1003444342 286
38 3300025921 Ga0207652_10252488 Ga0207652_102524882 286
39 3300042005 Ga0439448_0010438 Ga0439448_0010438_1812_2696 286
40 3300005536 Ga0070697_100003357 Ga0070697_1000033579 287
41 3300007265 Ga0099794_10029784 Ga0099794_100297842 287
42 3300027671 Ga0209588_1027658 Ga0209588_10276582 287
43 3300035085 Ga0373929_0026106 Ga0373929_0026106_295_1188 287
44 3300005536 Ga0070697_100061475 Ga0070697_1000614752 289
45 3300005981 Ga0081538_10112585 Ga0081538_101125852 290
46 3300031727 Ga0316576_10009465 Ga0316576_100094657 290
47 3300031733 Ga0316577_10184817 Ga0316577_101848171 290
48 3300035121 Ga0373960_0077348 Ga0373960_0077348_151_1023 290
49 3300035398 Ga0316574_0136247 Ga0316574_0136247_272_1153 290
50 3300036712 Ga0316584_0136874 Ga0316584_0136874_923_1804 290
51 3300046684 Ga0495669_0084462 Ga0495669_0084462_480_1361 290
52 3300049583 Ga0501067_0028908 Ga0501067_0028908_473_1345 290
53 3300049590 Ga0501074_0289151 Ga0501074_0289151_70_954 290
54 3300050490 nmdc:mga03n38_9393_c1 nmdc:mga03n38_9393_c1_534_1406 290
55 3300050494 nmdc:mga06z11_1346_c1 nmdc:mga06z11_1346_c1_831_1703 290
56 3300060353 Ga0501082_0164199 Ga0501082_0164199_334_1218 290
57 3300005293 Ga0065715_10154919 Ga0065715_101549192 291
58 3300005295 Ga0065707_10013126 Ga0065707_100131262 291
59 3300005328 Ga0070676_10006343 Ga0070676_100063431 291
60 3300005334 Ga0068869_100002645 Ga0068869_1000026454 291
61 3300005335 Ga0070666_10127298 Ga0070666_101272982 291
62 3300005337 Ga0070682_100004373 Ga0070682_1000043733 291
63 3300005344 Ga0070661_100028127 Ga0070661_1000281273 291
64 3300005345 Ga0070692_10032597 Ga0070692_100325972 291
65 3300005353 Ga0070669_100328500 Ga0070669_1003285001 291
66 3300005356 Ga0070674_100352600 Ga0070674_1003526001 291
67 3300005364 Ga0070673_100018625 Ga0070673_1000186254 291
68 3300005366 Ga0070659_100001866 Ga0070659_1000018662 291
69 3300005367 Ga0070667_100075934 Ga0070667_1000759342 291
70 3300005441 Ga0070700_100202582 Ga0070700_1002025822 291
71 3300005455 Ga0070663_100004072 Ga0070663_1000040724 291
72 3300005456 Ga0070678_100037914 Ga0070678_1000379143 291
73 3300005535 Ga0070684_100081355 Ga0070684_1000813552 291
74 3300005545 Ga0070695_100007273 Ga0070695_1000072735 291
75 3300005547 Ga0070693_100000843 Ga0070693_1000008438 291
76 3300005549 Ga0070704_100008491 Ga0070704_1000084916 291
77 3300005563 Ga0068855_100001567 Ga0068855_10000156730 291
78 3300005564 Ga0070664_100477166 Ga0070664_1004771662 291
79 3300005614 Ga0068856_100001093 Ga0068856_10000109329 291
80 3300005615 Ga0070702_100013611 Ga0070702_1000136113 291
81 3300005617 Ga0068859_100148199 Ga0068859_1001481992 291
82 3300005719 Ga0068861_100235102 Ga0068861_1002351022 291
83 3300005842 Ga0068858_100032144 Ga0068858_1000321444 291
84 3300005843 Ga0068860_100208862 Ga0068860_1002088621 291
85 3300005844 Ga0068862_100007309 Ga0068862_1000073094 291
86 3300005985 Ga0081539_10050163 Ga0081539_100501633 291
87 3300006844 Ga0075428_100013571 Ga0075428_10001357110 291
88 3300006844 Ga0075428_100060795 Ga0075428_1000607952 291
89 3300006847 Ga0075431_100119289 Ga0075431_1001192892 291
90 3300006852 Ga0075433_10128475 Ga0075433_101284752 291
91 3300006871 Ga0075434_100227219 Ga0075434_1002272192 291
92 3300006880 Ga0075429_100137481 Ga0075429_1001374812 291
93 3300006931 Ga0097620_100148200 Ga0097620_1001482002 291
94 3300006931 Ga0097620_100650386 Ga0097620_1006503861 291
95 3300009094 Ga0111539_10014111 Ga0111539_100141115 291
96 3300009147 Ga0114129_10041202 Ga0114129_100412026 291
