F449532

General Info

Members Datasets Scaffolds Average Seq Length
465 275 930 248

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0124070|Ga0466967_0124070_1003_1767
Length 246
Sequence MSEAGTARVAIVTGAARGIGAATARRLAADGFAVAVIDLDEGSAKGTVEAIEADGGRAIAVGADVSDAEQVDAAVARVAAELGGPTVLVNNAGVTRDNMLFKMTESDWDTVMNVHLKGAFLMSRATQKHMVNLSSVSALGNRGQANYSTAKAGLQGFTKTLAIELGRFGVTVNAIAPGFIQTEMTRATAERIGISFEDMIAAASKEIPVGRVGQPEDIAALVGFLVSEGAGFVSGQVIYAAGGPKA

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
115 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
116 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
117 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
118 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
119 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
123 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
124 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300031011 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
152 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
196 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
238 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
252 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
255 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
256 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
257 2517572101 Frankia sp. DC12 Isolate Nodule
258 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
259 2626541554 Frankia sp. AvcI.1 Isolate Nodule
260 2671180195 Frankia sp. CcI49 Isolate Nodule
261 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
262 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
263 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
264 2738543010 Bacillus sp. YR335 Isolate Unclassified
265 2773857922 Frankia sp. CcI49 Isolate Nodule
266 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
267 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
268 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
269 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
270 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
271 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
272 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
273 8002784119 Frankia sp. AgB1.9 Isolate Nodule
274 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
275 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.32
Metatranscriptomes 4.95
Isolates 4.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.29
Nodule 1.72
Rhizoplane 3.44
Rhizosphere 87.1
Stem 0
Stem Tuber 0.22
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0124070 3300045976 Bacteria 2390
2 JGI25406J46586_10010569 3300003203 Bacteria 4092
3 Ga0070658_10103876 3300005327 Bacteria 2350
4 Ga0070658_10131652 3300005327 Bacteria 2085
5 Ga0070658_10286902 3300005327 Bacteria 1402
6 Ga0070658_10442342 3300005327 Bacteria 1119
7 Ga0070683_100007875 3300005329 Bacteria 9027
8 Ga0070683_100077856 3300005329 Bacteria 3101
9 Ga0070683_100153543 3300005329 Bacteria 2183
10 Ga0070683_100201163 3300005329 Bacteria 1891
11 Ga0070683_100293555 3300005329 Bacteria 1546
12 Ga0070680_100144334 3300005336 Bacteria 1997
13 Ga0070680_100529008 3300005336 Bacteria 1010
14 Ga0070682_100012375 3300005337 Bacteria 4892
15 Ga0068868_100029319 3300005338 Bacteria 4213
16 Ga0070689_100200090 3300005340 Bacteria 1631
17 Ga0070691_10023183 3300005341 Bacteria 2882
18 Ga0070692_10237083 3300005345 Bacteria 1086
19 Ga0070668_100020243 3300005347 Bacteria 5020
20 Ga0070668_100177313 3300005347 Bacteria 1739
21 Ga0070668_100345122 3300005347 Bacteria 1259
22 Ga0070668_100649408 3300005347 Bacteria 927
23 Ga0070669_100201202 3300005353 Bacteria 1567
24 Ga0070671_100000270 3300005355 Bacteria 35025
25 Ga0070671_100055571 3300005355 Bacteria 3293
26 Ga0070671_100289450 3300005355 Bacteria 1394
27 Ga0070659_100200627 3300005366 Bacteria 1642
28 Ga0070659_100340266 3300005366 Bacteria 1257
29 Ga0070667_100042501 3300005367 Bacteria 3814
30 Ga0070714_100011289 3300005435 Bacteria 7081
31 Ga0070714_100017807 3300005435 Bacteria 5761
32 Ga0070714_100480990 3300005435 Bacteria 1182
33 Ga0070713_100002323 3300005436 Bacteria 12391
34 Ga0070713_100073580 3300005436 Bacteria 2892
35 Ga0070713_100303482 3300005436 Bacteria 1470
36 Ga0070713_100606314 3300005436 Bacteria 1040
37 Ga0070710_10003790 3300005437 Bacteria 7145
38 Ga0070711_100010316 3300005439 Bacteria 5779
39 Ga0070711_100222863 3300005439 Bacteria 1467
40 Ga0070711_100357879 3300005439 Bacteria 1175
41 Ga0070700_100178433 3300005441 Bacteria 1476
42 Ga0070708_100537211 3300005445 Bacteria 1103
43 Ga0070663_100025445 3300005455 Bacteria 3996
44 Ga0070663_100031936 3300005455 Bacteria 3624
45 Ga0070681_10118220 3300005458 Bacteria 2587
46 Ga0070681_10150480 3300005458 Bacteria 2254
47 Ga0068867_100213567 3300005459 Bacteria 1551
48 Ga0070706_100087206 3300005467 Bacteria 2893
49 Ga0070698_100003928 3300005471 Bacteria 16346
50 Ga0070684_100029168 3300005535 Bacteria 4673
51 Ga0070684_100158058 3300005535 Bacteria 2055
