F449574

General Info

Members Datasets Scaffolds Average Seq Length
465 290 462 284

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_73010_c1|nmdc:mga0rr50_73010_c1_602_1540
Length 312
Sequence LLALCSGLGEGRKDTKNLHRILSFLLRAAAILPLRALHAVGFVLGWAMYGMSPTYRRHLRDNLGQAGLDAPATRRAAIAAAGQMIAELPALWFRPRAKSLALVKGAEGVEAVLAARAAGKALLLLTPHHGCFEISAHYAAQIFPITVLYRAPKIAWLEPLMREGRAGDNLRLAPADVSGVRELFRALERGEAAGFLPDQVPGLGEGEWTEFFGKPAYTMTLAAKLAERPNIATFLAYAQRLPKGEGYRIVVRRFPAKDSSETAARRLNRALEDLVRECPEQYLWGYNRYKTPAGAEPPPGAGGNIPPAPPVA

Samples

Sample ID Description Type Environment
1 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
2 2643221660 Methylibium sp. Root1272 Isolate Unclassified
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
102 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
103 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
107 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
108 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
165 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
168 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
171 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
172 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
178 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
179 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
182 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
185 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
186 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
187 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
188 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
189 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
190 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
191 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
192 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
193 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
200 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
203 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
204 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
216 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
217 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
218 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
219 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
220 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
231 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
250 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
251 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
252 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
261 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
262 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
263 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
264 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
265 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
266 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
269 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
274 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
275 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
276 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
277 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
280 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
281 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
282 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
283 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
284 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
285 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
290 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.62
Nodule 0
Rhizoplane 0.22
Rhizosphere 78.92
Stem 0
Stem Tuber 0
Unclassified 6.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24033J26618_1013010 3300002155 Unclassified 1007
2 JGI25156J39149_1002577 3300002705 Bacteria 6413
3 JGI25154J39366_1000518 3300002738 Bacteria 19464
4 JGI25157J39369_1000743 3300002741 Bacteria 17282
5 rootH1_10052059 3300003316 Bacteria 7994
6 rootH1_10050641 3300003323 Bacteria 5530
7 rootH1_10050678 3300003323 Bacteria 13701
8 Ga0055539_1000140 3300003752 Bacteria 74869
9 Ga0055539_1001323 3300003752 Bacteria 4803
10 Ga0055533_1000045 3300003756 Bacteria 223637
11 Ga0055535_1002371 3300003761 Bacteria 6749
12 Ga0055529_1000148 3300003763 Bacteria 100809
13 Ga0055529_1010900 3300003763 Bacteria 1176
14 Ga0065715_10104788 3300005293 Bacteria 2931
15 Ga0070658_10054707 3300005327 Bacteria 3240
16 Ga0070658_10056054 3300005327 Bacteria 3202
17 Ga0070676_10010008 3300005328 Bacteria 5132
18 Ga0070676_10116342 3300005328 Bacteria 1672
19 Ga0070690_100017574 3300005330 Bacteria 4304
20 Ga0070690_100042630 3300005330 Bacteria 2875
21 Ga0070690_100244814 3300005330 Bacteria 1266
22 Ga0070670_100062592 3300005331 Bacteria 3194
23 Ga0070670_100293284 3300005331 Bacteria 1422
24 Ga0070670_100340841 3300005331 Bacteria 1316
25 Ga0068869_100013610 3300005334 Bacteria 5415
26 Ga0068869_100078771 3300005334 Bacteria 2455
27 Ga0070680_100038414 3300005336 Bacteria 3872
28 Ga0070680_100170046 3300005336 Bacteria 1833
29 Ga0070680_100384041 3300005336 Bacteria 1196
30 Ga0068868_100051935 3300005338 Bacteria 3227
31 Ga0070660_100138703 3300005339 Bacteria 1949
32 Ga0070660_100154391 3300005339 Bacteria 1847
33 Ga0070687_100046936 3300005343 Bacteria 2213
34 Ga0070687_100156970 3300005343 Bacteria 1341
35 Ga0070661_100295412 3300005344 Unclassified 1260
36 Ga0070692_10003525 3300005345 Bacteria 6362
37 Ga0070692_10165049 3300005345 Bacteria 1272
38 Ga0070668_100087502 3300005347 Bacteria 2451
39 Ga0070669_100003316 3300005353 Bacteria 11568
40 Ga0070675_100246700 3300005354 Bacteria 1561
41 Ga0070671_100189176 3300005355 Bacteria 1745
42 Ga0070671_100201286 3300005355 Bacteria 1688
43 Ga0070674_100138998 3300005356 Bacteria 1821
44 Ga0070673_100008834 3300005364 Bacteria 6728
45 Ga0070673_100011910 3300005364 Bacteria 5957
46 Ga0070673_100192493 3300005364 Bacteria 1752
47 Ga0070659_100093718 3300005366 Bacteria 2410
48 Ga0070667_100207387 3300005367 Bacteria 1741
49 Ga0070667_100633377 3300005367 Bacteria 987
50 Ga0070710_10051880 3300005437 Bacteria 2305
51 Ga0070705_100033683 3300005440 Bacteria 2857
52 Ga0070700_100001929 3300005441 Bacteria 10495
53 Ga0070694_100007385 3300005444 Bacteria 6701
54 Ga0070694_100075703 3300005444 Bacteria 2328
55 Ga0070708_100471397 3300005445 Bacteria 1184
56 Ga0070663_100053189 3300005455 Bacteria 2890
57 Ga0070663_100230235 3300005455 Bacteria 1459
58 Ga0070678_100318739 3300005456 Bacteria 1327
59 Ga0070662_100144968 3300005457 Bacteria 1844
60 Ga0070662_100222787 3300005457 Bacteria 1506
61 Ga0070681_10000135 3300005458 Bacteria 56156
62 Ga0068867_100000606 3300005459 Bacteria 23757
63 Ga0068867_100021775 3300005459 Bacteria 4576
64 Ga0068867_100023367 3300005459 Bacteria 4426
65 Ga0068867_100155788 3300005459 Bacteria 1798
66 Ga0068867_100487160 3300005459 Bacteria 1058
67 Ga0068867_100488044 3300005459 Bacteria 1057
68 Ga0070706_100003188 3300005467 Bacteria 16188
69 Ga0070707_100037315 3300005468 Bacteria 4637