97 3300009147 Ga0114129_10388625 Ga0114129_103886252 291
98 3300013100 Ga0157373_10000631 Ga0157373_1000063130 291
99 3300013102 Ga0157371_10066042 Ga0157371_100660423 291
100 3300013307 Ga0157372_10000318 Ga0157372_1000031854 291
101 3300014325 Ga0163163_10743972 Ga0163163_107439721 291
102 3300014326 Ga0157380_10338998 Ga0157380_103389982 291
103 3300025302 Ga0207426_1004450 Ga0207426_10044503 291
104 3300025903 Ga0207680_10265863 Ga0207680_102658631 291
105 3300025907 Ga0207645_10000318 Ga0207645_100003183 291
106 3300025908 Ga0207643_10000486 Ga0207643_100004862 291
107 3300025920 Ga0207649_10009872 Ga0207649_100098722 291
108 3300025921 Ga0207652_10000863 Ga0207652_100008632 291
109 3300025923 Ga0207681_10092824 Ga0207681_100928242 291
110 3300025925 Ga0207650_10004253 Ga0207650_100042537 291
111 3300025932 Ga0207690_10003736 Ga0207690_100037363 291
112 3300025933 Ga0207706_10082080 Ga0207706_100820802 291
113 3300025937 Ga0207669_10139162 Ga0207669_101391622 291
114 3300025937 Ga0207669_10229974 Ga0207669_102299742 291
115 3300025942 Ga0207689_10001438 Ga0207689_1000143823 291
116 3300025949 Ga0207667_10001363 Ga0207667_100013633 291
117 3300026035 Ga0207703_10107274 Ga0207703_101072742 291
118 3300026041 Ga0207639_10017553 Ga0207639_100175533 291
119 3300026067 Ga0207678_10004914 Ga0207678_100049142 291
120 3300026078 Ga0207702_10004262 Ga0207702_100042621 291
121 3300026089 Ga0207648_10026702 Ga0207648_100267024 291
122 3300026095 Ga0207676_10063638 Ga0207676_100636381 291
123 3300026116 Ga0207674_10002237 Ga0207674_100022372 291
124 3300026118 Ga0207675_100071879 Ga0207675_1000718792 291
125 3300026118 Ga0207675_100164351 Ga0207675_1001643512 291
126 3300026121 Ga0207683_10084020 Ga0207683_100840202 291
127 3300028379 Ga0268266_10436421 Ga0268266_104364212 291
128 3300028380 Ga0268265_10378702 Ga0268265_103787021 291
129 3300028381 Ga0268264_10011071 Ga0268264_100110712 291
130 3300031247 Ga0265340_10023654 Ga0265340_100236543 291
131 3300036712 Ga0316584_0172385 Ga0316584_0172385_47_931 291
132 3300042005 Ga0439448_0004758 Ga0439448_0004758_1316_2245 291
133 3300042438 Ga0439459_0000039 Ga0439459_0000039_1064_1981 291
134 3300042876 Ga0451577_0083684 Ga0451577_0083684_1860_2765 291
135 3300045051 Ga0451576_0044026 Ga0451576_0044026_1881_2798 291
136 3300048905 Ga0496102_0028850 Ga0496102_0028850_3079_4008 291
137 3300048915 Ga0496112_0092248 Ga0496112_0092248_1358_2263 291
138 3300049571 Ga0501034_0000826 Ga0501034_0000826_25750_26634 291
139 3300049571 Ga0501034_0008942 Ga0501034_0008942_3364_4248 291
140 3300049823 Ga0501044_0015489 Ga0501044_0015489_2937_3821 291
141 3300050508 nmdc:mga09592_25423_c1 nmdc:mga09592_25423_c1_2440_3324 291
142 3300050510 nmdc:mga06r32_23611_c1 nmdc:mga06r32_23611_c1_734_1609 291
143 3300050511 nmdc:mga08y16_14351_c1 nmdc:mga08y16_14351_c1_3601_4485 291
144 3300005439 Ga0070711_100522791 Ga0070711_1005227911 292
145 3300005548 Ga0070665_100003659 Ga0070665_10000365911 292
146 3300005548 Ga0070665_100124813 Ga0070665_1001248132 292
147 3300025915 Ga0207693_10186352 Ga0207693_101863521 292
148 3300025920 Ga0207649_10034315 Ga0207649_100343151 292
149 3300025928 Ga0207700_10033618 Ga0207700_100336182 292
150 3300026121 Ga0207683_10249756 Ga0207683_102497562 292
151 3300028379 Ga0268266_10078644 Ga0268266_100786443 292
152 3300031691 Ga0316579_10002462 Ga0316579_100024628 292
153 3300032133 Ga0316583_10012027 Ga0316583_100120273 292
154 3300037588 Ga0316581_0012903 Ga0316581_0012903_369_1247 292