52 Ga0070684_100195767 3300005535 Bacteria 1840
53 Ga0070684_100240828 3300005535 Bacteria 1653
54 Ga0070684_100427072 3300005535 Bacteria 1224
55 Ga0070672_100171252 3300005543 Bacteria 1806
56 Ga0070665_100003024 3300005548 Bacteria 18135
57 Ga0070665_100019927 3300005548 Bacteria 6736
58 Ga0070664_100137856 3300005564 Bacteria 2146
59 Ga0068857_100034998 3300005577 Bacteria 4445
60 Ga0068857_100110430 3300005577 Bacteria 2471
61 Ga0068857_100150174 3300005577 Bacteria 2110
62 Ga0068854_100070353 3300005578 Bacteria 2557
63 Ga0068856_100202714 3300005614 Bacteria 1998
64 Ga0068856_100557502 3300005614 Bacteria 1167
65 Ga0068856_100734408 3300005614 Bacteria 1007
66 Ga0070702_100131224 3300005615 Bacteria 1583
67 Ga0068852_100176551 3300005616 Bacteria 2006
68 Ga0068852_100203170 3300005616 Bacteria 1876
69 Ga0068859_100002377 3300005617 Bacteria 19158
70 Ga0068859_100376876 3300005617 Bacteria 1514
71 Ga0068866_10056181 3300005718 Bacteria 2024
72 Ga0068870_10075676 3300005840 Bacteria 1847
73 Ga0068863_100003700 3300005841 Bacteria 15116
74 Ga0068863_100004203 3300005841 Bacteria 14220
75 Ga0068863_100068275 3300005841 Bacteria 3363
76 Ga0068863_100301163 3300005841 Bacteria 1555
77 Ga0068858_100009052 3300005842 Bacteria 9521
78 Ga0068858_100042384 3300005842 Bacteria 4220
79 Ga0068858_100048749 3300005842 Bacteria 3923
80 Ga0068860_100000632 3300005843 Bacteria 41515
81 Ga0068860_100024247 3300005843 Bacteria 5865
82 Ga0068862_100153141 3300005844 Bacteria 2053
83 Ga0081455_10281748 3300005937 Bacteria 1201
84 Ga0081539_10001194 3300005985 Bacteria 46877
85 Ga0081539_10194053 3300005985 Bacteria 943
86 Ga0070717_10147798 3300006028 Bacteria 2031
87 Ga0075363_100224101 3300006048 Bacteria 1078
88 Ga0070716_100012064 3300006173 Bacteria 4368
89 Ga0070716_100138066 3300006173 Bacteria 1550
90 Ga0070712_100194706 3300006175 Bacteria 1588
91 Ga0075370_10160773 3300006353 Bacteria 1318
92 Ga0075430_100109059 3300006846 Bacteria 2309
93 Ga0075434_100147859 3300006871 Bacteria 2370
94 Ga0075429_100220801 3300006880 Bacteria 1660
95 Ga0097620_100002300 3300006931 Bacteria 19403
96 Ga0097620_100002377 3300006931 Bacteria 19158
97 Ga0097620_100376886 3300006931 Bacteria 1514
98 Ga0075435_100350270 3300007076 Bacteria 1266
99 Ga0105250_10091021 3300009092 Bacteria 1240
100 Ga0105245_10872148 3300009098 Bacteria 941
101 Ga0105247_10000620 3300009101 Bacteria 28578
102 Ga0105247_10009726 3300009101 Bacteria 5831
103 Ga0114129_10499645 3300009147 Bacteria 1589
104 Ga0105238_10401317 3300009551 Bacteria 1364
105 Ga0105238_10532785 3300009551 Bacteria 1178
106 Ga0105238_10747769 3300009551 Bacteria 992
107 Ga0157370_10130851 3300013104 Bacteria 2340
108 Ga0157369_10084545 3300013105 Bacteria 3391
109 Ga0157369_10154468 3300013105 Bacteria 2425
110 Ga0157369_10279934 3300013105 Bacteria 1737
111 Ga0157369_10431125 3300013105 Bacteria 1366
112 Ga0157372_10161136 3300013307 Bacteria 2593
113 Ga0157372_10280584 3300013307 Bacteria 1937
114 Ga0157372_10463958 3300013307 Bacteria 1476
115 Ga0163163_10052859 3300014325 Bacteria 4009
116 Ga0157380_10626149 3300014326 Bacteria 1069
117 Ga0157379_10003408 3300014968 Bacteria 13446
118 Ga0157379_10071588 3300014968 Bacteria 3101
119 Ga0157379_10148621 3300014968 Bacteria 2113
120 Ga0163161_10037687 3300017792 Bacteria 3466
121 Ga0197907_11288439 3300020069 Bacteria 946
122 Ga0197907_11467779 3300020069 Bacteria 1308
123 Ga0206356_10367707 3300020070 Bacteria 1283
124 Ga0206356_10435524 3300020070 Bacteria 1246
125 Ga0206356_10814877 3300020070 Bacteria 1729
126 Ga0206351_10323364 3300020077 Bacteria 1243
127 Ga0206350_10359205 3300020080 Bacteria 1211
128 Ga0206350_10843837 3300020080 Bacteria 1077
129 Ga0206354_10044910 3300020081 Bacteria 3251
130 Ga0206354_11203322 3300020081 Bacteria 2299
131 Ga0206353_10960647 3300020082 Bacteria 2604
132 Ga0206353_11320048 3300020082 Bacteria 3068
133 Ga0206353_11421238 3300020082 Bacteria 6258
134 Ga0206353_11983092 3300020082 Bacteria 3251
135 Ga0154015_1055681 3300020610 Bacteria 909
136 Ga0213875_10044866 3300021388 Bacteria 2076
137 Ga0224712_10012855 3300022467 Bacteria 2649
138 Ga0224712_10016386 3300022467 Bacteria 2434
139 Ga0224712_10054499 3300022467 Bacteria 1570
140 Ga0207642_10158843 3300025899 Bacteria 1212
141 Ga0207710_10000008 3300025900 Bacteria 485312
142 Ga0207710_10003363 3300025900 Bacteria 7150
143 Ga0207688_10006980 3300025901 Bacteria 6145
144 Ga0207680_10001761 3300025903 Bacteria 10223
145 Ga0207699_10002136 3300025906 Bacteria 9357
146 Ga0207699_10052787 3300025906 Bacteria 2408
147 Ga0207705_10094230 3300025909 Bacteria 2195
148 Ga0207705_10106455 3300025909 Bacteria 2068
149 Ga0207705_10228073 3300025909 Bacteria 1416
150 Ga0207684_10074145 3300025910 Bacteria 2891
151 Ga0207684_10311512 3300025910 Bacteria 1357
152 Ga0207707_10089983 3300025912 Bacteria 2682
153 Ga0207707_10109009 3300025912 Bacteria 2421
154 Ga0207693_10040108 3300025915 Bacteria 3687
155 Ga0207663_10058532 3300025916 Bacteria 2433
156 Ga0207663_10191795 3300025916 Bacteria 1468