70 Ga0070707_100579144 3300005468 Bacteria 1085
71 Ga0070698_100036226 3300005471 Bacteria 5099
72 Ga0070699_100214835 3300005518 Bacteria 1713
73 Ga0070699_100308891 3300005518 Bacteria 1419
74 Ga0070679_100046897 3300005530 Bacteria 4308
75 Ga0070697_100017635 3300005536 Bacteria 5623
76 Ga0068853_100249322 3300005539 Bacteria 1629
77 Ga0070686_100265549 3300005544 Bacteria 1260
78 Ga0070686_100297439 3300005544 Bacteria 1196
79 Ga0070695_100003127 3300005545 Bacteria 9643
80 Ga0070696_100001158 3300005546 Bacteria 17126
81 Ga0070696_100043993 3300005546 Bacteria 3091
82 Ga0070665_100035834 3300005548 Bacteria 4991
83 Ga0070704_100009462 3300005549 Bacteria 5888
84 Ga0070704_100096596 3300005549 Bacteria 2215
85 Ga0068855_100012349 3300005563 Bacteria 10318
86 Ga0068855_100161223 3300005563 Bacteria 2545
87 Ga0070664_100189498 3300005564 Bacteria 1832
88 Ga0070664_100382923 3300005564 Bacteria 1284
89 Ga0068857_100003374 3300005577 Bacteria 13292
90 Ga0068857_100253283 3300005577 Bacteria 1614
91 Ga0068854_100008220 3300005578 Bacteria 6697
92 Ga0068854_100222791 3300005578 Bacteria 1493
93 Ga0068856_100002437 3300005614 Bacteria 19136
94 Ga0068852_100113529 3300005616 Bacteria 2467
95 Ga0068852_100279551 3300005616 Bacteria 1609
96 Ga0068859_100024148 3300005617 Bacteria 6100
97 Ga0068859_100067147 3300005617 Bacteria 3620
98 Ga0068864_100007242 3300005618 Bacteria 9120
99 Ga0068861_100000492 3300005719 Bacteria 22985
100 Ga0068861_100008163 3300005719 Bacteria 7204
101 Ga0068870_10024562 3300005840 Bacteria 2983
102 Ga0068863_100027398 3300005841 Bacteria 5435
103 Ga0068862_100002979 3300005844 Bacteria 14786
104 Ga0075365_10173538 3300006038 Bacteria 1505
105 Ga0075368_10001585 3300006042 Bacteria 7303
106 Ga0075368_10017530 3300006042 Bacteria 2681
107 Ga0075364_10187728 3300006051 Bacteria 1399
108 Ga0070716_100066925 3300006173 Bacteria 2097
109 Ga0075362_10004323 3300006177 Bacteria 5085
110 Ga0075362_10032216 3300006177 Bacteria 2273
111 Ga0075367_10009705 3300006178 Bacteria 5043
112 Ga0075367_10016595 3300006178 Bacteria 4022
113 Ga0075367_10019903 3300006178 Bacteria 3729
114 Ga0075369_10022846 3300006186 Bacteria 2582
115 Ga0075366_10046772 3300006195 Bacteria 2564
116 Ga0075366_10055015 3300006195 Bacteria 2364
117 Ga0075366_10096726 3300006195 Bacteria 1770
118 Ga0075366_10121013 3300006195 Bacteria 1577
119 Ga0075366_10203571 3300006195 Bacteria 1204
120 Ga0097621_100029903 3300006237 Bacteria 4306
121 Ga0097621_100188659 3300006237 Bacteria 1784
122 Ga0097621_100213016 3300006237 Bacteria 1681
123 Ga0075370_10002430 3300006353 Bacteria 8635
124 Ga0075370_10011130 3300006353 Bacteria 4719
125 Ga0075370_10011503 3300006353 Bacteria 4653
126 Ga0075370_10017563 3300006353 Bacteria 3867
127 Ga0075370_10018414 3300006353 Bacteria 3790
128 Ga0068871_100001506 3300006358 Bacteria 15616
129 Ga0075428_100051859 3300006844 Bacteria 4499
130 Ga0075431_100040353 3300006847 Bacteria 4810
131 Ga0075431_100132842 3300006847 Bacteria 2567
132 Ga0075431_100263023 3300006847 Bacteria 1750
133 Ga0075433_10333671 3300006852 Bacteria 1341
134 Ga0075434_100000002 3300006871 Bacteria 135661
135 Ga0068865_100007318 3300006881 Bacteria 6783
136 Ga0075436_100034169 3300006914 Bacteria 3506
137 Ga0097620_100024148 3300006931 Bacteria 6100
138 Ga0097620_100067148 3300006931 Bacteria 3620
139 Ga0075435_100004018 3300007076 Bacteria 10052
140 Ga0105240_10047132 3300009093 Bacteria 5456
141 Ga0105240_10202928 3300009093 Bacteria 2322
142 Ga0111539_10184208 3300009094 Bacteria 2438
143 Ga0105245_10106875 3300009098 Bacteria 2597
144 Ga0105245_10205234 3300009098 Bacteria 1894
145 Ga0105245_10212568 3300009098 Bacteria 1862
146 Ga0105247_10080685 3300009101 Bacteria 2050
147 Ga0114129_10156352 3300009147 Bacteria 3117
148 Ga0114129_10902887 3300009147 Bacteria 1119
149 Ga0105241_10064719 3300009174 Bacteria 2824
150 Ga0105242_10028991 3300009176 Bacteria 4411
151 Ga0105242_10342569 3300009176 Bacteria 1378
152 Ga0105237_10157941 3300009545 Bacteria 2265
153 Ga0105239_10357438 3300010375 Bacteria 1649
154 Ga0157369_10054876 3300013105 Bacteria 4302
155 Ga0163162_10137495 3300013306 Bacteria 2555
156 Ga0157375_10046040 3300013308 Bacteria 4250
157 Ga0157375_10081044 3300013308 Bacteria 3285
158 Ga0157380_10230891 3300014326 Unclassified 1662
159 Ga0157377_10277655 3300014745 Bacteria 1097
160 Ga0157379_10152584 3300014968 Bacteria 2084
161 Ga0157379_10204103 3300014968 Bacteria 1788
162 Ga0182007_10032743 3300015262 Bacteria 1764
163 Ga0213872_10000982 3300021361 Bacteria 19943
164 Ga0209674_100073 3300025226 Bacteria 223689
165 Ga0209563_100061 3300025230 Bacteria 274295
166 Ga0209258_100998 3300025242 Bacteria 13040
167 Ga0209258_101471 3300025242 Bacteria 8165
168 Ga0209646_1000249 3300025246 Bacteria 54511
169 Ga0209026_1000011 3300025250 Bacteria 507291
170 Ga0209677_100120 3300025253 Bacteria 80505
171 Ga0209677_100633 3300025253 Bacteria 18825
172 Ga0209677_103461 3300025253 Bacteria 5110
173 Ga0209148_1008260 3300025254 Bacteria 2101
174 Ga0209759_1000034 3300025256 Bacteria 271209
175 Ga0209759_1000900 3300025256 Bacteria 22212
176 Ga0209759_1003968 3300025256 Bacteria 5680
177 Ga0209455_1000053 3300025272 Bacteria 365949
178 Ga0209455_1000596 3300025272 Bacteria 23241
179 Ga0207642_10082471 3300025899 Bacteria 1565
180 Ga0207685_10061579 3300025905 Bacteria 1488
181 Ga0207645_10014430 3300025907 Bacteria 5287
182 Ga0207643_10085476 3300025908 Unclassified 1832
183 Ga0207705_10028930 3300025909 Bacteria 3951
184 Ga0207705_10069863 3300025909 Bacteria 2544
185 Ga0207654_10040895 3300025911 Bacteria 2615
186 Ga0207707_10003001 3300025912 Bacteria 15006
187 Ga0207695_10005833 3300025913 Bacteria 16193
188 Ga0207671_10044286 3300025914 Bacteria 3291
189 Ga0207662_10159148 3300025918 Bacteria 1442
190 Ga0207657_10077316 3300025919 Bacteria 2805
191 Ga0207657_10142561 3300025919 Bacteria 1957
192 Ga0207649_10266023 3300025920 Unclassified 1241
193 Ga0207646_10057941 3300025922 Bacteria 3461
194 Ga0207681_10003667 3300025923 Bacteria 9545
195 Ga0207694_10008860 3300025924 Bacteria 7590
196 Ga0207650_10050852 3300025925 Bacteria 3066
197 Ga0207650_10225743 3300025925 Bacteria 1509
198 Ga0207659_10043579 3300025926 Bacteria 3152
199 Ga0207687_10060483 3300025927 Bacteria 2672
200 Ga0207687_10062324 3300025927 Bacteria 2637
201 Ga0207644_10189111 3300025931 Bacteria 1618
202 Ga0207690_10084916 3300025932 Bacteria 2220
203 Ga0207706_10004957 3300025933 Bacteria 12440
204 Ga0207706_10250996 3300025933 Bacteria 1545
205 Ga0207686_10210055 3300025934 Bacteria 1399
206 Ga0207669_10013398 3300025937 Bacteria 4069
207 Ga0207704_10004352 3300025938 Bacteria 6474
208 Ga0207704_10157444 3300025938 Bacteria 1612
209 Ga0207665_10064893 3300025939 Bacteria 2482
210 Ga0207691_10112148 3300025940 Bacteria 2424
211 Ga0207689_10011590 3300025942 Bacteria 7552
212 Ga0207689_10017327 3300025942 Bacteria 6097
213 Ga0207689_10017773 3300025942 Bacteria 6009
214 Ga0207679_10216924 3300025945 Bacteria 1608
215 Ga0207679_10336485 3300025945 Bacteria 1312
216 Ga0207667_10004262 3300025949 Bacteria 17553