155 3300049581 Ga0501047_0108416 Ga0501047_0108416_594_1484 292
156 3300049587 Ga0501071_0213164 Ga0501071_0213164_41_940 292
157 3300005337 Ga0070682_100044543 Ga0070682_1000445432 293
158 3300005345 Ga0070692_10058200 Ga0070692_100582002 293
159 3300005347 Ga0070668_100250517 Ga0070668_1002505172 293
160 3300005353 Ga0070669_100022628 Ga0070669_1000226283 293
161 3300005439 Ga0070711_100011672 Ga0070711_1000116725 293
162 3300005441 Ga0070700_100033954 Ga0070700_1000339542 293
163 3300005467 Ga0070706_100025243 Ga0070706_1000252432 293
164 3300005468 Ga0070707_100039430 Ga0070707_1000394303 293
165 3300005471 Ga0070698_100014147 Ga0070698_1000141472 293
166 3300005518 Ga0070699_100016378 Ga0070699_1000163784 293
167 3300005535 Ga0070684_100033985 Ga0070684_1000339854 293
168 3300005536 Ga0070697_100038602 Ga0070697_1000386023 293
169 3300005536 Ga0070697_100323193 Ga0070697_1003231931 293
170 3300005543 Ga0070672_100049219 Ga0070672_1000492192 293
171 3300005549 Ga0070704_100012563 Ga0070704_1000125634 293
172 3300005719 Ga0068861_100029904 Ga0068861_1000299043 293
173 3300005841 Ga0068863_100089551 Ga0068863_1000895513 293
174 3300005937 Ga0081455_10092794 Ga0081455_100927942 293
175 3300006163 Ga0070715_10070464 Ga0070715_100704641 293
176 3300006175 Ga0070712_100057046 Ga0070712_1000570463 293
177 3300006177 Ga0075362_10032437 Ga0075362_100324373 293
178 3300006186 Ga0075369_10020935 Ga0075369_100209353 293
179 3300006186 Ga0075369_10022620 Ga0075369_100226202 293
180 3300006237 Ga0097621_100023702 Ga0097621_1000237025 293
181 3300006358 Ga0068871_100022089 Ga0068871_1000220894 293
182 3300006844 Ga0075428_100013819 Ga0075428_1000138197 293
183 3300006846 Ga0075430_100037587 Ga0075430_1000375873 293
184 3300006880 Ga0075429_100011045 Ga0075429_1000110454 293
185 3300007076 Ga0075435_100088529 Ga0075435_1000885292 293
186 3300007076 Ga0075435_100269382 Ga0075435_1002693822 293
187 3300007265 Ga0099794_10000380 Ga0099794_100003808 293
188 3300009094 Ga0111539_10052717 Ga0111539_100527172 293
189 3300009147 Ga0114129_10020131 Ga0114129_100201313 293
190 3300009147 Ga0114129_10093889 Ga0114129_100938891 293
191 3300009147 Ga0114129_10183325 Ga0114129_101833251 293
192 3300009148 Ga0105243_10056127 Ga0105243_100561273 293
193 3300009174 Ga0105241_10025283 Ga0105241_100252833 293
194 3300009553 Ga0105249_10105646 Ga0105249_101056463 293
195 3300013297 Ga0157378_10129534 Ga0157378_101295341 293
196 3300014326 Ga0157380_10007331 Ga0157380_100073316 293
197 3300014969 Ga0157376_10078983 Ga0157376_100789832 293
198 3300025910 Ga0207684_10016934 Ga0207684_100169345 293
199 3300025915 Ga0207693_10060498 Ga0207693_100604983 293
200 3300025922 Ga0207646_10024506 Ga0207646_100245063 293
201 3300025922 Ga0207646_10031782 Ga0207646_100317823 293
202 3300025933 Ga0207706_10060859 Ga0207706_100608593 293
203 3300025934 Ga0207686_10245730 Ga0207686_102457302 293
204 3300025935 Ga0207709_10210196 Ga0207709_102101962 293
205 3300025940 Ga0207691_10035778 Ga0207691_100357784 293
206 3300025944 Ga0207661_10178533 Ga0207661_101785331 293
207 3300026075 Ga0207708_10002773 Ga0207708_100027738 293
208 3300026088 Ga0207641_10211198 Ga0207641_102111981 293
209 3300026089 Ga0207648_10281212 Ga0207648_102812122 293
210 3300026118 Ga0207675_100021157 Ga0207675_1000211575 293
211 3300027907 Ga0207428_10022968 Ga0207428_100229685 293
212 3300028380 Ga0268265_10208132 Ga0268265_102081322 293
213 3300032002 Ga0307416_100205219 Ga0307416_1002052193 293