157 Ga0207649_10187618 3300025920 Bacteria 1452
158 Ga0207652_10035707 3300025921 Bacteria 4197
159 Ga0207652_10073818 3300025921 Bacteria 2968
160 Ga0207652_10109221 3300025921 Bacteria 2452
161 Ga0207694_10439815 3300025924 Bacteria 1088
162 Ga0207687_10042507 3300025927 Bacteria 3127
163 Ga0207700_10002503 3300025928 Bacteria 10532
164 Ga0207700_10008523 3300025928 Bacteria 6361
165 Ga0207700_10073198 3300025928 Bacteria 2645
166 Ga0207700_10194206 3300025928 Bacteria 1707
167 Ga0207700_10633546 3300025928 Bacteria 953
168 Ga0207700_10756420 3300025928 Bacteria 868
169 Ga0207664_10002153 3300025929 Bacteria 12944
170 Ga0207664_10018624 3300025929 Bacteria 5116
171 Ga0207664_10415019 3300025929 Bacteria 1198
172 Ga0207664_10590359 3300025929 Bacteria 997
173 Ga0207644_10009239 3300025931 Bacteria 6468
174 Ga0207644_10036775 3300025931 Bacteria 3439
175 Ga0207690_10414330 3300025932 Bacteria 1077
176 Ga0207665_10002913 3300025939 Bacteria 11475
177 Ga0207665_10030010 3300025939 Bacteria 3593
178 Ga0207691_10220133 3300025940 Bacteria 1646
179 Ga0207689_10083959 3300025942 Bacteria 2618
180 Ga0207661_10041422 3300025944 Bacteria 3626
181 Ga0207661_10046674 3300025944 Bacteria 3435
182 Ga0207661_10069907 3300025944 Bacteria 2864
183 Ga0207679_10099767 3300025945 Bacteria 2268
184 Ga0207668_10013546 3300025972 Bacteria 5026
185 Ga0207668_10056939 3300025972 Bacteria 2725
186 Ga0207668_10065565 3300025972 Bacteria 2571
187 Ga0207668_10228572 3300025972 Bacteria 1498
188 Ga0207640_10194547 3300025981 Bacteria 1531
189 Ga0207658_10102750 3300025986 Bacteria 2242
190 Ga0207677_10213636 3300026023 Bacteria 1542
191 Ga0207703_10000280 3300026035 Bacteria 56569
192 Ga0207703_10006130 3300026035 Bacteria 9623
193 Ga0207703_10080000 3300026035 Bacteria 2721
194 Ga0207678_10014634 3300026067 Bacteria 6904
195 Ga0207678_10023657 3300026067 Bacteria 5372
196 Ga0207702_10483711 3300026078 Bacteria 1205
197 Ga0207641_10002501 3300026088 Bacteria 16960
198 Ga0207641_10007845 3300026088 Bacteria 8864
199 Ga0207641_10009967 3300026088 Bacteria 7818
200 Ga0207648_10201723 3300026089 Bacteria 1764
201 Ga0207676_10808723 3300026095 Bacteria 915
202 Ga0207674_10012803 3300026116 Bacteria 9365
203 Ga0207674_10027440 3300026116 Bacteria 6022
204 Ga0207674_10047959 3300026116 Bacteria 4376
205 Ga0207674_10071426 3300026116 Bacteria 3487
206 Ga0207683_10024651 3300026121 Bacteria 5182
207 Ga0207698_10016939 3300026142 Bacteria 4930
208 Ga0268266_10001653 3300028379 Bacteria 25773
209 Ga0268266_10014404 3300028379 Bacteria 6798
210 Ga0268264_10000656 3300028381 Bacteria 40642
211 Ga0268264_10011970 3300028381 Bacteria 7143
212 Ga0265337_1000592 3300028556 Bacteria 19072
213 Ga0265326_10002134 3300028558 Bacteria 6736
214 Ga0265319_1004847 3300028563 Bacteria 6585
215 Ga0265334_10005273 3300028573 Bacteria 5654
216 Ga0265318_10003530 3300028577 Bacteria 7831
217 Ga0265323_10003256 3300028653 Bacteria 7236
218 Ga0307515_10149363 3300028794 Bacteria 2453
219 Ga0265338_10000215 3300028800 Bacteria 106645
220 Ga0265338_10002578 3300028800 Bacteria 26786
221 Ga0265338_10008895 3300028800 Bacteria 12094
222 Ga0265324_10000726 3300029957 Bacteria 21964
223 Ga0307511_10178766 3300030521 Bacteria 1148
224 Ga0265764_100012 3300030882 Bacteria 5170
225 Ga0265774_100402 3300031011 Bacteria 1236
226 Ga0265779_100091 3300031043 Bacteria 2831
227 Ga0265760_10005490 3300031090 Bacteria 3633
228 Ga0265332_10006440 3300031238 Bacteria 5326
229 Ga0265320_10014060 3300031240 Bacteria 4577
230 Ga0265325_10005795 3300031241 Bacteria 7575
231 Ga0265340_10000273 3300031247 Bacteria 26865
232 Ga0265339_10008815 3300031249 Bacteria 6384
233 Ga0265316_10014391 3300031344 Bacteria 6966
234 Ga0307513_10000085 3300031456 Bacteria 131110
235 Ga0307513_10189762 3300031456 Bacteria 1908
236 Ga0307408_100115707 3300031548 Bacteria 2068
237 Ga0307408_100500750 3300031548 Bacteria 1063
238 Ga0265313_10006318 3300031595 Bacteria 8431
239 Ga0265314_10005791 3300031711 Bacteria 11084
240 Ga0265342_10002178 3300031712 Bacteria 17221
241 Ga0307405_10167240 3300031731 Bacteria 1564
242 Ga0307405_10259805 3300031731 Bacteria 1296
243 Ga0307405_10528925 3300031731 Bacteria 950
244 Ga0307413_10039237 3300031824 Bacteria 2752
245 Ga0307413_10304213 3300031824 Bacteria 1211
246 Ga0307413_10476875 3300031824 Bacteria 996
247 Ga0307410_10050199 3300031852 Bacteria 2804
248 Ga0307410_10123362 3300031852 Bacteria 1892
249 Ga0307406_10124377 3300031901 Bacteria 1799
250 Ga0307406_10243930 3300031901 Bacteria 1349
251 Ga0307406_10325176 3300031901 Bacteria 1191
252 Ga0307406_10393262 3300031901 Bacteria 1096
253 Ga0307407_10033091 3300031903 Bacteria 2817
254 Ga0307407_10170020 3300031903 Bacteria 1434
255 Ga0307407_10316609 3300031903 Bacteria 1093
256 Ga0307407_10326588 3300031903 Bacteria 1078
257 Ga0307409_100015783 3300031995 Bacteria 4971
258 Ga0307409_100027582 3300031995 Bacteria 4027
259 Ga0307409_100044528 3300031995 Bacteria 3343
260 Ga0307409_100106495 3300031995 Bacteria 2340