217 Ga0207667_10206182 3300025949 Bacteria 2016
218 Ga0207667_10374252 3300025949 Bacteria 1451
219 Ga0207651_10114626 3300025960 Bacteria 2030
220 Ga0207651_10385625 3300025960 Bacteria 1188
221 Ga0207712_10001907 3300025961 Bacteria 13705
222 Ga0207668_10007277 3300025972 Bacteria 6571
223 Ga0207640_10004000 3300025981 Bacteria 7964
224 Ga0207640_10256509 3300025981 Bacteria 1360
225 Ga0207658_10178393 3300025986 Bacteria 1756
226 Ga0207639_10716844 3300026041 Bacteria 929
227 Ga0207678_10006113 3300026067 Bacteria 10709
228 Ga0207678_10258950 3300026067 Bacteria 1491
229 Ga0207708_10010615 3300026075 Bacteria 6839
230 Ga0207702_10006491 3300026078 Bacteria 10081
231 Ga0207641_10137768 3300026088 Bacteria 2198
232 Ga0207648_10000362 3300026089 Bacteria 50094
233 Ga0207648_10033577 3300026089 Bacteria 4525
234 Ga0207648_10171447 3300026089 Bacteria 1918
235 Ga0207648_10203747 3300026089 Bacteria 1755
236 Ga0207648_10512882 3300026089 Bacteria 1098
237 Ga0207674_10087457 3300026116 Bacteria 3110
238 Ga0207674_10225642 3300026116 Bacteria 1821
239 Ga0207675_100012092 3300026118 Bacteria 8064
240 Ga0207675_100037995 3300026118 Bacteria 4493
241 Ga0207683_10278963 3300026121 Bacteria 1527
242 Ga0207698_10195544 3300026142 Bacteria 1806
243 Ga0209968_1006989 3300027526 Bacteria 1703
244 Ga0209999_1008228 3300027543 Bacteria 1878
245 Ga0209971_1012837 3300027682 Bacteria 1985
246 Ga0209966_1000138 3300027695 Bacteria 30805
247 Ga0209966_1000929 3300027695 Bacteria 5525
248 Ga0209813_10006913 3300027866 Bacteria 2815
249 Ga0207428_10037946 3300027907 Bacteria 3919
250 Ga0268266_10013661 3300028379 Bacteria 6993
251 Ga0268265_10001605 3300028380 Bacteria 18666
252 Ga0265336_10000556 3300028666 Bacteria 21237
253 Ga0307517_10111454 3300028786 Bacteria 2079
254 Ga0307517_10132524 3300028786 Bacteria 1787
255 Ga0307515_10014894 3300028794 Bacteria 14373
256 Ga0307515_10018130 3300028794 Bacteria 12769
257 Ga0307515_10183789 3300028794 Bacteria 2029
258 Ga0307515_10184468 3300028794 Bacteria 2022
259 Ga0265324_10012293 3300029957 Bacteria 3232
260 Ga0307512_10104116 3300030522 Bacteria 1905
261 Ga0265332_10006016 3300031238 Bacteria 5547
262 Ga0265328_10034578 3300031239 Bacteria 1871
263 Ga0265320_10036589 3300031240 Bacteria 2479
264 Ga0265331_10005817 3300031250 Bacteria 7388
265 Ga0265331_10057453 3300031250 Bacteria 1845
266 Ga0265327_10000136 3300031251 Bacteria 160868
267 Ga0307513_10057211 3300031456 Bacteria 4156
268 Ga0307513_10237409 3300031456 Bacteria 1631
269 Ga0307509_10001647 3300031507 Bacteria 37422
270 Ga0307509_10029240 3300031507 Bacteria 6119
271 Ga0307509_10052681 3300031507 Bacteria 4343
272 Ga0307408_100047939 3300031548 Bacteria 3062
273 Ga0307508_10045147 3300031616 Bacteria 3938
274 Ga0316575_10031265 3300031665 Bacteria 2083
275 Ga0316575_10032811 3300031665 Bacteria 2035
276 Ga0316579_10000229 3300031691 Bacteria 16998
277 Ga0265314_10012555 3300031711 Bacteria 6902
278 Ga0316578_10003363 3300031728 Bacteria 7300
279 Ga0307516_10000155 3300031730 Bacteria 85605
280 Ga0307416_100042374 3300032002 Bacteria 3553
281 Ga0307416_100289954 3300032002 Bacteria 1620
282 Ga0307416_100838780 3300032002 Bacteria 1017
283 Ga0316583_10001141 3300032133 Bacteria 8669
284 Ga0307510_10059773 3300033180 Bacteria 3931
285 Ga0373938_0052679 3300034957 Bacteria 933
286 Ga0373934_0005550 3300035086 Bacteria 4671
287 Ga0373934_0031327 3300035086 Bacteria 2082
288 Ga0373956_0150755 3300035119 Bacteria 1094
289 Ga0373957_0005373 3300035120 Bacteria 3967
290 Ga0373960_0009027 3300035121 Bacteria 2405
291 Ga0373961_0006198 3300035241 Bacteria 2874
292 Ga0316574_0016443 3300035398 Bacteria 4312
293 Ga0373924_0024900 3300035410 Bacteria 2362
294 Ga0373931_0001491 3300035691 Bacteria 10067
295 Ga0373931_0130954 3300035691 Bacteria 1444
296 Ga0373927_0185479 3300035695 Bacteria 1365
297 Ga0373933_0002244 3300035724 Bacteria 11024
298 Ga0373937_0017644 3300036401 Bacteria 6366
299 Ga0373937_0499694 3300036401 Bacteria 1156
300 Ga0436361_0046388 3300039447 Bacteria 28554
301 Ga0451807_1808059 3300041486 Bacteria 1518
302 Ga0439444_0008325 3300042437 Bacteria 1614
303 Ga0451577_0010640 3300042876 Bacteria 8766
304 Ga0451577_0015014 3300042876 Bacteria 7206
305 Ga0451577_0022141 3300042876 Bacteria 5804
306 Ga0451577_0208854 3300042876 Bacteria 1763
307 Ga0451577_0253509 3300042876 Bacteria 1593
308 Ga0451577_0331978 3300042876 Bacteria 1379
309 Ga0466969_0020667 3300044656 Bacteria 3407
310 Ga0453683_0136090 3300044673 Bacteria 1549
311 Ga0453683_0176530 3300044673 Bacteria 1354
312 Ga0466965_0018614 3300044683 Bacteria 3331
313 Ga0466966_0000454 3300044684 Bacteria 26412
314 Ga0466961_0018142 3300044693 Bacteria 4525
315 Ga0466963_0085019 3300044694 Bacteria 2147
316 Ga0466964_0029421 3300044706 Bacteria 2168
317 Ga0453684_0000826 3300044712 Bacteria 104663
318 Ga0453684_0069662 3300044712 Bacteria 4459
319 Ga0453684_0142325 3300044712 Bacteria 2862
320 Ga0453684_0215836 3300044712 Bacteria 2226
321 Ga0466957_0004587 3300044842 Bacteria 7720
322 Ga0466957_0121140 3300044842 Bacteria 1668
323 Ga0466959_0025615 3300045049 Bacteria 4373
324 Ga0451576_0000140 3300045051 Bacteria 183279
325 Ga0451576_0016220 3300045051 Bacteria 8228
326 Ga0451576_0018773 3300045051 Bacteria 7562
327 Ga0451576_0048830 3300045051 Bacteria 4443
328 Ga0451576_0078095 3300045051 Bacteria 3445
329 Ga0451576_0148204 3300045051 Bacteria 2447
330 Ga0466958_0148593 3300045836 Bacteria 1477
331 Ga0495592_0004208 3300046454 Bacteria 10512
332 Ga0495608_0077353 3300046511 Bacteria 2166
333 Ga0495610_0040271 3300046512 Bacteria 2357
334 Ga0495620_0080500 3300046515 Bacteria 1318
335 Ga0495632_0039269 3300046519 Bacteria 2390
336 Ga0495643_0127653 3300046522 Bacteria 1279
337 Ga0495597_0003790 3300046542 Bacteria 8604
338 Ga0495667_0030705 3300046559 Bacteria 3610
339 Ga0495668_0015696 3300046616 Bacteria 4415
340 Ga0495668_0052640 3300046616 Bacteria 2252
341 Ga0495625_0058287 3300046660 Bacteria 2744
342 Ga0495671_0043748 3300046692 Bacteria 2248
343 Ga0495649_0039245 3300046694 Bacteria 2596
344 Ga0495680_0015266 3300047322 Bacteria 6629
345 Ga0495687_000890 3300047443 Bacteria 31459
346 Ga0495687_023652 3300047443 Bacteria 2931
347 Ga0495686_0188817 3300047472 Bacteria 1189
348 Ga0496126_0006677 3300048929 Bacteria 12822
349 Ga0501292_001480 3300049515 Bacteria 2896
350 Ga0501031_0009313 3300049568 Bacteria 6384
351 Ga0501031_0172378 3300049568 Bacteria 1414
352 Ga0501032_0019325 3300049569 Bacteria 4768
353 Ga0501033_0002541 3300049570 Bacteria 15450
354 Ga0501036_0001819 3300049572 Bacteria 16536
355 Ga0501036_0035700 3300049572 Bacteria 4206
356 Ga0501037_0024926 3300049573 Bacteria 4421
357 Ga0501038_0000189 3300049574 Bacteria 53371
358 Ga0501038_0241121 3300049574 Bacteria 1435
359 Ga0501039_0000247 3300049575 Bacteria 39539
360 Ga0501039_0006986 3300049575 Bacteria 8596
361 Ga0501039_0035321 3300049575 Bacteria 3857
362 Ga0501039_0091829 3300049575 Bacteria 2366
363 Ga0501040_0007182 3300049576 Bacteria 7212
364 Ga0501041_0000032 3300049577 Bacteria 44999
