F449522

General Info

Members Datasets Scaffolds Average Seq Length
465 224 930 73

Family's Representative Sequence

Representative Sequence 3300042000|Ga0439437_017586|Ga0439437_017586_521_784
Length 68
Sequence MAKEQKTNKAEDLKGKSPDELNAMLIDLRKQQLNMRFQRAGGTLENTSEMRKVRRTIARVKTVLNQQA

Samples

Sample ID Description Type Environment
1 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
73 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
74 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
152 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
153 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
154 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
155 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
156 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
157 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
158 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
159 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
160 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
161 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
162 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
163 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
164 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
171 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
172 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
173 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
174 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
179 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
212 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
213 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
214 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
215 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
221 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
222 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.27
Metatranscriptomes 4.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.95
Nodule 0
Rhizoplane 4.09
Rhizosphere 90.97
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439437_017586 3300042000 Unclassified 850
2 JGI24739J22299_10099339 3300001989 Bacteria 879
3 JGI24738J21930_10027584 3300002075 Bacteria 1164
4 JGI24744J21845_10103561 3300002077 Bacteria 526
5 JGI24033J26618_1046317 3300002155 Bacteria 616
6 Ga0058863_10693721 3300004799 Bacteria 590
7 Ga0065712_10155000 3300005290 Bacteria 1341
8 Ga0065712_10327270 3300005290 Bacteria 819
9 Ga0065715_10249216 3300005293 Bacteria 1173
10 Ga0065715_10583706 3300005293 Bacteria 718
11 Ga0065715_10610176 3300005293 Bacteria 702
12 Ga0070658_11148008 3300005327 Bacteria 675
13 Ga0070676_10078650 3300005328 Bacteria 1995
14 Ga0070676_10342605 3300005328 Bacteria 1025
15 Ga0070676_10507378 3300005328 Bacteria 857
16 Ga0070683_102115168 3300005329 Bacteria 541
17 Ga0070670_100094293 3300005331 Bacteria 2574
18 Ga0070677_10064728 3300005333 Bacteria 1519
19 Ga0070677_10183277 3300005333 Bacteria 999
20 Ga0070677_10335713 3300005333 Bacteria 778
21 Ga0068869_101954430 3300005334 Bacteria 526
22 Ga0070666_10058140 3300005335 Bacteria 2614
23 Ga0070666_10152132 3300005335 Bacteria 1614
24 Ga0070666_10320059 3300005335 Bacteria 1106
25 Ga0070666_10498256 3300005335 Bacteria 883
26 Ga0070680_100567104 3300005336 Bacteria 973
27 Ga0070682_100055962 3300005337 Bacteria 2479
28 Ga0070660_100235491 3300005339 Bacteria 1490
29 Ga0070660_100317858 3300005339 Bacteria 1278
30 Ga0070687_100054716 3300005343 Bacteria 2081
31 Ga0070661_100274858 3300005344 Bacteria 1305
32 Ga0070661_100281337 3300005344 Bacteria 1290
33 Ga0070661_101003118 3300005344 Bacteria 692
34 Ga0070661_101068680 3300005344 Bacteria 671
35 Ga0070668_100166462 3300005347 Bacteria 1792
36 Ga0070668_101217789 3300005347 Bacteria 682
37 Ga0070668_101870119 3300005347 Bacteria 553
38 Ga0070669_100477131 3300005353 Bacteria 1031
39 Ga0070669_100724052 3300005353 Bacteria 841
40 Ga0070669_100801210 3300005353 Bacteria 801
41 Ga0070675_100048237 3300005354 Bacteria 3491
42 Ga0070675_100070917 3300005354 Bacteria 2889
43 Ga0070675_100136010 3300005354 Bacteria 2097
44 Ga0070675_100549311 3300005354 Bacteria 1044
45 Ga0070671_100431944 3300005355 Bacteria 1128
46 Ga0070671_100586924 3300005355 Bacteria 962
47 Ga0070671_100830231 3300005355 Bacteria 805
48 Ga0070671_101650669 3300005355 Bacteria 568
49 Ga0070674_100167258 3300005356 Bacteria 1673
50 Ga0070674_100288610 3300005356 Bacteria 1303
51 Ga0070674_100926015 3300005356 Bacteria 761
52 Ga0070674_101453562 3300005356 Bacteria 615
53 Ga0070673_100197404 3300005364 Bacteria 1731
54 Ga0070673_100393058 3300005364 Bacteria 1238
55 Ga0070673_100836082 3300005364 Bacteria 851
56 Ga0070673_100849942 3300005364 Bacteria 844
57 Ga0070673_101514793 3300005364 Bacteria 633
58 Ga0070659_100207119 3300005366 Bacteria 1615
59 Ga0070659_100242409 3300005366 Bacteria 1492