214 3300032005 Ga0307411_10035096 Ga0307411_100350962 293
215 3300035121 Ga0373960_0025119 Ga0373960_0025119_360_1241 293
216 3300037312 Ga0395899_0048564 Ga0395899_0048564_2200_3090 293
217 3300037418 Ga0395900_0004115 Ga0395900_0004115_12886_13776 293
218 3300037466 Ga0395898_0008227 Ga0395898_0008227_5727_6617 293
219 3300038443 Ga0395901_0007155 Ga0395901_0007155_6428_7318 293
220 3300039453 Ga0436362_0220062 Ga0436362_0220062_54_941 293
221 3300046472 Ga0495580_0027241 Ga0495580_0027241_839_1720 293
222 3300046472 Ga0495580_0167794 Ga0495580_0167794_11_892 293
223 3300046472 Ga0495580_0240313 Ga0495580_0240313_17_898 293
224 3300046499 Ga0495594_0016795 Ga0495594_0016795_247_1140 293
225 3300046615 Ga0495656_0065295 Ga0495656_0065295_667_1560 293
226 3300048905 Ga0496102_0146793 Ga0496102_0146793_352_1245 293
227 3300049591 Ga0501075_0015687 Ga0501075_0015687_284_1168 293
228 3300049824 Ga0501045_0402442 Ga0501045_0402442_65_967 293
229 3300050492 nmdc:mga0yw44_123546_c1 nmdc:mga0yw44_123546_c1_762_1643 293
230 3300050492 nmdc:mga0yw44_13106_c1 nmdc:mga0yw44_13106_c1_2684_3565 293
231 3300050494 nmdc:mga06z11_72849_c1 nmdc:mga06z11_72849_c1_713_1594 293
232 3300050496 nmdc:mga07m45_149707_c1 nmdc:mga07m45_149707_c1_13_894 293
233 3300050507 nmdc:mga05p37_241108_c1 nmdc:mga05p37_241108_c1_121_1002 293
234 3300050507 nmdc:mga05p37_32136_c2 nmdc:mga05p37_32136_c2_2203_3084 293
235 3300050507 nmdc:mga05p37_4023_c1 nmdc:mga05p37_4023_c1_6571_7452 293
236 3300050507 nmdc:mga05p37_65258_c1 nmdc:mga05p37_65258_c1_992_1882 293
237 3300050508 nmdc:mga09592_41553_c1 nmdc:mga09592_41553_c1_583_1485 293
238 3300050508 nmdc:mga09592_96297_c1 nmdc:mga09592_96297_c1_376_1266 293
239 3300050509 nmdc:mga0qj67_46050_c1 nmdc:mga0qj67_46050_c1_2208_3110 293
240 3300050510 nmdc:mga06r32_586073_c1 nmdc:mga06r32_586073_c1_185_1069 293
241 3300050511 nmdc:mga08y16_13540_c1 nmdc:mga08y16_13540_c1_2198_3091 293
242 3300050512 nmdc:mga0n895_17440_c1 nmdc:mga0n895_17440_c1_1196_2077 293
243 3300050513 nmdc:mga0rr50_49646_c1 nmdc:mga0rr50_49646_c1_645_1526 293
244 3300050514 nmdc:mga08x19_46866_c1 nmdc:mga08x19_46866_c1_1808_2689 293
245 3300050515 nmdc:mga0a205_137952_c1 nmdc:mga0a205_137952_c1_119_1009 293
246 3300050515 nmdc:mga0a205_3634_c1 nmdc:mga0a205_3634_c1_10352_11233 293
247 3300050516 nmdc:mga0sz30_4470_c1 nmdc:mga0sz30_4470_c1_120_1001 293
248 3300050516 nmdc:mga0sz30_76758_c1 nmdc:mga0sz30_76758_c1_425_1306 293
249 3300053153 Ga0500616_0002472 Ga0500616_0002472_13273_14154 293
250 3300005468 Ga0070707_100025168 Ga0070707_1000251685 294
251 3300005471 Ga0070698_100019929 Ga0070698_1000199294 294
252 3300005535 Ga0070684_100268298 Ga0070684_1002682982 294
253 3300005937 Ga0081455_10374264 Ga0081455_103742641 294
254 3300025936 Ga0207670_10025769 Ga0207670_100257694 294
255 3300049576 Ga0501040_0126453 Ga0501040_0126453_512_1423 294
256 3300054114 Ga0501084_0046612 Ga0501084_0046612_1163_2047 294
257 3300005438 Ga0070701_10211000 Ga0070701_102110001 295
258 3300005444 Ga0070694_100050343 Ga0070694_1000503432 295
259 3300005536 Ga0070697_100478124 Ga0070697_1004781241 295
260 3300005544 Ga0070686_100275454 Ga0070686_1002754542 295
261 3300005719 Ga0068861_100505111 Ga0068861_1005051111 295
262 3300005842 Ga0068858_100507466 Ga0068858_1005074662 295
263 3300006195 Ga0075366_10006657 Ga0075366_100066577 295
264 3300009101 Ga0105247_10034765 Ga0105247_100347652 295
265 3300013297 Ga0157378_10148801 Ga0157378_101488012 295