365 Ga0501041_0000908 3300049577 Bacteria 16021
366 Ga0501041_0100079 3300049577 Bacteria 1794
367 Ga0501042_0037862 3300049578 Bacteria 3424
368 Ga0501042_0083601 3300049578 Bacteria 2288
369 Ga0501042_0110873 3300049578 Bacteria 1976
370 Ga0501042_0142447 3300049578 Bacteria 1728
371 Ga0501042_0300661 3300049578 Bacteria 1159
372 Ga0501043_0007581 3300049579 Bacteria 8603
373 Ga0501046_0000156 3300049580 Bacteria 70512
374 Ga0501046_0097612 3300049580 Bacteria 2257
375 Ga0501046_0278989 3300049580 Bacteria 1224
376 Ga0501048_0000957 3300049582 Bacteria 21341
377 Ga0501048_0063204 3300049582 Bacteria 2619
378 Ga0501048_0366282 3300049582 Unclassified 1028
379 Ga0501068_0006605 3300049584 Bacteria 6401
380 Ga0501070_0078285 3300049586 Bacteria 2736
381 Ga0501071_0008815 3300049587 Bacteria 6684
382 Ga0501071_0224759 3300049587 Bacteria 1413
383 Ga0501072_0005510 3300049588 Bacteria 9631
384 Ga0501074_0077697 3300049590 Bacteria 2382
385 Ga0501074_0194128 3300049590 Bacteria 1447
386 Ga0501075_0000053 3300049591 Bacteria 49110
387 Ga0501075_0015270 3300049591 Bacteria 5509
388 Ga0501076_0000575 3300049592 Bacteria 23441
389 Ga0501076_0000683 3300049592 Bacteria 21818
390 Ga0501077_0000543 3300049593 Bacteria 22905
391 Ga0501077_0101299 3300049593 Bacteria 1825
392 Ga0501209_000208 3300049656 Bacteria 6868
393 Ga0501079_0000351 3300049741 Bacteria 29422
394 Ga0501079_0410710 3300049741 Bacteria 1062
395 Ga0501080_0007436 3300049742 Bacteria 9889
396 Ga0501080_0016153 3300049742 Bacteria 6891
397 Ga0501080_0149328 3300049742 Bacteria 2161
398 Ga0501080_0439915 3300049742 Bacteria 1170
399 Ga0501081_0000440 3300049743 Bacteria 22990
400 Ga0501081_0018231 3300049743 Bacteria 4660
401 Ga0501083_0028625 3300049744 Bacteria 3839
402 Ga0501083_0087071 3300049744 Bacteria 2066
403 Ga0501035_0019631 3300049822 Bacteria 6211
404 Ga0501035_0030978 3300049822 Bacteria 4871
405 Ga0501035_0040034 3300049822 Bacteria 4237
406 Ga0501044_0001590 3300049823 Bacteria 26597
407 Ga0501044_0110768 3300049823 Bacteria 2754
408 Ga0501045_0015830 3300049824 Bacteria 5349
409 Ga0501045_0043054 3300049824 Bacteria 3287
410 Ga0501045_0153021 3300049824 Bacteria 1716
411 nmdc:mga03683_22656_c1 3300050489 Bacteria 2437
412 nmdc:mga03683_95397_c1 3300050489 Bacteria 1302
413 nmdc:mga00v17_58111_c1 3300050491 Bacteria 2368
414 nmdc:mga0yw44_107646_c1 3300050492 Bacteria 1783
415 nmdc:mga0k408_12173_c1 3300050493 Bacteria 4699
416 nmdc:mga0k408_139395_c1 3300050493 Bacteria 1442
417 nmdc:mga0k408_193375_c1 3300050493 Bacteria 1214
418 nmdc:mga0k408_19633_c1 3300050493 Bacteria 3780
419 nmdc:mga0k408_31767_c1 3300050493 Bacteria 3017
420 nmdc:mga0k408_44865_c1 3300050493 Bacteria 2550
421 nmdc:mga0k408_4953_c1 3300050493 Bacteria 7058
422 nmdc:mga0k408_86725_c1 3300050493 Bacteria 1838
423 nmdc:mga06z11_9592_c1 3300050494 Bacteria 4085
424 nmdc:mga04h51_15514_c1 3300050495 Bacteria 2196
425 nmdc:mga07m45_105210_c1 3300050496 Bacteria 1623
426 nmdc:mga07m45_12903_c1 3300050496 Bacteria 4127
427 nmdc:mga07m45_1608_c1 3300050496 Bacteria 10398
428 nmdc:mga07m45_17600_c1 3300050496 Bacteria 3842
429 nmdc:mga07m45_2148_c1 3300050496 Bacteria 9185
430 nmdc:mga07m45_45347_c1 3300050496 Bacteria 2469
431 nmdc:mga07m45_45631_c1 3300050496 Bacteria 2461
432 nmdc:mga07m45_6047_c2 3300050496 Bacteria 3699
433 nmdc:mga05p37_446382_c1 3300050507 Bacteria 1498
434 nmdc:mga05p37_70588_c1 3300050507 Bacteria 4296
435 nmdc:mga09592_24649_c1 3300050508 Bacteria 4977
436 nmdc:mga09592_312740_c1 3300050508 Bacteria 1361
437 nmdc:mga0qj67_18030_c1 3300050509 Bacteria 5377
438 nmdc:mga0qj67_24181_c1 3300050509 Bacteria 4681
439 nmdc:mga06r32_216984_c1 3300050510 Bacteria 1901
440 nmdc:mga08y16_36460_c1 3300050511 Bacteria 5165
441 nmdc:mga0n895_1811_c1 3300050512 Bacteria 16267
442 nmdc:mga0n895_251761_c1 3300050512 Bacteria 1792
443 nmdc:mga0rr50_1193_c1 3300050513 Bacteria 14104
444 nmdc:mga0rr50_73010_c1 3300050513 Bacteria 2622
445 nmdc:mga08x19_30111_c1 3300050514 Bacteria 3408
446 nmdc:mga08x19_762_c1 3300050514 Bacteria 20508
447 nmdc:mga0a205_177025_c1 3300050515 Bacteria 2028
448 nmdc:mga0sz30_18909_c1 3300050516 Bacteria 2762
449 Ga0500635_0000029 3300053080 Bacteria 100914
450 Ga0495619_0078558 3300053085 Bacteria 2219
451 Ga0500651_0125492 3300053093 Bacteria 1555
452 Ga0500594_0028256 3300053118 Bacteria 1458
453 Ga0500658_0002762 3300053134 Bacteria 6750
454 Ga0500559_0000133 3300053136 Bacteria 56972
455 Ga0500568_0009517 3300053139 Bacteria 4607
456 Ga0500590_050792 3300053148 Bacteria 2108
457 Ga0500634_0037028 3300053161 Bacteria 2655
458 Ga0501084_0008574 3300054114 Bacteria 8454
459 Ga0501082_0021131 3300060353 Bacteria 5613
460 Ga0466962_0012247 3300061719 Bacteria 4122
461 Ga0530510_0000115 3300061734 Bacteria 45273
462 Ga0530510_0005523 3300061734 Bacteria 8757

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300034957 Ga0373938_0052679 Ga0373938_0052679_10_762 241
2 3300006847 Ga0075431_100132842 Ga0075431_1001328422 244
3 3300009094 Ga0111539_10184208 Ga0111539_101842082 244
4 3300050509 nmdc:mga0qj67_24181_c1 nmdc:mga0qj67_24181_c1_2778_3539 244
5 3300050510 nmdc:mga06r32_216984_c1 nmdc:mga06r32_216984_c1_908_1669 244
6 3300050511 nmdc:mga08y16_36460_c1 nmdc:mga08y16_36460_c1_713_1474 244
7 3300050514 nmdc:mga08x19_762_c1 nmdc:mga08x19_762_c1_4513_5274 244
8 3300006173 Ga0070716_100066925 Ga0070716_1000669252 247
9 3300025905 Ga0207685_10061579 Ga0207685_100615792 247
10 3300025939 Ga0207665_10064893 Ga0207665_100648932 247
11 3300041486 Ga0451807_1808059 Ga0451807_1808059_12_815 250
12 3300003323 rootH1_10050641 rootH1_100506412 251
13 3300006847 Ga0075431_100040353 Ga0075431_1000403534 252
14 3300027543 Ga0209999_1008228 Ga0209999_10082282 252
15 3300027682 Ga0209971_1012837 Ga0209971_10128372 252
16 3300027695 Ga0209966_1000929 Ga0209966_10009294 252
17 3300042437 Ga0439444_0008325 Ga0439444_0008325_320_1105 252
18 3300049578 Ga0501042_0110873 Ga0501042_0110873_1130_1915 252
19 3300049580 Ga0501046_0278989 Ga0501046_0278989_269_1081 252
20 3300049824 Ga0501045_0153021 Ga0501045_0153021_218_1030 252
21 3300009147 Ga0114129_10902887 Ga0114129_109028872 256
22 3300050507 nmdc:mga05p37_446382_c1 nmdc:mga05p37_446382_c1_569_1408 256
23 3300003323 rootH1_10050678 rootH1_100506786 258
24 3300005459 Ga0068867_100488044 Ga0068867_1004880441 258
25 3300005539 Ga0068853_100249322 Ga0068853_1002493222 258
26 3300005563 Ga0068855_100012349 Ga0068855_1000123494 258
27 3300005719 Ga0068861_100000492 Ga0068861_1000004925 258
28 3300005844 Ga0068862_100002979 Ga0068862_1000029796 258
29 3300006195 Ga0075366_10203571 Ga0075366_102035712 258
30 3300006881 Ga0068865_100007318 Ga0068865_1000073185 258
31 3300009098 Ga0105245_10205234 Ga0105245_102052342 258
32 3300025253 Ga0209677_103461 Ga0209677_1034614 258
33 3300025899 Ga0207642_10082471 Ga0207642_100824712 258
34 3300025923 Ga0207681_10003667 Ga0207681_100036679 258
35 3300025933 Ga0207706_10250996 Ga0207706_102509962 258
36 3300025934 Ga0207686_10210055 Ga0207686_102100552 258
37 3300025937 Ga0207669_10013398 Ga0207669_100133985 258