261 Ga0307409_100304714 3300031995 Bacteria 1484
262 Ga0307409_100528711 3300031995 Bacteria 1153
263 Ga0307409_100548295 3300031995 Bacteria 1134
264 Ga0307416_100210946 3300032002 Bacteria 1852
265 Ga0307416_101119531 3300032002 Bacteria 892
266 Ga0307416_101162161 3300032002 Bacteria 877
267 Ga0307414_10033470 3300032004 Bacteria 3398
268 Ga0307414_10191514 3300032004 Bacteria 1655
269 Ga0307414_10567797 3300032004 Bacteria 1013
270 Ga0307411_10060765 3300032005 Bacteria 2512
271 Ga0307411_10201512 3300032005 Bacteria 1529
272 Ga0307411_10250691 3300032005 Bacteria 1392
273 Ga0307411_10519870 3300032005 Bacteria 1010
274 Ga0307411_10558890 3300032005 Bacteria 977
275 Ga0307415_100033772 3300032126 Bacteria 3322
276 Ga0307415_100051407 3300032126 Bacteria 2796
277 Ga0307415_100191765 3300032126 Bacteria 1613
278 Ga0307507_10027024 3300033179 Bacteria 6165
279 Ga0307510_10046895 3300033180 Bacteria 4639
280 Ga0316214_1000663 3300033545 Bacteria 3632
281 Ga0316212_1005423 3300033547 Bacteria 1854
282 Ga0373934_0043957 3300035086 Bacteria 1765
283 Ga0373944_0001171 3300035089 Bacteria 6542
284 Ga0373923_0002432 3300035111 Bacteria 5733
285 Ga0373945_0012098 3300035116 Bacteria 2861
286 Ga0373953_0034059 3300035117 Bacteria 1995
287 Ga0373954_0011996 3300035118 Bacteria 3849
288 Ga0373946_0012101 3300035171 Bacteria 3227
289 Ga0373946_0201295 3300035171 Bacteria 954
290 Ga0373955_0006981 3300035172 Bacteria 5168
291 Ga0373955_0044416 3300035172 Bacteria 2393
292 Ga0373924_0012985 3300035410 Bacteria 3122
293 Ga0373935_0031953 3300035692 Bacteria 3270
294 Ga0373935_0043686 3300035692 Bacteria 2821
295 Ga0373927_0047991 3300035695 Bacteria 2761
296 Ga0373933_0020299 3300035724 Bacteria 3765
297 Ga0373933_0467449 3300035724 Bacteria 825
298 Ga0373947_0007070 3300035725 Bacteria 6504
299 Ga0373937_0075909 3300036401 Bacteria 3103
300 Ga0373937_0077607 3300036401 Bacteria 3069
301 Ga0373937_0328841 3300036401 Bacteria 1446
302 Ga0373937_0740487 3300036401 Bacteria 930
303 Ga0373925_0000024 3300037068 Bacteria 155831
304 Ga0373925_0177852 3300037068 Bacteria 1682
305 Ga0395899_0244166 3300037312 Bacteria 1235
306 Ga0395900_0788643 3300037418 Bacteria 879
307 Ga0395898_0301886 3300037466 Bacteria 1527
308 Ga0395898_0354169 3300037466 Bacteria 1400
309 Ga0395898_0551160 3300037466 Bacteria 1095
310 Ga0395901_0003543 3300038443 Bacteria 15734
311 Ga0395901_0053770 3300038443 Bacteria 4184
312 Ga0395901_0448360 3300038443 Bacteria 1320
313 Ga0466969_0154450 3300044656 Bacteria 1056
314 Ga0466969_0163695 3300044656 Bacteria 1022
315 Ga0466965_0035986 3300044683 Bacteria 2428
316 Ga0466961_0036472 3300044693 Bacteria 3156
317 Ga0466963_0035419 3300044694 Bacteria 3252
318 Ga0466963_0045907 3300044694 Bacteria 2879
319 Ga0466963_0168649 3300044694 Bacteria 1525
320 Ga0466968_0191113 3300044735 Bacteria 955
321 Ga0466970_0275453 3300044765 Bacteria 946
322 Ga0466970_0297751 3300044765 Bacteria 909
323 Ga0466957_0086745 3300044842 Bacteria 1956
324 Ga0466957_0142519 3300044842 Bacteria 1545
325 Ga0466957_0214137 3300044842 Bacteria 1270
326 Ga0466960_0050813 3300044901 Bacteria 2000
327 Ga0466960_0198399 3300044901 Bacteria 1095
328 Ga0466959_0029557 3300045049 Bacteria 4061
329 Ga0466959_0114279 3300045049 Bacteria 1924
330 Ga0466958_0072986 3300045836 Bacteria 2102
331 Ga0466958_0128309 3300045836 Bacteria 1591
332 Ga0466958_0430882 3300045836 Bacteria 853
333 Ga0466958_0464166 3300045836 Bacteria 820
334 Ga0466958_0473653 3300045836 Bacteria 812
335 Ga0466967_0054673 3300045976 Bacteria 3515
336 Ga0466967_0134227 3300045976 Bacteria 2301
337 Ga0466967_0240635 3300045976 Bacteria 1726
338 Ga0466967_0266134 3300045976 Bacteria 1641
339 Ga0495592_0114028 3300046454 Bacteria 1909
340 Ga0495629_0011082 3300046459 Bacteria 6550
341 Ga0495641_0046419 3300046461 Bacteria 1997
342 Ga0495651_0034336 3300046462 Bacteria 3953
343 Ga0495653_0151328 3300046463 Bacteria 1621
344 Ga0495580_0032276 3300046472 Bacteria 3780
345 Ga0495582_0001010 3300046473 Bacteria 15775
346 Ga0495662_0001143 3300046476 Bacteria 13088
347 Ga0495664_0032390 3300046477 Bacteria 3066
348 Ga0495594_0228654 3300046499 Bacteria 1060
349 Ga0495594_0308250 3300046499 Bacteria 902
350 Ga0495608_0149430 3300046511 Bacteria 1489
351 Ga0495618_0022652 3300046514 Bacteria 3880
352 Ga0495630_0213956 3300046517 Bacteria 1471
353 Ga0495631_0056314 3300046518 Bacteria 1712
354 Ga0495632_0058608 3300046519 Bacteria 1876
355 Ga0495666_0023143 3300046526 Bacteria 3073
356 Ga0495652_0035207 3300046529 Bacteria 4358
357 Ga0495652_0095419 3300046529 Bacteria 2423
358 Ga0495652_0097586 3300046529 Bacteria 2390
359 Ga0495665_0011381 3300046531 Bacteria 4815
360 Ga0495640_0045904 3300046533 Bacteria 3030
361 Ga0495640_0234756 3300046533 Bacteria 1152
362 Ga0495586_0105691 3300046535 Bacteria 1565
363 Ga0495645_0029005 3300046543 Bacteria 4021
364 Ga0495645_0085915 3300046543 Bacteria 2251
365 Ga0495667_0024698 3300046559 Bacteria 4047
366 Ga0495667_0310895 3300046559 Bacteria 998
367 Ga0495668_0274947 3300046616 Bacteria 923