266 3300017792 Ga0163161_10454767 Ga0163161_104547671 295
267 3300025900 Ga0207710_10019723 Ga0207710_100197233 295
268 3300025925 Ga0207650_10132511 Ga0207650_101325112 295
269 3300025926 Ga0207659_10441189 Ga0207659_104411891 295
270 3300028380 Ga0268265_10051064 Ga0268265_100510642 295
271 3300039437 Ga0436365_1330721 Ga0436365_1330721_1875_2801 295
272 3300050493 nmdc:mga0k408_6009_c1 nmdc:mga0k408_6009_c1_957_1844 295
273 iso_pu_bacteria 2929199973 2929206149 295
274 iso_pu_bacteria 8055909800 8055912662 295
275 3300005444 Ga0070694_100041630 Ga0070694_1000416304 296
276 3300005445 Ga0070708_100017605 Ga0070708_1000176054 296
277 3300005459 Ga0068867_100098594 Ga0068867_1000985942 296
278 3300005468 Ga0070707_100113784 Ga0070707_1001137842 296
279 3300005468 Ga0070707_100533145 Ga0070707_1005331452 296
280 3300005471 Ga0070698_100020542 Ga0070698_1000205425 296
281 3300005471 Ga0070698_100311503 Ga0070698_1003115032 296
282 3300005536 Ga0070697_100036549 Ga0070697_1000365493 296
283 3300005536 Ga0070697_100104117 Ga0070697_1001041172 296
284 3300005546 Ga0070696_100077165 Ga0070696_1000771652 296
285 3300005617 Ga0068859_100118691 Ga0068859_1001186914 296
286 3300005937 Ga0081455_10034530 Ga0081455_100345303 296
287 3300005983 Ga0081540_1027752 Ga0081540_10277522 296
288 3300006177 Ga0075362_10038216 Ga0075362_100382162 296
289 3300006844 Ga0075428_100001050 Ga0075428_10000105029 296
290 3300006846 Ga0075430_100024841 Ga0075430_1000248412 296
291 3300006847 Ga0075431_100000573 Ga0075431_10000057310 296
292 3300006852 Ga0075433_10005884 Ga0075433_100058842 296
293 3300006871 Ga0075434_100003396 Ga0075434_10000339612 296
294 3300006871 Ga0075434_100034293 Ga0075434_1000342935 296
295 3300006914 Ga0075436_100021750 Ga0075436_1000217504 296
296 3300006914 Ga0075436_100313813 Ga0075436_1003138132 296
297 3300006931 Ga0097620_100118685 Ga0097620_1001186854 296
298 3300007265 Ga0099794_10121554 Ga0099794_101215542 296
299 3300009094 Ga0111539_10000922 Ga0111539_1000092228 296
300 3300009098 Ga0105245_10020740 Ga0105245_100207405 296
301 3300009147 Ga0114129_10000529 Ga0114129_1000052925 296
302 3300009147 Ga0114129_10155903 Ga0114129_101559032 296
303 3300009176 Ga0105242_10102816 Ga0105242_101028162 296
304 3300025910 Ga0207684_10090792 Ga0207684_100907923 296
305 3300025922 Ga0207646_10103243 Ga0207646_101032432 296
306 3300025922 Ga0207646_10175091 Ga0207646_101750913 296
307 3300025934 Ga0207686_10205351 Ga0207686_102053512 296
308 3300025942 Ga0207689_10097645 Ga0207689_100976453 296
309 3300026075 Ga0207708_10250272 Ga0207708_102502722 296
310 3300026089 Ga0207648_10084039 Ga0207648_100840392 296
311 3300027671 Ga0209588_1002985 Ga0209588_10029854 296
312 3300027907 Ga0207428_10001697 Ga0207428_1000169710 296
313 3300035090 Ga0373949_0050146 Ga0373949_0050146_11_931 296
314 3300035113 Ga0373936_0017340 Ga0373936_0017340_1849_2739 296
315 3300035114 Ga0373939_0044336 Ga0373939_0044336_138_1058 296
316 3300035115 Ga0373941_0025017 Ga0373941_0025017_693_1613 296
317 3300035241 Ga0373961_0002345 Ga0373961_0002345_495_1415 296
318 3300035241 Ga0373961_0048697 Ga0373961_0048697_269_1159 296
319 3300035692 Ga0373935_0001211 Ga0373935_0001211_12877_13767 296
320 3300042001 Ga0439441_004980 Ga0439441_004980_825_1715 296
321 3300045051 Ga0451576_0014576 Ga0451576_0014576_2273_3163 296
322 3300048929 Ga0496126_0030413 Ga0496126_0030413_2867_3769 296
323 3300049588 Ga0501072_0109602 Ga0501072_0109602_1165_2064 296
324 3300049592 Ga0501076_0095972 Ga0501076_0095972_1352_2251 296