38 3300025938 Ga0207704_10004352 Ga0207704_100043525 258
39 3300025942 Ga0207689_10011590 Ga0207689_100115906 258
40 3300025949 Ga0207667_10004262 Ga0207667_100042628 258
41 3300025961 Ga0207712_10001907 Ga0207712_100019078 258
42 3300025972 Ga0207668_10007277 Ga0207668_100072772 258
43 3300026075 Ga0207708_10010615 Ga0207708_100106155 258
44 3300026089 Ga0207648_10000362 Ga0207648_1000036237 258
45 3300026089 Ga0207648_10203747 Ga0207648_102037472 258
46 3300026116 Ga0207674_10225642 Ga0207674_102256422 258
47 3300027907 Ga0207428_10037946 Ga0207428_100379464 258
48 3300028380 Ga0268265_10001605 Ga0268265_1000160511 258
49 3300035086 Ga0373934_0005550 Ga0373934_0005550_2695_3579 258
50 3300050493 nmdc:mga0k408_193375_c1 nmdc:mga0k408_193375_c1_194_1069 258
51 3300003316 rootH1_10052059 rootH1_100520597 259
52 3300005330 Ga0070690_100017574 Ga0070690_1000175744 259
53 3300005343 Ga0070687_100046936 Ga0070687_1000469362 259
54 3300005355 Ga0070671_100189176 Ga0070671_1001891762 259
55 3300005544 Ga0070686_100265549 Ga0070686_1002655492 259
56 3300006237 Ga0097621_100029903 Ga0097621_1000299034 259
57 3300006358 Ga0068871_100001506 Ga0068871_10000150615 259
58 3300005336 Ga0070680_100170046 Ga0070680_1001700462 263
59 3300031239 Ga0265328_10034578 Ga0265328_100345782 263
60 3300031250 Ga0265331_10005817 Ga0265331_100058172 263
61 3300031251 Ga0265327_10000136 Ga0265327_1000013676 263
62 3300036401 Ga0373937_0499694 Ga0373937_0499694_33_854 263
63 3300047322 Ga0495680_0015266 Ga0495680_0015266_5545_6363 264
64 3300049582 Ga0501048_0366282 Ga0501048_0366282_165_980 264
65 3300005339 Ga0070660_100138703 Ga0070660_1001387032 266
66 3300032002 Ga0307416_100289954 Ga0307416_1002899542 266
67 3300032002 Ga0307416_100838780 Ga0307416_1008387801 267
68 3300042876 Ga0451577_0015014 Ga0451577_0015014_287_1117 267
69 3300042876 Ga0451577_0208854 Ga0451577_0208854_226_1143 267
70 3300042876 Ga0451577_0253509 Ga0451577_0253509_149_1003 267
71 3300044673 Ga0453683_0136090 Ga0453683_0136090_128_958 267
72 3300044673 Ga0453683_0176530 Ga0453683_0176530_509_1339 267
73 3300044712 Ga0453684_0000826 Ga0453684_0000826_2739_3569 267
74 3300044712 Ga0453684_0069662 Ga0453684_0069662_3311_4141 267
75 3300045051 Ga0451576_0000140 Ga0451576_0000140_110154_111095 267
76 3300045051 Ga0451576_0016220 Ga0451576_0016220_3095_3925 267
77 3300045051 Ga0451576_0018773 Ga0451576_0018773_2291_3136 267
78 3300045051 Ga0451576_0078095 Ga0451576_0078095_201_1031 267
79 3300045051 Ga0451576_0148204 Ga0451576_0148204_817_1647 267
80 3300048929 Ga0496126_0006677 Ga0496126_0006677_11257_12102 267
81 3300049656 Ga0501209_000208 Ga0501209_000208_590_1432 267
82 3300049744 Ga0501083_0028625 Ga0501083_0028625_33_860 267
83 3300050508 nmdc:mga09592_312740_c1 nmdc:mga09592_312740_c1_316_1149 267
84 3300031238 Ga0265332_10006016 Ga0265332_100060166 268
85 3300031250 Ga0265331_10057453 Ga0265331_100574531 268
86 3300031711 Ga0265314_10012555 Ga0265314_100125553 268
87 3300042876 Ga0451577_0022141 Ga0451577_0022141_4507_5373 268
88 3300050509 nmdc:mga0qj67_18030_c1 nmdc:mga0qj67_18030_c1_110_967 268
89 3300006844 Ga0075428_100051859 Ga0075428_1000518592 269
90 3300006847 Ga0075431_100263023 Ga0075431_1002630232 269
91 3300009147 Ga0114129_10156352 Ga0114129_101563522 269
92 3300042876 Ga0451577_0331978 Ga0451577_0331978_365_1258 269
93 3300050507 nmdc:mga05p37_70588_c1 nmdc:mga05p37_70588_c1_1461_2294 269
94 3300050508 nmdc:mga09592_24649_c1 nmdc:mga09592_24649_c1_2781_3614 269
95 3300050512 nmdc:mga0n895_251761_c1 nmdc:mga0n895_251761_c1_529_1365 269
96 3300053161 Ga0500634_0037028 Ga0500634_0037028_788_1651 269
97 3300005330 Ga0070690_100244814 Ga0070690_1002448142 270
98 3300005336 Ga0070680_100038414 Ga0070680_1000384143 270
99 3300005336 Ga0070680_100384041 Ga0070680_1003840411 270
100 3300005343 Ga0070687_100156970 Ga0070687_1001569701 270
101 3300005345 Ga0070692_10003525 Ga0070692_100035252 270
102 3300005345 Ga0070692_10165049 Ga0070692_101650492 270
103 3300005347 Ga0070668_100087502 Ga0070668_1000875022 270
104 3300005353 Ga0070669_100003316 Ga0070669_1000033169 270
105 3300005356 Ga0070674_100138998 Ga0070674_1001389982 270
106 3300005437 Ga0070710_10051880 Ga0070710_100518802 270
107 3300005440 Ga0070705_100033683 Ga0070705_1000336833 270
108 3300005441 Ga0070700_100001929 Ga0070700_1000019295 270
109 3300005444 Ga0070694_100007385 Ga0070694_1000073853 270
110 3300005444 Ga0070694_100075703 Ga0070694_1000757032 270
111 3300005445 Ga0070708_100471397 Ga0070708_1004713972 270
112 3300005457 Ga0070662_100144968 Ga0070662_1001449682 270
113 3300005458 Ga0070681_10000135 Ga0070681_1000013527 270
114 3300005459 Ga0068867_100000606 Ga0068867_10000060619 270
115 3300005459 Ga0068867_100155788 Ga0068867_1001557882 270
116 3300005518 Ga0070699_100308891 Ga0070699_1003088911 270
117 3300005530 Ga0070679_100046897 Ga0070679_1000468974 270
118 3300005536 Ga0070697_100017635 Ga0070697_1000176354 270
119 3300005545 Ga0070695_100003127 Ga0070695_1000031277 270
120 3300005546 Ga0070696_100001158 Ga0070696_10000115814 270
121 3300005546 Ga0070696_100043993 Ga0070696_1000439932 270
122 3300005549 Ga0070704_100009462 Ga0070704_1000094623 270
123 3300005549 Ga0070704_100096596 Ga0070704_1000965962 270
124 3300005617 Ga0068859_100024148 Ga0068859_1000241482 270
125 3300006852 Ga0075433_10333671 Ga0075433_103336712 270
126 3300006871 Ga0075434_100000002 Ga0075434_10000000272 270
127 3300006914 Ga0075436_100034169 Ga0075436_1000341692 270
128 3300006931 Ga0097620_100024148 Ga0097620_1000241487 270
129 3300007076 Ga0075435_100004018 Ga0075435_1000040188 270
130 3300009176 Ga0105242_10028991 Ga0105242_100289912 270
131 3300025912 Ga0207707_10003001 Ga0207707_1000300112 270
132 3300025918 Ga0207662_10159148 Ga0207662_101591482 270
133 3300026089 Ga0207648_10171447 Ga0207648_101714472 270
134 3300026118 Ga0207675_100037995 Ga0207675_1000379955 270
135 3300031240 Ga0265320_10036589 Ga0265320_100365892 270
136 3300031548 Ga0307408_100047939 Ga0307408_1000479392 270
137 3300031665 Ga0316575_10031265 Ga0316575_100312652 270
138 3300031665 Ga0316575_10032811 Ga0316575_100328112 270
139 3300031691 Ga0316579_10000229 Ga0316579_100002298 270
140 3300031728 Ga0316578_10003363 Ga0316578_100033633 270
141 3300032133 Ga0316583_10001141 Ga0316583_100011412 270
142 3300035086 Ga0373934_0031327 Ga0373934_0031327_1029_1877 270
143 3300035119 Ga0373956_0150755 Ga0373956_0150755_41_889 270
144 3300035120 Ga0373957_0005373 Ga0373957_0005373_884_1732 270
145 3300035121 Ga0373960_0009027 Ga0373960_0009027_518_1357 270
146 3300035241 Ga0373961_0006198 Ga0373961_0006198_62_901 270
147 3300035398 Ga0316574_0016443 Ga0316574_0016443_35_895 270
148 3300035410 Ga0373924_0024900 Ga0373924_0024900_1367_2215 270
149 3300035691 Ga0373931_0001491 Ga0373931_0001491_6149_6988 270
150 3300035691 Ga0373931_0130954 Ga0373931_0130954_543_1433 270
151 3300035695 Ga0373927_0185479 Ga0373927_0185479_453_1292 270
152 3300035724 Ga0373933_0002244 Ga0373933_0002244_3512_4360 270
153 3300036401 Ga0373937_0017644 Ga0373937_0017644_314_1162 270