368 Ga0495634_0027002 3300046642 Bacteria 3999
369 Ga0495635_0018928 3300046663 Bacteria 4806
370 Ga0495635_0078336 3300046663 Bacteria 2262
371 Ga0495635_0119963 3300046663 Bacteria 1794
372 Ga0495657_0028915 3300046675 Bacteria 3891
373 Ga0495599_0112231 3300046678 Bacteria 1697
374 Ga0495646_0123304 3300046680 Bacteria 1464
375 Ga0495647_0012986 3300046681 Bacteria 2877
376 Ga0495613_0053241 3300046689 Bacteria 2978
377 Ga0495624_0029614 3300046690 Bacteria 3570
378 Ga0495600_0029821 3300046809 Bacteria 3533
379 Ga0495581_0004889 3300047315 Bacteria 7750
380 Ga0495581_0027988 3300047315 Bacteria 3268
381 Ga0495581_0258653 3300047315 Bacteria 1018
382 Ga0495604_0004918 3300047317 Bacteria 10596
383 Ga0495604_0038604 3300047317 Bacteria 3756
384 Ga0495604_0340179 3300047317 Bacteria 999
385 Ga0495674_0034777 3300047319 Bacteria 4552
386 Ga0495676_0085249 3300047321 Bacteria 2380
387 Ga0495680_0003184 3300047322 Bacteria 16333
388 Ga0495680_0066002 3300047322 Bacteria 2770
389 Ga0495675_0014053 3300047444 Bacteria 5060
390 Ga0495675_0038898 3300047444 Bacteria 3029
391 Ga0495684_0071480 3300047471 Bacteria 2636
392 Ga0495593_0011950 3300047673 Bacteria 4976
393 Ga0495602_0071734 3300048088 Bacteria 2956
394 Ga0495602_0525775 3300048088 Bacteria 823
395 Ga0495614_0023805 3300048089 Bacteria 2643
396 Ga0496101_0328975 3300048904 Bacteria 1199
397 Ga0496102_0005461 3300048905 Bacteria 10782
398 Ga0496102_0027058 3300048905 Bacteria 5121
399 Ga0496102_0293688 3300048905 Bacteria 1532
400 Ga0496102_0659300 3300048905 Bacteria 970
401 Ga0496103_0000452 3300048906 Bacteria 34999
402 Ga0496104_0012644 3300048907 Bacteria 7599
403 Ga0496105_0003349 3300048908 Bacteria 11843
404 Ga0496105_0155852 3300048908 Bacteria 1876
405 Ga0496106_0022060 3300048909 Bacteria 4729
406 Ga0496108_0357011 3300048911 Bacteria 1275
407 Ga0496109_0142928 3300048912 Bacteria 2238
408 Ga0496109_0344381 3300048912 Bacteria 1408
409 Ga0496111_0242306 3300048914 Bacteria 1339
410 Ga0496112_0313521 3300048915 Bacteria 1514
411 Ga0496112_0449255 3300048915 Bacteria 1227
412 Ga0496116_0000164 3300048919 Bacteria 133731
413 Ga0496117_0009027 3300048920 Bacteria 9373
414 Ga0496118_0001005 3300048921 Bacteria 43925
415 Ga0496118_0024078 3300048921 Bacteria 5267
416 Ga0496119_0002514 3300048922 Bacteria 20017
417 Ga0496119_0006792 3300048922 Bacteria 10490
418 Ga0496119_0022776 3300048922 Bacteria 4470
419 Ga0496119_0028212 3300048922 Bacteria 3837
420 Ga0496119_0070024 3300048922 Bacteria 2059
421 Ga0496120_0006816 3300048923 Bacteria 8655
422 Ga0496121_0032311 3300048924 Bacteria 4761
423 Ga0496121_0038638 3300048924 Bacteria 4220
424 Ga0496126_0026359 3300048929 Bacteria 5575
425 Ga0496126_0334049 3300048929 Bacteria 1243
426 Ga0501317_015346 3300049533 Bacteria 981
427 Ga0501031_0217109 3300049568 Bacteria 1246
428 Ga0501040_0160528 3300049576 Bacteria 1589
429 Ga0501047_0000015 3300049581 Bacteria 307932
430 nmdc:mga07m45_269220_c1 3300050496 Unclassified 991
431 nmdc:mga09592_161290_c1 3300050508 Bacteria 1937
432 nmdc:mga09592_49367_c1 3300050508 Bacteria 3547
433 nmdc:mga0qj67_247627_c1 3300050509 Bacteria 1446
434 nmdc:mga0n895_285917_c1 3300050512 Bacteria 1672
435 nmdc:mga0rr50_118806_c1 3300050513 Bacteria 2101
436 Ga0495601_0018260 3300053077 Bacteria 4266
437 Ga0495612_0013560 3300053078 Bacteria 3282
438 Ga0495595_0032117 3300053084 Bacteria 2363
439 Ga0495619_0009084 3300053085 Bacteria 6272
440 Ga0500604_0060392 3300053151 Bacteria 1189
441 Ga0500616_0000160 3300053153 Bacteria 111647
442 Ga0500616_0000579 3300053153 Bacteria 44555
443 Ga0466962_0072906 3300061719 Bacteria 1640
444 2517759117 2517572101 Bacteria 6884336
445 2623498385 2622736605 Bacteria 4992138
446 2623500791 2622736605 Bacteria 4992138
447 2626638449 2626541554 Bacteria 7741902
448 2671833193 2671180195 Bacteria 9757215
449 2671835979 2671180195 Bacteria 9757215
450 2676479411 2675903059 Bacteria 8644972
451 2686536902 2684623035 Bacteria 8032739
452 2689994189 2687453743 Bacteria 8361025
453 2739231019 2738543010 Bacteria 5583595
454 2774851349 2773857922 Bacteria 9757215
455 2774854135 2773857922 Bacteria 9757215
456 2795785453 2795385470 Bacteria 8317180
457 2816507308 2816332139 Bacteria 9138787
458 2866614640 2866612099 Bacteria 7543886
459 2895884037 2895880812 Bacteria 11255272
460 2899368248 2899359706 Bacteria 10940472
461 2899372546 2899370129 Bacteria 6781179
462 2917740799 2917736166 Bacteria 9690793
463 8002789783 8002784119 Bacteria 9788632
464 8025483817 8025478263 Bacteria 8209203
465 8056210701 8056207758 Bacteria 8639239
466 Ga0466967_0124070
467 JGI25406J46586_10010569
468 Ga0070658_10103876
469 Ga0070658_10131652
470 Ga0070658_10286902
471 Ga0070658_10442342
472 Ga0070683_100007875
473 Ga0070683_100077856
474 Ga0070683_100153543
475 Ga0070683_100201163
476 Ga0070683_100293555
477 Ga0070680_100144334
478 Ga0070680_100529008
479 Ga0070682_100012375
480 Ga0068868_100029319
481 Ga0070689_100200090
482 Ga0070691_10023183
483 Ga0070692_10237083
484 Ga0070668_100020243