325 3300049743 Ga0501081_0058617 Ga0501081_0058617_1494_2393 296
326 3300050492 nmdc:mga0yw44_127114_c1 nmdc:mga0yw44_127114_c1_50_967 296
327 3300050492 nmdc:mga0yw44_220181_c1 nmdc:mga0yw44_220181_c1_321_1238 296
328 3300050507 nmdc:mga05p37_515_c1 nmdc:mga05p37_515_c1_27277_28200 296
329 3300050509 nmdc:mga0qj67_20214_c1 nmdc:mga0qj67_20214_c1_3549_4472 296
330 3300050510 nmdc:mga06r32_128552_c1 nmdc:mga06r32_128552_c1_1262_2188 296
331 3300050510 nmdc:mga06r32_28_c1 nmdc:mga06r32_28_c1_34628_35551 296
332 3300050511 nmdc:mga08y16_124_c2 nmdc:mga08y16_124_c2_14126_15049 296
333 3300050511 nmdc:mga08y16_247363_c1 nmdc:mga08y16_247363_c1_839_1759 296
334 3300050512 nmdc:mga0n895_21138_c1 nmdc:mga0n895_21138_c1_1238_2158 296
335 3300050514 nmdc:mga08x19_162563_c1 nmdc:mga08x19_162563_c1_116_1042 296
336 3300050514 nmdc:mga08x19_21892_c1 nmdc:mga08x19_21892_c1_215_1105 296
337 3300050515 nmdc:mga0a205_5781_c1 nmdc:mga0a205_5781_c1_9127_10047 296
338 3300054114 Ga0501084_0201905 Ga0501084_0201905_616_1515 296
339 3300060353 Ga0501082_0083172 Ga0501082_0083172_1497_2396 296
340 3300006846 Ga0075430_100333542 Ga0075430_1003335421 297
341 3300009094 Ga0111539_10705235 Ga0111539_107052351 297
342 3300009098 Ga0105245_10398916 Ga0105245_103989162 298
343 3300013308 Ga0157375_10029384 Ga0157375_100293841 298
344 3300014325 Ga0163163_10108350 Ga0163163_101083502 298
345 3300046499 Ga0495594_0118334 Ga0495594_0118334_512_1408 298
346 3300027907 Ga0207428_10231621 Ga0207428_102316211 299
347 3300005334 Ga0068869_100079341 Ga0068869_1000793412 300
348 3300005548 Ga0070665_100331391 Ga0070665_1003313911 300
349 3300025935 Ga0207709_10327821 Ga0207709_103278211 300
350 3300025942 Ga0207689_10055657 Ga0207689_100556573 300
351 3300039437 Ga0436365_1780730 Ga0436365_1780730_4937_5842 300
352 3300053139 Ga0500568_0041495 Ga0500568_0041495_144_1046 300
353 3300005293 Ga0065715_10212173 Ga0065715_102121732 301
354 3300005333 Ga0070677_10014935 Ga0070677_100149354 301
355 3300005335 Ga0070666_10211291 Ga0070666_102112912 301
356 3300005340 Ga0070689_100048233 Ga0070689_1000482333 301
357 3300005354 Ga0070675_100247709 Ga0070675_1002477092 301
358 3300005441 Ga0070700_100447075 Ga0070700_1004470751 301
359 3300005444 Ga0070694_100086132 Ga0070694_1000861322 301
360 3300005456 Ga0070678_100024818 Ga0070678_1000248182 301
361 3300005466 Ga0070685_10078612 Ga0070685_100786121 301
362 3300005543 Ga0070672_100412179 Ga0070672_1004121791 301
363 3300005544 Ga0070686_100079763 Ga0070686_1000797634 301
364 3300005546 Ga0070696_100016271 Ga0070696_1000162715 301
365 3300005549 Ga0070704_100526211 Ga0070704_1005262111 301
366 3300005617 Ga0068859_100054629 Ga0068859_1000546294 301
367 3300005617 Ga0068859_100230549 Ga0068859_1002305493 301
368 3300005618 Ga0068864_100067040 Ga0068864_1000670402 301
369 3300005718 Ga0068866_10080481 Ga0068866_100804812 301
370 3300005719 Ga0068861_100167939 Ga0068861_1001679392 301
371 3300005843 Ga0068860_100469487 Ga0068860_1004694871 301
372 3300005844 Ga0068862_100014790 Ga0068862_10001479012 301
373 3300005937 Ga0081455_10332278 Ga0081455_103322781 301
374 3300006038 Ga0075365_10005019 Ga0075365_100050192 301
375 3300006048 Ga0075363_100000477 Ga0075363_10000047716 301
376 3300006048 Ga0075363_100002454 Ga0075363_10000245411 301
377 3300006051 Ga0075364_10027306 Ga0075364_100273063 301
378 3300006177 Ga0075362_10007144 Ga0075362_100071445 301
379 3300006178 Ga0075367_10000548 Ga0075367_100005485 301