154 3300044712 Ga0453684_0215836 Ga0453684_0215836_894_1754 270
155 3300045051 Ga0451576_0048830 Ga0451576_0048830_1858_2703 270
156 3300046511 Ga0495608_0077353 Ga0495608_0077353_872_1720 270
157 3300046559 Ga0495667_0030705 Ga0495667_0030705_1911_2759 270
158 3300049568 Ga0501031_0009313 Ga0501031_0009313_510_1385 270
159 3300049568 Ga0501031_0172378 Ga0501031_0172378_532_1386 270
160 3300049569 Ga0501032_0019325 Ga0501032_0019325_401_1276 270
161 3300049570 Ga0501033_0002541 Ga0501033_0002541_794_1669 270
162 3300049572 Ga0501036_0001819 Ga0501036_0001819_13654_14529 270
163 3300049572 Ga0501036_0035700 Ga0501036_0035700_2110_2964 270
164 3300049573 Ga0501037_0024926 Ga0501037_0024926_802_1677 270
165 3300049574 Ga0501038_0000189 Ga0501038_0000189_22505_23380 270
166 3300049574 Ga0501038_0241121 Ga0501038_0241121_161_1039 270
167 3300049575 Ga0501039_0000247 Ga0501039_0000247_8854_9729 270
168 3300049575 Ga0501039_0006986 Ga0501039_0006986_5446_6300 270
169 3300049575 Ga0501039_0035321 Ga0501039_0035321_898_1749 270
170 3300049575 Ga0501039_0091829 Ga0501039_0091829_123_1001 270
171 3300049576 Ga0501040_0007182 Ga0501040_0007182_6291_7145 270
172 3300049577 Ga0501041_0000032 Ga0501041_0000032_40259_41134 270
173 3300049577 Ga0501041_0000908 Ga0501041_0000908_10413_11267 270
174 3300049577 Ga0501041_0100079 Ga0501041_0100079_885_1736 270
175 3300049578 Ga0501042_0037862 Ga0501042_0037862_169_1023 270
176 3300049578 Ga0501042_0083601 Ga0501042_0083601_603_1478 270
177 3300049578 Ga0501042_0142447 Ga0501042_0142447_729_1607 270
178 3300049578 Ga0501042_0300661 Ga0501042_0300661_228_1079 270
179 3300049579 Ga0501043_0007581 Ga0501043_0007581_7310_8185 270
180 3300049580 Ga0501046_0000156 Ga0501046_0000156_44584_45459 270
181 3300049580 Ga0501046_0097612 Ga0501046_0097612_79_933 270
182 3300049582 Ga0501048_0000957 Ga0501048_0000957_7735_8610 270
183 3300049582 Ga0501048_0063204 Ga0501048_0063204_242_1093 270
184 3300049584 Ga0501068_0006605 Ga0501068_0006605_1143_2018 270
185 3300049586 Ga0501070_0078285 Ga0501070_0078285_131_1006 270
186 3300049587 Ga0501071_0008815 Ga0501071_0008815_722_1597 270
187 3300049587 Ga0501071_0224759 Ga0501071_0224759_202_1056 270
188 3300049588 Ga0501072_0005510 Ga0501072_0005510_4891_5766 270
189 3300049590 Ga0501074_0077697 Ga0501074_0077697_915_1790 270
190 3300049590 Ga0501074_0194128 Ga0501074_0194128_525_1379 270
191 3300049591 Ga0501075_0000053 Ga0501075_0000053_24928_25803 270
192 3300049591 Ga0501075_0015270 Ga0501075_0015270_3954_4808 270
193 3300049592 Ga0501076_0000575 Ga0501076_0000575_18522_19376 270
194 3300049592 Ga0501076_0000683 Ga0501076_0000683_4754_5629 270
195 3300049593 Ga0501077_0000543 Ga0501077_0000543_2008_2883 270
196 3300049593 Ga0501077_0101299 Ga0501077_0101299_455_1309 270
197 3300049741 Ga0501079_0000351 Ga0501079_0000351_27843_28718 270
198 3300049741 Ga0501079_0410710 Ga0501079_0410710_47_898 270
199 3300049742 Ga0501080_0007436 Ga0501080_0007436_1193_2047 270
200 3300049742 Ga0501080_0016153 Ga0501080_0016153_818_1693 270
201 3300049742 Ga0501080_0149328 Ga0501080_0149328_627_1466 270
202 3300049742 Ga0501080_0439915 Ga0501080_0439915_265_1119 270
203 3300049743 Ga0501081_0000440 Ga0501081_0000440_1143_2018 270
204 3300049743 Ga0501081_0018231 Ga0501081_0018231_2713_3567 270
205 3300049744 Ga0501083_0087071 Ga0501083_0087071_380_1234 270
206 3300049822 Ga0501035_0019631 Ga0501035_0019631_5112_5987 270
207 3300049823 Ga0501044_0110768 Ga0501044_0110768_787_1662 270
208 3300049824 Ga0501045_0015830 Ga0501045_0015830_2488_3342 270
209 3300050512 nmdc:mga0n895_1811_c1 nmdc:mga0n895_1811_c1_6623_7462 270
210 3300050513 nmdc:mga0rr50_1193_c1 nmdc:mga0rr50_1193_c1_6381_7220 270
211 3300050513 nmdc:mga0rr50_73010_c1 nmdc:mga0rr50_73010_c1_602_1540 270
212 3300050514 nmdc:mga08x19_30111_c1 nmdc:mga08x19_30111_c1_2406_3257 270
213 3300050515 nmdc:mga0a205_177025_c1 nmdc:mga0a205_177025_c1_429_1367 270
214 3300053085 Ga0495619_0078558 Ga0495619_0078558_837_1685 270
215 3300054114 Ga0501084_0008574 Ga0501084_0008574_5112_5987 270
216 3300060353 Ga0501082_0021131 Ga0501082_0021131_2731_3606 270
217 3300061734 Ga0530510_0000115 Ga0530510_0000115_25526_26401 270
218 3300061734 Ga0530510_0005523 Ga0530510_0005523_7837_8691 270
219 iso_pu_bacteria 8055225921 8055226517 270
220 3300005367 Ga0070667_100633377 Ga0070667_1006333771 271
221 3300003763 Ga0055529_1010900 Ga0055529_10109002 272
222 3300005327 Ga0070658_10054707 Ga0070658_100547074 272
223 3300025272 Ga0209455_1000596 Ga0209455_100059613 272
224 3300025909 Ga0207705_10028930 Ga0207705_100289305 272
225 3300049822 Ga0501035_0030978 Ga0501035_0030978_487_1365 272
226 3300049822 Ga0501035_0040034 Ga0501035_0040034_2881_3756 272
227 3300049823 Ga0501044_0001590 Ga0501044_0001590_7524_8399 272
228 3300002705 JGI25156J39149_1002577 JGI25156J39149_10025772 273
229 3300002738 JGI25154J39366_1000518 JGI25154J39366_10005182 273
230 3300002741 JGI25157J39369_1000743 JGI25157J39369_100074314 273
231 3300003752 Ga0055539_1000140 Ga0055539_10001406 273
232 3300003752 Ga0055539_1001323 Ga0055539_10013234 273
233 3300003756 Ga0055533_1000045 Ga0055533_1000045154 273
234 3300005577 Ga0068857_100003374 Ga0068857_1000033744 273
235 3300005578 Ga0068854_100008220 Ga0068854_1000082202 273
236 3300005614 Ga0068856_100002437 Ga0068856_10000243712 273
237 3300005616 Ga0068852_100279551 Ga0068852_1002795512 273
238 3300006353 Ga0075370_10018414 Ga0075370_100184142 273
239 3300009093 Ga0105240_10047132 Ga0105240_100471324 273
240 3300009174 Ga0105241_10064719 Ga0105241_100647193 273
241 3300013105 Ga0157369_10054876 Ga0157369_100548764 273
242 3300025226 Ga0209674_100073 Ga0209674_100073154 273
243 3300025230 Ga0209563_100061 Ga0209563_10006176 273
244 3300025246 Ga0209646_1000249 Ga0209646_10002492 273
245 3300025250 Ga0209026_1000011 Ga0209026_1000011428 273
246 3300025253 Ga0209677_100120 Ga0209677_10012011 273
247 3300025253 Ga0209677_100633 Ga0209677_1006335 273
248 3300025256 Ga0209759_1000034 Ga0209759_100003448 273
249 3300025911 Ga0207654_10040895 Ga0207654_100408952 273
250 3300025913 Ga0207695_10005833 Ga0207695_1000583315 273
251 3300025919 Ga0207657_10142561 Ga0207657_101425612 273
252 3300025924 Ga0207694_10008860 Ga0207694_100088604 273
253 3300025949 Ga0207667_10206182 Ga0207667_102061822 273
254 3300025981 Ga0207640_10004000 Ga0207640_100040009 273
255 3300026078 Ga0207702_10006491 Ga0207702_100064914 273
256 3300026116 Ga0207674_10087457 Ga0207674_100874574 273
257 3300050496 nmdc:mga07m45_6047_c2 nmdc:mga07m45_6047_c2_761_1645 273
258 3300025242 Ga0209258_101471 Ga0209258_1014714 274
259 3300042876 Ga0451577_0010640 Ga0451577_0010640_510_1355 275
260 3300021361 Ga0213872_10000982 Ga0213872_1000098213 277
261 3300039447 Ga0436361_0046388 Ga0436361_0046388_18859_19728 277
262 iso_pu_bacteria 2643221654 2644301112 277
263 3300006353 Ga0075370_10017563 Ga0075370_100175632 278
264 3300027526 Ga0209968_1006989 Ga0209968_10069892 278
265 3300027695 Ga0209966_1000138 Ga0209966_10001382 278
266 3300028794 Ga0307515_10014894 Ga0307515_100148942 278