485 Ga0070668_100177313
486 Ga0070668_100345122
487 Ga0070668_100649408
488 Ga0070669_100201202
489 Ga0070671_100000270
490 Ga0070671_100055571
491 Ga0070671_100289450
492 Ga0070659_100200627
493 Ga0070659_100340266
494 Ga0070667_100042501
495 Ga0070714_100011289
496 Ga0070714_100017807
497 Ga0070714_100480990
498 Ga0070713_100002323
499 Ga0070713_100073580
500 Ga0070713_100303482
501 Ga0070713_100606314
502 Ga0070710_10003790
503 Ga0070711_100010316
504 Ga0070711_100222863
505 Ga0070711_100357879
506 Ga0070700_100178433
507 Ga0070708_100537211
508 Ga0070663_100025445
509 Ga0070663_100031936
510 Ga0070681_10118220
511 Ga0070681_10150480
512 Ga0068867_100213567
513 Ga0070706_100087206
514 Ga0070698_100003928
515 Ga0070684_100029168
516 Ga0070684_100158058
517 Ga0070684_100195767
518 Ga0070684_100240828
519 Ga0070684_100427072
520 Ga0070672_100171252
521 Ga0070665_100003024
522 Ga0070665_100019927
523 Ga0070664_100137856
524 Ga0068857_100034998
525 Ga0068857_100110430
526 Ga0068857_100150174
527 Ga0068854_100070353
528 Ga0068856_100202714
529 Ga0068856_100557502
530 Ga0068856_100734408
531 Ga0070702_100131224
532 Ga0068852_100176551
533 Ga0068852_100203170
534 Ga0068859_100002377
535 Ga0068859_100376876
536 Ga0068866_10056181
537 Ga0068870_10075676
538 Ga0068863_100003700
539 Ga0068863_100004203
540 Ga0068863_100068275
541 Ga0068863_100301163
542 Ga0068858_100009052
543 Ga0068858_100042384
544 Ga0068858_100048749
545 Ga0068860_100000632
546 Ga0068860_100024247
547 Ga0068862_100153141
548 Ga0081455_10281748
549 Ga0081539_10001194
550 Ga0081539_10194053
551 Ga0070717_10147798
552 Ga0075363_100224101
553 Ga0070716_100012064
554 Ga0070716_100138066
555 Ga0070712_100194706
556 Ga0075370_10160773
557 Ga0075430_100109059
558 Ga0075434_100147859
559 Ga0075429_100220801
560 Ga0097620_100002300
561 Ga0097620_100002377
562 Ga0097620_100376886
563 Ga0075435_100350270
564 Ga0105250_10091021
565 Ga0105245_10872148
566 Ga0105247_10000620
567 Ga0105247_10009726
568 Ga0114129_10499645
569 Ga0105238_10401317
570 Ga0105238_10532785
571 Ga0105238_10747769
572 Ga0157370_10130851
573 Ga0157369_10084545
574 Ga0157369_10154468
575 Ga0157369_10279934
576 Ga0157369_10431125
577 Ga0157372_10161136
578 Ga0157372_10280584
579 Ga0157372_10463958
580 Ga0163163_10052859
581 Ga0157380_10626149
582 Ga0157379_10003408
583 Ga0157379_10071588
584 Ga0157379_10148621
585 Ga0163161_10037687
586 Ga0197907_11288439
587 Ga0197907_11467779
588 Ga0206356_10367707
589 Ga0206356_10435524
590 Ga0206356_10814877
591 Ga0206351_10323364
592 Ga0206350_10359205
593 Ga0206350_10843837
594 Ga0206354_10044910
595 Ga0206354_11203322
596 Ga0206353_10960647
597 Ga0206353_11320048
598 Ga0206353_11421238
599 Ga0206353_11983092
600 Ga0154015_1055681
601 Ga0213875_10044866
602 Ga0224712_10012855
603 Ga0224712_10016386
604 Ga0224712_10054499
605 Ga0207642_10158843
606 Ga0207710_10000008
607 Ga0207710_10003363
608 Ga0207688_10006980
609 Ga0207680_10001761
610 Ga0207699_10002136
611 Ga0207699_10052787
612 Ga0207705_10094230
613 Ga0207705_10106455
614 Ga0207705_10228073
615 Ga0207684_10074145
616 Ga0207684_10311512
617 Ga0207707_10089983
618 Ga0207707_10109009
619 Ga0207693_10040108
620 Ga0207663_10058532
621 Ga0207663_10191795
622 Ga0207649_10187618
623 Ga0207652_10035707
624 Ga0207652_10073818
625 Ga0207652_10109221
626 Ga0207694_10439815
627 Ga0207687_10042507
628 Ga0207700_10002503
629 Ga0207700_10008523
630 Ga0207700_10073198
631 Ga0207700_10194206
632 Ga0207700_10633546
633 Ga0207700_10756420
634 Ga0207664_10002153
635 Ga0207664_10018624
636 Ga0207664_10415019
637 Ga0207664_10590359
638 Ga0207644_10009239
639 Ga0207644_10036775
640 Ga0207690_10414330
641 Ga0207665_10002913
642 Ga0207665_10030010
643 Ga0207691_10220133
644 Ga0207689_10083959
645 Ga0207661_10041422
646 Ga0207661_10046674
647 Ga0207661_10069907
648 Ga0207679_10099767
649 Ga0207668_10013546
650 Ga0207668_10056939
651 Ga0207668_10065565
652 Ga0207668_10228572
653 Ga0207640_10194547
654 Ga0207658_10102750
655 Ga0207677_10213636
656 Ga0207703_10000280
657 Ga0207703_10006130
658 Ga0207703_10080000
659 Ga0207678_10014634
660 Ga0207678_10023657
661 Ga0207702_10483711
662 Ga0207641_10002501
663 Ga0207641_10007845
664 Ga0207641_10009967
665 Ga0207648_10201723
666 Ga0207676_10808723
667 Ga0207674_10012803
668 Ga0207674_10027440
669 Ga0207674_10047959
670 Ga0207674_10071426
671 Ga0207683_10024651
672 Ga0207698_10016939
673 Ga0268266_10001653
674 Ga0268266_10014404
675 Ga0268264_10000656
676 Ga0268264_10011970
677 Ga0265337_1000592
678 Ga0265326_10002134
679 Ga0265319_1004847
680 Ga0265334_10005273
681 Ga0265318_10003530
682 Ga0265323_10003256
683 Ga0307515_10149363
684 Ga0265338_10000215
685 Ga0265338_10002578
686 Ga0265338_10008895
687 Ga0265324_10000726
688 Ga0307511_10178766
689 Ga0265764_100012
690 Ga0265774_100402
691 Ga0265779_100091
692 Ga0265760_10005490
693 Ga0265332_10006440
694 Ga0265320_10014060
695 Ga0265325_10005795
696 Ga0265340_10000273
697 Ga0265339_10008815
698 Ga0265316_10014391
699 Ga0307513_10000085