380 3300006195 Ga0075366_10059375 Ga0075366_100593754 301
381 3300006844 Ga0075428_100088446 Ga0075428_1000884463 301
382 3300006846 Ga0075430_100000034 Ga0075430_1000000342 301
383 3300006846 Ga0075430_100171430 Ga0075430_1001714302 301
384 3300006847 Ga0075431_100022483 Ga0075431_1000224832 301
385 3300006847 Ga0075431_100064507 Ga0075431_1000645073 301
386 3300006847 Ga0075431_100080205 Ga0075431_1000802052 301
387 3300006847 Ga0075431_100542638 Ga0075431_1005426381 301
388 3300006852 Ga0075433_10034170 Ga0075433_100341705 301
389 3300006871 Ga0075434_100008961 Ga0075434_1000089614 301
390 3300006931 Ga0097620_100054634 Ga0097620_1000546344 301
391 3300006931 Ga0097620_100230537 Ga0097620_1002305373 301
392 3300007076 Ga0075435_100031047 Ga0075435_1000310475 301
393 3300009094 Ga0111539_10078467 Ga0111539_100784674 301
394 3300009101 Ga0105247_10040026 Ga0105247_100400262 301
395 3300009147 Ga0114129_10010980 Ga0114129_100109809 301
396 3300009147 Ga0114129_10168299 Ga0114129_101682993 301
397 3300009147 Ga0114129_10249539 Ga0114129_102495392 301
398 3300009147 Ga0114129_10380917 Ga0114129_103809172 301
399 3300009177 Ga0105248_10580367 Ga0105248_105803671 301
400 3300013306 Ga0163162_10225411 Ga0163162_102254113 301
401 3300013308 Ga0157375_10200047 Ga0157375_102000472 301
402 3300014325 Ga0163163_10248029 Ga0163163_102480292 301
403 3300014969 Ga0157376_10171164 Ga0157376_101711642 301
404 3300025315 Ga0207697_10033604 Ga0207697_100336043 301
405 3300025893 Ga0207682_10001624 Ga0207682_100016243 301
406 3300025903 Ga0207680_10063128 Ga0207680_100631282 301
407 3300025904 Ga0207647_10062989 Ga0207647_100629892 301
408 3300025907 Ga0207645_10014878 Ga0207645_100148783 301
409 3300025908 Ga0207643_10119725 Ga0207643_101197252 301
410 3300025917 Ga0207660_10079142 Ga0207660_100791422 301
411 3300025918 Ga0207662_10012539 Ga0207662_100125394 301
412 3300025918 Ga0207662_10253372 Ga0207662_102533722 301
413 3300025926 Ga0207659_10186338 Ga0207659_101863382 301
414 3300025933 Ga0207706_10067080 Ga0207706_100670801 301
415 3300025936 Ga0207670_10074967 Ga0207670_100749673 301
416 3300025937 Ga0207669_10015709 Ga0207669_100157095 301
417 3300025940 Ga0207691_10012117 Ga0207691_100121174 301
418 3300025960 Ga0207651_10100199 Ga0207651_101001993 301
419 3300025981 Ga0207640_10342192 Ga0207640_103421921 301
420 3300026075 Ga0207708_10332187 Ga0207708_103321872 301
421 3300026089 Ga0207648_10043528 Ga0207648_100435282 301
422 3300026118 Ga0207675_100067570 Ga0207675_1000675702 301
423 3300026121 Ga0207683_10016495 Ga0207683_100164953 301
424 3300027907 Ga0207428_10198741 Ga0207428_101987411 301
425 3300027907 Ga0207428_10415481 Ga0207428_104154811 301
426 3300028380 Ga0268265_10098859 Ga0268265_100988592 301
427 3300028380 Ga0268265_10244732 Ga0268265_102447322 301
428 3300031456 Ga0307513_10058214 Ga0307513_100582144 301
429 3300035171 Ga0373946_0062882 Ga0373946_0062882_521_1453 301
430 3300035691 Ga0373931_0029962 Ga0373931_0029962_1363_2301 301
431 3300035692 Ga0373935_0145303 Ga0373935_0145303_266_1198 301
432 3300045051 Ga0451576_0000946 Ga0451576_0000946_18778_19701 301
433 3300046615 Ga0495656_0103313 Ga0495656_0103313_248_1207 301
434 3300047317 Ga0495604_0178545 Ga0495604_0178545_23_964 301
435 3300047318 Ga0495636_0068495 Ga0495636_0068495_107_1066 301
436 3300048090 Ga0495615_0003747 Ga0495615_0003747_1413_2372 301
437 3300050490 nmdc:mga03n38_10735_c1 nmdc:mga03n38_10735_c1_2247_3182 301
438 3300050492 nmdc:mga0yw44_30085_c1 nmdc:mga0yw44_30085_c1_1643_2578 301