267 3300031730 Ga0307516_10000155 Ga0307516_1000015570 278
268 3300050496 nmdc:mga07m45_17600_c1 nmdc:mga07m45_17600_c1_1421_2281 278
269 iso_pu_bacteria 2643221660 2644338543 278
270 3300003761 Ga0055535_1002371 Ga0055535_10023712 279
271 3300003763 Ga0055529_1000148 Ga0055529_10001482 279
272 3300005327 Ga0070658_10056054 Ga0070658_100560542 279
273 3300005330 Ga0070690_100042630 Ga0070690_1000426302 279
274 3300005339 Ga0070660_100154391 Ga0070660_1001543912 279
275 3300005364 Ga0070673_100011910 Ga0070673_1000119102 279
276 3300005366 Ga0070659_100093718 Ga0070659_1000937182 279
277 3300005544 Ga0070686_100297439 Ga0070686_1002974392 279
278 3300005563 Ga0068855_100161223 Ga0068855_1001612232 279
279 3300005719 Ga0068861_100008163 Ga0068861_1000081633 279
280 3300009176 Ga0105242_10342569 Ga0105242_103425692 279
281 3300014968 Ga0157379_10152584 Ga0157379_101525842 279
282 3300015262 Ga0182007_10032743 Ga0182007_100327432 279
283 3300025242 Ga0209258_100998 Ga0209258_1009983 279
284 3300025254 Ga0209148_1008260 Ga0209148_10082602 279
285 3300025256 Ga0209759_1000900 Ga0209759_10009004 279
286 3300025256 Ga0209759_1003968 Ga0209759_10039684 279
287 3300025272 Ga0209455_1000053 Ga0209455_1000053354 279
288 3300025909 Ga0207705_10069863 Ga0207705_100698633 279
289 3300025919 Ga0207657_10077316 Ga0207657_100773162 279
290 3300025932 Ga0207690_10084916 Ga0207690_100849162 279
291 3300025949 Ga0207667_10374252 Ga0207667_103742521 279
292 3300025960 Ga0207651_10114626 Ga0207651_101146262 279
293 3300026118 Ga0207675_100012092 Ga0207675_1000120925 279
294 3300028666 Ga0265336_10000556 Ga0265336_100005563 279
295 3300029957 Ga0265324_10012293 Ga0265324_100122934 279
296 3300044656 Ga0466969_0020667 Ga0466969_0020667_2057_2929 279
297 3300044683 Ga0466965_0018614 Ga0466965_0018614_494_1366 279
298 3300044684 Ga0466966_0000454 Ga0466966_0000454_608_1480 279
299 3300044693 Ga0466961_0018142 Ga0466961_0018142_850_1722 279
300 3300044694 Ga0466963_0085019 Ga0466963_0085019_286_1158 279
301 3300044706 Ga0466964_0029421 Ga0466964_0029421_976_1848 279
302 3300044842 Ga0466957_0004587 Ga0466957_0004587_425_1297 279
303 3300044842 Ga0466957_0121140 Ga0466957_0121140_495_1367 279
304 3300045049 Ga0466959_0025615 Ga0466959_0025615_474_1346 279
305 3300045836 Ga0466958_0148593 Ga0466958_0148593_467_1339 279
306 3300053080 Ga0500635_0000029 Ga0500635_0000029_21411_22295 279
307 3300061719 Ga0466962_0012247 Ga0466962_0012247_2078_2950 279
308 3300005468 Ga0070707_100579144 Ga0070707_1005791441 280
309 3300026121 Ga0207683_10278963 Ga0207683_102789632 280
310 3300044712 Ga0453684_0142325 Ga0453684_0142325_1578_2447 280
311 3300002155 JGI24033J26618_1013010 JGI24033J26618_10130101 281
312 3300005293 Ga0065715_10104788 Ga0065715_101047883 281
313 3300005328 Ga0070676_10010008 Ga0070676_100100085 281
314 3300005328 Ga0070676_10116342 Ga0070676_101163422 281
315 3300005331 Ga0070670_100062592 Ga0070670_1000625922 281
316 3300005331 Ga0070670_100293284 Ga0070670_1002932842 281
317 3300005331 Ga0070670_100340841 Ga0070670_1003408412 281
318 3300005334 Ga0068869_100013610 Ga0068869_1000136102 281
319 3300005334 Ga0068869_100078771 Ga0068869_1000787712 281
320 3300005338 Ga0068868_100051935 Ga0068868_1000519354 281
321 3300005344 Ga0070661_100295412 Ga0070661_1002954121 281
322 3300005354 Ga0070675_100246700 Ga0070675_1002467002 281
323 3300005355 Ga0070671_100201286 Ga0070671_1002012862 281
324 3300005364 Ga0070673_100008834 Ga0070673_1000088346 281
325 3300005364 Ga0070673_100192493 Ga0070673_1001924932 281
326 3300005367 Ga0070667_100207387 Ga0070667_1002073871 281
327 3300005455 Ga0070663_100053189 Ga0070663_1000531892 281
328 3300005455 Ga0070663_100230235 Ga0070663_1002302351 281
329 3300005456 Ga0070678_100318739 Ga0070678_1003187392 281
330 3300005457 Ga0070662_100222787 Ga0070662_1002227871 281
331 3300005459 Ga0068867_100021775 Ga0068867_1000217755 281
332 3300005459 Ga0068867_100023367 Ga0068867_1000233673 281
333 3300005459 Ga0068867_100487160 Ga0068867_1004871601 281
334 3300005467 Ga0070706_100003188 Ga0070706_10000318814 281
335 3300005468 Ga0070707_100037315 Ga0070707_1000373155 281
336 3300005471 Ga0070698_100036226 Ga0070698_1000362261 281
337 3300005518 Ga0070699_100214835 Ga0070699_1002148351 281
338 3300005548 Ga0070665_100035834 Ga0070665_1000358342 281
339 3300005564 Ga0070664_100189498 Ga0070664_1001894982 281
340 3300005564 Ga0070664_100382923 Ga0070664_1003829231 281
341 3300005577 Ga0068857_100253283 Ga0068857_1002532832 281
342 3300005578 Ga0068854_100222791 Ga0068854_1002227912 281
343 3300005616 Ga0068852_100113529 Ga0068852_1001135292 281
344 3300005617 Ga0068859_100067147 Ga0068859_1000671474 281
345 3300005618 Ga0068864_100007242 Ga0068864_1000072423 281
346 3300005840 Ga0068870_10024562 Ga0068870_100245622 281
347 3300005841 Ga0068863_100027398 Ga0068863_1000273986 281
348 3300006038 Ga0075365_10173538 Ga0075365_101735382 281
349 3300006042 Ga0075368_10001585 Ga0075368_100015854 281
350 3300006042 Ga0075368_10017530 Ga0075368_100175303 281
351 3300006051 Ga0075364_10187728 Ga0075364_101877282 281
352 3300006177 Ga0075362_10004323 Ga0075362_100043232 281
353 3300006177 Ga0075362_10032216 Ga0075362_100322162 281
354 3300006178 Ga0075367_10009705 Ga0075367_100097052 281
355 3300006178 Ga0075367_10016595 Ga0075367_100165952 281
356 3300006178 Ga0075367_10019903 Ga0075367_100199032 281
357 3300006186 Ga0075369_10022846 Ga0075369_100228463 281
358 3300006195 Ga0075366_10046772 Ga0075366_100467723 281
359 3300006195 Ga0075366_10055015 Ga0075366_100550153 281
360 3300006195 Ga0075366_10096726 Ga0075366_100967262 281
361 3300006195 Ga0075366_10121013 Ga0075366_101210132 281
362 3300006237 Ga0097621_100188659 Ga0097621_1001886592 281
363 3300006237 Ga0097621_100213016 Ga0097621_1002130161 281
364 3300006353 Ga0075370_10002430 Ga0075370_100024308 281
365 3300006353 Ga0075370_10011130 Ga0075370_100111305 281
366 3300006353 Ga0075370_10011503 Ga0075370_100115035 281
367 3300006931 Ga0097620_100067148 Ga0097620_1000671484 281
368 3300009093 Ga0105240_10202928 Ga0105240_102029282 281
369 3300009098 Ga0105245_10106875 Ga0105245_101068753 281
370 3300009098 Ga0105245_10212568 Ga0105245_102125682 281
371 3300009101 Ga0105247_10080685 Ga0105247_100806852 281
372 3300009545 Ga0105237_10157941 Ga0105237_101579411 281
373 3300010375 Ga0105239_10357438 Ga0105239_103574382 281
374 3300013306 Ga0163162_10137495 Ga0163162_101374951 281
375 3300013308 Ga0157375_10046040 Ga0157375_100460405 281
376 3300013308 Ga0157375_10081044 Ga0157375_100810442 281
377 3300014326 Ga0157380_10230891 Ga0157380_102308911 281
378 3300014745 Ga0157377_10277655 Ga0157377_102776551 281
379 3300014968 Ga0157379_10204103 Ga0157379_102041032 281
380 3300025907 Ga0207645_10014430 Ga0207645_100144302 281
381 3300025908 Ga0207643_10085476 Ga0207643_100854761 281
382 3300025914 Ga0207671_10044286 Ga0207671_100442862 281
383 3300025920 Ga0207649_10266023 Ga0207649_102660231 281
384 3300025922 Ga0207646_10057941 Ga0207646_100579412 281
385 3300025925 Ga0207650_10050852 Ga0207650_100508523 281