700 Ga0307513_10189762
701 Ga0307408_100115707
702 Ga0307408_100500750
703 Ga0265313_10006318
704 Ga0265314_10005791
705 Ga0265342_10002178
706 Ga0307405_10167240
707 Ga0307405_10259805
708 Ga0307405_10528925
709 Ga0307413_10039237
710 Ga0307413_10304213
711 Ga0307413_10476875
712 Ga0307410_10050199
713 Ga0307410_10123362
714 Ga0307406_10124377
715 Ga0307406_10243930
716 Ga0307406_10325176
717 Ga0307406_10393262
718 Ga0307407_10033091
719 Ga0307407_10170020
720 Ga0307407_10316609
721 Ga0307407_10326588
722 Ga0307409_100015783
723 Ga0307409_100027582
724 Ga0307409_100044528
725 Ga0307409_100106495
726 Ga0307409_100304714
727 Ga0307409_100528711
728 Ga0307409_100548295
729 Ga0307416_100210946
730 Ga0307416_101119531
731 Ga0307416_101162161
732 Ga0307414_10033470
733 Ga0307414_10191514
734 Ga0307414_10567797
735 Ga0307411_10060765
736 Ga0307411_10201512
737 Ga0307411_10250691
738 Ga0307411_10519870
739 Ga0307411_10558890
740 Ga0307415_100033772
741 Ga0307415_100051407
742 Ga0307415_100191765
743 Ga0307507_10027024
744 Ga0307510_10046895
745 Ga0316214_1000663
746 Ga0316212_1005423
747 Ga0373934_0043957
748 Ga0373944_0001171
749 Ga0373923_0002432
750 Ga0373945_0012098
751 Ga0373953_0034059
752 Ga0373954_0011996
753 Ga0373946_0012101
754 Ga0373946_0201295
755 Ga0373955_0006981
756 Ga0373955_0044416
757 Ga0373924_0012985
758 Ga0373935_0031953
759 Ga0373935_0043686
760 Ga0373927_0047991
761 Ga0373933_0020299
762 Ga0373933_0467449
763 Ga0373947_0007070
764 Ga0373937_0075909
765 Ga0373937_0077607
766 Ga0373937_0328841
767 Ga0373937_0740487
768 Ga0373925_0000024
769 Ga0373925_0177852
770 Ga0395899_0244166
771 Ga0395900_0788643
772 Ga0395898_0301886
773 Ga0395898_0354169
774 Ga0395898_0551160
775 Ga0395901_0003543
776 Ga0395901_0053770
777 Ga0395901_0448360
778 Ga0466969_0154450
779 Ga0466969_0163695
780 Ga0466965_0035986
781 Ga0466961_0036472
782 Ga0466963_0035419
783 Ga0466963_0045907
784 Ga0466963_0168649
785 Ga0466968_0191113
786 Ga0466970_0275453
787 Ga0466970_0297751
788 Ga0466957_0086745
789 Ga0466957_0142519
790 Ga0466957_0214137
791 Ga0466960_0050813
792 Ga0466960_0198399
793 Ga0466959_0029557
794 Ga0466959_0114279
795 Ga0466958_0072986
796 Ga0466958_0128309
797 Ga0466958_0430882
798 Ga0466958_0464166
799 Ga0466958_0473653
800 Ga0466967_0054673
801 Ga0466967_0134227
802 Ga0466967_0240635
803 Ga0466967_0266134
804 Ga0495592_0114028
805 Ga0495629_0011082
806 Ga0495641_0046419
807 Ga0495651_0034336
808 Ga0495653_0151328
809 Ga0495580_0032276
810 Ga0495582_0001010
811 Ga0495662_0001143
812 Ga0495664_0032390
813 Ga0495594_0228654
814 Ga0495594_0308250
815 Ga0495608_0149430
816 Ga0495618_0022652
817 Ga0495630_0213956
818 Ga0495631_0056314
819 Ga0495632_0058608
820 Ga0495666_0023143
821 Ga0495652_0035207
822 Ga0495652_0095419
823 Ga0495652_0097586
824 Ga0495665_0011381
825 Ga0495640_0045904
826 Ga0495640_0234756
827 Ga0495586_0105691
828 Ga0495645_0029005
829 Ga0495645_0085915
830 Ga0495667_0024698
831 Ga0495667_0310895
832 Ga0495668_0274947
833 Ga0495634_0027002
834 Ga0495635_0018928
835 Ga0495635_0078336
836 Ga0495635_0119963
837 Ga0495657_0028915
838 Ga0495599_0112231
839 Ga0495646_0123304
840 Ga0495647_0012986
841 Ga0495613_0053241
842 Ga0495624_0029614
843 Ga0495600_0029821
844 Ga0495581_0004889
845 Ga0495581_0027988
846 Ga0495581_0258653
847 Ga0495604_0004918
848 Ga0495604_0038604
849 Ga0495604_0340179
850 Ga0495674_0034777
851 Ga0495676_0085249
852 Ga0495680_0003184
853 Ga0495680_0066002
854 Ga0495675_0014053
855 Ga0495675_0038898
856 Ga0495684_0071480
857 Ga0495593_0011950
858 Ga0495602_0071734
859 Ga0495602_0525775
860 Ga0495614_0023805
861 Ga0496101_0328975
862 Ga0496102_0005461
863 Ga0496102_0027058
864 Ga0496102_0293688
865 Ga0496102_0659300
866 Ga0496103_0000452
867 Ga0496104_0012644
868 Ga0496105_0003349
869 Ga0496105_0155852
870 Ga0496106_0022060
871 Ga0496108_0357011
872 Ga0496109_0142928
873 Ga0496109_0344381
874 Ga0496111_0242306
875 Ga0496112_0313521
876 Ga0496112_0449255
877 Ga0496116_0000164
878 Ga0496117_0009027
879 Ga0496118_0001005
880 Ga0496118_0024078
881 Ga0496119_0002514
882 Ga0496119_0006792
883 Ga0496119_0022776
884 Ga0496119_0028212
885 Ga0496119_0070024
886 Ga0496120_0006816
887 Ga0496121_0032311
888 Ga0496121_0038638
889 Ga0496126_0026359
890 Ga0496126_0334049
891 Ga0501317_015346
892 Ga0501031_0217109
893 Ga0501040_0160528
894 Ga0501047_0000015
895 nmdc:mga07m45_269220_c1
896 nmdc:mga09592_161290_c1
897 nmdc:mga09592_49367_c1
898 nmdc:mga0qj67_247627_c1
899 nmdc:mga0n895_285917_c1
900 nmdc:mga0rr50_118806_c1
901 Ga0495601_0018260
902 Ga0495612_0013560
903 Ga0495595_0032117
904 Ga0495619_0009084
905 Ga0500604_0060392
906 Ga0500616_0000160
907 Ga0500616_0000579
908 Ga0466962_0072906
909 2517759117
910 2623498385
911 2623500791
912 2626638449
913 2671833193
914 2671835979
915 2676479411
916 2686536902
917 2689994189
918 2739231019
919 2774851349
920 2774854135
921 2795785453
922 2816507308
923 2866614640
924 2895884037
925 2899368248
926 2899372546
927 2917740799
928 8002789783
929 8025483817
930 8056210701