439 3300050494 nmdc:mga06z11_1071_c1 nmdc:mga06z11_1071_c1_1681_2616 301
440 3300050495 nmdc:mga04h51_19226_c1 nmdc:mga04h51_19226_c1_918_1853 301
441 3300050495 nmdc:mga04h51_71440_c1 nmdc:mga04h51_71440_c1_246_1154 301
442 3300050507 nmdc:mga05p37_286814_c1 nmdc:mga05p37_286814_c1_892_1818 301
443 3300050507 nmdc:mga05p37_81437_c1 nmdc:mga05p37_81437_c1_2214_3143 301
444 3300050507 nmdc:mga05p37_98434_c1 nmdc:mga05p37_98434_c1_725_1660 301
445 3300050508 nmdc:mga09592_217980_c1 nmdc:mga09592_217980_c1_200_1159 301
446 3300050508 nmdc:mga09592_59291_c1 nmdc:mga09592_59291_c1_621_1550 301
447 3300050509 nmdc:mga0qj67_119004_c1 nmdc:mga0qj67_119004_c1_499_1428 301
448 3300050509 nmdc:mga0qj67_1580_c1 nmdc:mga0qj67_1580_c1_6671_7597 301
449 3300050510 nmdc:mga06r32_2324_c1 nmdc:mga06r32_2324_c1_7223_8149 301
450 3300050510 nmdc:mga06r32_7255_c1 nmdc:mga06r32_7255_c1_3405_4334 301
451 3300050511 nmdc:mga08y16_263524_c1 nmdc:mga08y16_263524_c1_424_1353 301
452 3300050511 nmdc:mga08y16_74284_c1 nmdc:mga08y16_74284_c1_31_960 301
453 3300050514 nmdc:mga08x19_30143_c1 nmdc:mga08x19_30143_c1_1164_2111 301
454 3300050515 nmdc:mga0a205_58820_c1 nmdc:mga0a205_58820_c1_599_1546 301
455 3300053079 Ga0500610_0058965 Ga0500610_0058965_200_1129 301
456 3300053096 Ga0500641_0005144 Ga0500641_0005144_2247_3176 301
457 3300053134 Ga0500658_0059027 Ga0500658_0059027_490_1419 301
458 3300006844 Ga0075428_100003836 Ga0075428_1000038362 302
459 3300028577 Ga0265318_10006928 Ga0265318_100069285 302
460 3300031240 Ga0265320_10029129 Ga0265320_100291292 302
461 3300031247 Ga0265340_10002924 Ga0265340_100029242 302
462 3300031595 Ga0265313_10008906 Ga0265313_100089065 302
463 3300039438 Ga0436360_0779635 Ga0436360_0779635_3469_4377 302
464 3300039447 Ga0436361_0471899 Ga0436361_0471899_375_1283 302
465 3300003911 JGI25405J52794_10021044 JGI25405J52794_100210442 303
466 3300005937 Ga0081455_10003994 Ga0081455_1000399410 303

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

108

318

0.92

PF23678

27

64

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.9634 68 302
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.9437 68 302
7jiz-assembly1.cif.gz_B dienelactone hydrolase family protein scdlh from solimonas sp. k1w22b-7 0.8569 75 303
1ggv-assembly1.cif.gz_A crystal structure of the c123s mutant of dienelactone hydrolase (dlh) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf) 0.8559 80 301
8g3d-assembly1.cif.gz_3D 48-nm doublet microtubule from tetrahymena thermophila strain k40r 0.8527 80 303
ID Description Score Start End Superfamily
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9672 68 302 3.40.50.1820
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.947 68 302 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8863 78 298 3.40.50.1820
af_Q54MZ9_1_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8615 76 302 3.40.50.1820
1zi9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8368 80 303 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A6L8B8N8-F1-model_v4 Dienelactone hydrolase family protein 0.9957 214 303 GO:0016787
AF-A0A378BQ54-F1-model_v4 Putative enzyme 0.9956 212 303 GO:0016787
AF-A0A3N5H463-F1-model_v4 Dienelactone hydrolase family protein 0.9941 197 303 GO:0016787
AF-A0A352MS01-F1-model_v4 deleted 0.9931 171 302
AF-A0A0R5RPW6-F1-model_v4 Dienelactone hydrolase family 0.9929 199 295 GO:0016787

Feature Viewer

pLDDT pTM Quality
88.44 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map