386 3300025925 Ga0207650_10225743 Ga0207650_102257432 281
387 3300025926 Ga0207659_10043579 Ga0207659_100435793 281
388 3300025927 Ga0207687_10060483 Ga0207687_100604832 281
389 3300025927 Ga0207687_10062324 Ga0207687_100623242 281
390 3300025931 Ga0207644_10189111 Ga0207644_101891112 281
391 3300025933 Ga0207706_10004957 Ga0207706_100049579 281
392 3300025938 Ga0207704_10157444 Ga0207704_101574442 281
393 3300025940 Ga0207691_10112148 Ga0207691_101121482 281
394 3300025942 Ga0207689_10017327 Ga0207689_100173277 281
395 3300025942 Ga0207689_10017773 Ga0207689_100177733 281
396 3300025945 Ga0207679_10216924 Ga0207679_102169242 281
397 3300025945 Ga0207679_10336485 Ga0207679_103364852 281
398 3300025960 Ga0207651_10385625 Ga0207651_103856252 281
399 3300025981 Ga0207640_10256509 Ga0207640_102565092 281
400 3300025986 Ga0207658_10178393 Ga0207658_101783931 281
401 3300026041 Ga0207639_10716844 Ga0207639_107168441 281
402 3300026067 Ga0207678_10006113 Ga0207678_1000611310 281
403 3300026067 Ga0207678_10258950 Ga0207678_102589502 281
404 3300026088 Ga0207641_10137768 Ga0207641_101377682 281
405 3300026089 Ga0207648_10033577 Ga0207648_100335772 281
406 3300026089 Ga0207648_10512882 Ga0207648_105128822 281
407 3300026142 Ga0207698_10195544 Ga0207698_101955442 281
408 3300027866 Ga0209813_10006913 Ga0209813_100069132 281
409 3300028379 Ga0268266_10013661 Ga0268266_100136616 281
410 3300028786 Ga0307517_10111454 Ga0307517_101114542 281
411 3300028786 Ga0307517_10132524 Ga0307517_101325242 281
412 3300028794 Ga0307515_10018130 Ga0307515_100181308 281
413 3300028794 Ga0307515_10183789 Ga0307515_101837893 281
414 3300028794 Ga0307515_10184468 Ga0307515_101844682 281
415 3300030522 Ga0307512_10104116 Ga0307512_101041162 281
416 3300031456 Ga0307513_10057211 Ga0307513_100572114 281
417 3300031456 Ga0307513_10237409 Ga0307513_102374092 281
418 3300031507 Ga0307509_10001647 Ga0307509_1000164721 281
419 3300031507 Ga0307509_10029240 Ga0307509_100292405 281
420 3300031507 Ga0307509_10052681 Ga0307509_100526815 281
421 3300031616 Ga0307508_10045147 Ga0307508_100451475 281
422 3300032002 Ga0307416_100042374 Ga0307416_1000423744 281
423 3300033180 Ga0307510_10059773 Ga0307510_100597733 281
424 3300046454 Ga0495592_0004208 Ga0495592_0004208_2355_3209 281
425 3300046512 Ga0495610_0040271 Ga0495610_0040271_47_901 281
426 3300046515 Ga0495620_0080500 Ga0495620_0080500_321_1175 281
427 3300046519 Ga0495632_0039269 Ga0495632_0039269_1116_1985 281
428 3300046522 Ga0495643_0127653 Ga0495643_0127653_161_1030 281
429 3300046542 Ga0495597_0003790 Ga0495597_0003790_7048_7917 281
430 3300046616 Ga0495668_0015696 Ga0495668_0015696_2982_3851 281
431 3300046616 Ga0495668_0052640 Ga0495668_0052640_434_1288 281
432 3300046660 Ga0495625_0058287 Ga0495625_0058287_31_900 281
433 3300046692 Ga0495671_0043748 Ga0495671_0043748_98_961 281
434 3300046694 Ga0495649_0039245 Ga0495649_0039245_971_1840 281
435 3300047443 Ga0495687_000890 Ga0495687_000890_7392_8261 281
436 3300047443 Ga0495687_023652 Ga0495687_023652_215_1084 281
437 3300047472 Ga0495686_0188817 Ga0495686_0188817_304_1158 281
438 3300049515 Ga0501292_001480 Ga0501292_001480_1429_2319 281
439 3300049824 Ga0501045_0043054 Ga0501045_0043054_482_1369 281
440 3300050489 nmdc:mga03683_22656_c1 nmdc:mga03683_22656_c1_1097_1966 281
441 3300050489 nmdc:mga03683_95397_c1 nmdc:mga03683_95397_c1_34_903 281
442 3300050491 nmdc:mga00v17_58111_c1 nmdc:mga00v17_58111_c1_974_1843 281
443 3300050492 nmdc:mga0yw44_107646_c1 nmdc:mga0yw44_107646_c1_497_1366 281
444 3300050493 nmdc:mga0k408_12173_c1 nmdc:mga0k408_12173_c1_3237_4106 281
445 3300050493 nmdc:mga0k408_139395_c1 nmdc:mga0k408_139395_c1_110_1006 281
446 3300050493 nmdc:mga0k408_19633_c1 nmdc:mga0k408_19633_c1_2710_3579 281
447 3300050493 nmdc:mga0k408_31767_c1 nmdc:mga0k408_31767_c1_1530_2399 281
448 3300050493 nmdc:mga0k408_44865_c1 nmdc:mga0k408_44865_c1_1240_2109 281
449 3300050493 nmdc:mga0k408_4953_c1 nmdc:mga0k408_4953_c1_2965_3834 281
450 3300050493 nmdc:mga0k408_86725_c1 nmdc:mga0k408_86725_c1_179_1048 281
451 3300050494 nmdc:mga06z11_9592_c1 nmdc:mga06z11_9592_c1_2443_3312 281
452 3300050495 nmdc:mga04h51_15514_c1 nmdc:mga04h51_15514_c1_627_1496 281
453 3300050496 nmdc:mga07m45_105210_c1 nmdc:mga07m45_105210_c1_569_1441 281
454 3300050496 nmdc:mga07m45_12903_c1 nmdc:mga07m45_12903_c1_125_994 281
455 3300050496 nmdc:mga07m45_1608_c1 nmdc:mga07m45_1608_c1_66_935 281
456 3300050496 nmdc:mga07m45_2148_c1 nmdc:mga07m45_2148_c1_1169_2038 281
457 3300050496 nmdc:mga07m45_45347_c1 nmdc:mga07m45_45347_c1_422_1291 281
458 3300050496 nmdc:mga07m45_45631_c1 nmdc:mga07m45_45631_c1_643_1512 281
459 3300050516 nmdc:mga0sz30_18909_c1 nmdc:mga0sz30_18909_c1_202_1071 281
460 3300053093 Ga0500651_0125492 Ga0500651_0125492_141_995 281
461 3300053118 Ga0500594_0028256 Ga0500594_0028256_268_1122 281
462 3300053134 Ga0500658_0002762 Ga0500658_0002762_2878_3747 281
463 3300053136 Ga0500559_0000133 Ga0500559_0000133_8251_9105 281
464 3300053139 Ga0500568_0009517 Ga0500568_0009517_3189_4058 281
465 3300053148 Ga0500590_050792 Ga0500590_050792_814_1704 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03279

Lip_A_acyltrans

Bacterial lipid A biosynthesis acyltransferase

14

291

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5knk-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii with catalytic residue substitution (e127a) 0.8142 9 279
5kn7-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii 0.7919 4 279
5f34-assembly1.cif.gz_A crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group 0.7912 32 270
5knk-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii with catalytic residue substitution (e127a) 0.7787 9 279
5kn7-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii 0.7707 4 279
ID Description Score Start End Superfamily
af_Q54I12_580_724_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.5679 86 211 3.40.50.620
1k30A02 Alpha Beta;3-Layer(aba) Sandwich;Glycerol-3-phosphate (1)-acyltransferase;Glycerol-3-phosphate (1)-acyltransferase 0.5678 84 267 3.40.1130.10
af_P31119_15_138_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.558 93 218 3.40.1010.10
af_Q22949_143_292_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.5569 88 187 3.40.50.620
af_Q4E308_598_739_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.5562 89 209 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A6L6Q2B0-F1-model_v4 Lysophospholipid acyltransferase family protein 0.9722 2 281 GO:0005886
GO:0009247
GO:0016746
AF-A0A1A7BUK6-F1-model_v4 KDO2-lipid IV(A) lauroyltransferase (EC 2.3.1.241) 0.9688 2 280 GO:0005886
GO:0008913
GO:0009247
AF-A0A127QBT5-F1-model_v4 Bacterial lipid A biosynthesis acyltransferase family protein 0.9679 2 280 GO:0005886
GO:0009247
GO:0016746
AF-A0A7W9X0E5-F1-model_v4 KDO2-lipid IV(A) lauroyltransferase (EC 2.3.1.241) 0.9677 15 280 GO:0005886
GO:0008913
GO:0009247
AF-A0A2G8T8C4-F1-model_v4 Lipid A biosynthesis acyltransferase 0.965 2 280 GO:0005886
GO:0009247
GO:0016746

Feature Viewer

pLDDT pTM Quality
90.59 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map