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

8

193

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

14

245

0.97

PF08659

KR

KR domain

9

177

0.88

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

10

156

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pcs-assembly1.cif.gz_D structure of the heterotetrameric sdr family member bbscd 0.9562 4 248
7pcs-assembly1.cif.gz_C structure of the heterotetrameric sdr family member bbscd 0.9549 5 248
6t6p-assembly1.cif.gz_A crystal structure of klebsiella pneumoniae fabg2(nadh-dependent) at 1.57 a resolution 0.9539 5 248
4cqm-assembly2.cif.gz_C crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9512 5 248
7tzp-assembly3.cif.gz_G crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. pneumoniae ntuh-k2044 in complex with nadh 0.951 5 248
ID Description Score Start End Superfamily
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9525 5 245 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9517 5 179 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9499 5 79 3.40.50.720
2et6A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.944 5 248 3.40.50.720
3ftpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9438 2 248 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7C4DJX8-F1-model_v4 SDR family oxidoreductase 0.9634 7 198
AF-A0A3D4A6D1-F1-model_v4 Ketoacyl reductase 0.962 5 190 GO:0016020
GO:0016491
AF-A0A562VFE8-F1-model_v4 Short subunit dehydrogenase 0.9581 5 124
AF-A0A3N2GPN5-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase 0.956 4 248 GO:0016491
AF-A0A7X3R6H7-F1-model_v4 SDR family oxidoreductase 0.9556 5 186 GO:0016020
GO:0016491

Map