60 Ga0070659_100372483 3300005366 Bacteria 1201
61 Ga0070659_100406096 3300005366 Bacteria 1151
62 Ga0070659_102169909 3300005366 Bacteria 500
63 Ga0070667_100105612 3300005367 Bacteria 2437
64 Ga0070667_100274832 3300005367 Bacteria 1511
65 Ga0070667_100331074 3300005367 Bacteria 1376
66 Ga0070667_100740877 3300005367 Bacteria 910
67 Ga0070667_101763307 3300005367 Bacteria 582
68 Ga0070708_100271215 3300005445 Bacteria 1596
69 Ga0070663_100352780 3300005455 Bacteria 1191
70 Ga0070663_100709709 3300005455 Bacteria 855
71 Ga0070678_100812468 3300005456 Bacteria 850
72 Ga0070678_101577233 3300005456 Bacteria 616
73 Ga0070662_100054942 3300005457 Bacteria 2887
74 Ga0070662_100125769 3300005457 Bacteria 1970
75 Ga0070662_100348057 3300005457 Bacteria 1213
76 Ga0070662_100365666 3300005457 Bacteria 1184
77 Ga0070681_10761364 3300005458 Bacteria 885
78 Ga0068867_100252891 3300005459 Bacteria 1433
79 Ga0068867_101027929 3300005459 Bacteria 749
80 Ga0068867_101212444 3300005459 Bacteria 693
81 Ga0068867_102101306 3300005459 Bacteria 535
82 Ga0070685_10429520 3300005466 Bacteria 921
83 Ga0070699_100375517 3300005518 Bacteria 1283
84 Ga0070679_100084951 3300005530 Bacteria 3152
85 Ga0070697_101825858 3300005536 Bacteria 544
86 Ga0070672_100029768 3300005543 Bacteria 4097
87 Ga0070672_100398475 3300005543 Bacteria 1179
88 Ga0070672_100755583 3300005543 Bacteria 853
89 Ga0070686_101174616 3300005544 Bacteria 637
90 Ga0070696_100665105 3300005546 Bacteria 846
91 Ga0070665_100043393 3300005548 Bacteria 4519
92 Ga0070665_100111059 3300005548 Bacteria 2744
93 Ga0070665_100464752 3300005548 Bacteria 1275
94 Ga0070665_100478823 3300005548 Bacteria 1255
95 Ga0068855_100341685 3300005563 Bacteria 1650
96 Ga0070664_100026594 3300005564 Bacteria 4801
97 Ga0070664_100070110 3300005564 Bacteria 3001
98 Ga0070664_101234403 3300005564 Bacteria 705
99 Ga0070664_101927755 3300005564 Bacteria 561
100 Ga0068857_100490878 3300005577 Bacteria 1151
101 Ga0068857_100714810 3300005577 Bacteria 952
102 Ga0068854_100178480 3300005578 Bacteria 1657
103 Ga0068854_100189556 3300005578 Bacteria 1610
104 Ga0068854_100339428 3300005578 Bacteria 1226
105 Ga0068856_101864336 3300005614 Bacteria 612
106 Ga0070702_100587653 3300005615 Bacteria 833
107 Ga0068852_100412083 3300005616 Bacteria 1331
108 Ga0068859_100176135 3300005617 Bacteria 2220
109 Ga0068864_100100283 3300005618 Bacteria 2566
110 Ga0068870_10048181 3300005840 Bacteria 2243
111 Ga0068870_10714633 3300005840 Bacteria 692
112 Ga0068863_100030104 3300005841 Bacteria 5185
113 Ga0068863_101374760 3300005841 Bacteria 713
114 Ga0068862_100178721 3300005844 Bacteria 1903
115 Ga0068862_101765688 3300005844 Bacteria 627
116 Ga0075363_100197142 3300006048 Bacteria 1150
117 Ga0075363_100344168 3300006048 Bacteria 870
118 Ga0075364_10024908 3300006051 Bacteria 3804
119 Ga0075364_10866717 3300006051 Bacteria 615
120 Ga0075362_10010315 3300006177 Bacteria 3644
121 Ga0075362_10031458 3300006177 Bacteria 2296
122 Ga0075366_10053468 3300006195 Bacteria 2399
123 Ga0075366_10322441 3300006195 Bacteria 947
124 Ga0075370_10049359 3300006353 Bacteria 2386
125 Ga0068871_100681516 3300006358 Bacteria 940
126 Ga0068871_100707881 3300006358 Bacteria 923
127 Ga0068871_101687665 3300006358 Bacteria 601
128 Ga0068865_100719844 3300006881 Bacteria 854
129 Ga0075436_100289425 3300006914 Bacteria 1172
130 Ga0097620_100176136 3300006931 Bacteria 2220
131 Ga0105240_11187584 3300009093 Bacteria 808
132 Ga0105243_10392213 3300009148 Bacteria 1287
133 Ga0105243_10871297 3300009148 Bacteria 893
134 Ga0105243_12963795 3300009148 Bacteria 515
135 Ga0105241_11756006 3300009174 Bacteria 604
136 Ga0105242_12388995 3300009176 Bacteria 576
137 Ga0105248_10221513 3300009177 Bacteria 2130
138 Ga0105249_10133308 3300009553 Bacteria 2374
139 Ga0105249_10267839 3300009553 Bacteria 1701
140 Ga0105249_12369422 3300009553 Bacteria 603
141 Ga0105239_12323613 3300010375 Bacteria 624
142 Ga0105246_10162779 3300011119 Bacteria 1701
143 Ga0157343_1009480 3300012488 Bacteria 720
144 Ga0157316_1039418 3300012510 Bacteria 609
145 Ga0157327_1026809 3300012512 Bacteria 692
146 Ga0157373_10196666 3300013100 Bacteria 1421
147 Ga0157373_10517864 3300013100 Bacteria 863
148 Ga0163162_12422386 3300013306 Bacteria 603
149 Ga0157372_10833560 3300013307 Bacteria 1071
150 Ga0157375_10077381 3300013308 Bacteria 3356
151 Ga0157375_11270402 3300013308 Bacteria 865
152 Ga0157375_12761512 3300013308 Bacteria 587
153 Ga0157380_11653539 3300014326 Bacteria 697
154 Ga0163161_10208320 3300017792 Bacteria 1509
155 Ga0163161_10664619 3300017792 Bacteria 864
156 Ga0207666_1007694 3300025271 Bacteria 1425
157 Ga0207673_1055421 3300025290 Bacteria 563
158 Ga0207697_10468689 3300025315 Bacteria 558
159 Ga0207682_10004483 3300025893 Bacteria 5825
160 Ga0207682_10079304 3300025893 Bacteria 1404
161 Ga0207688_10238346 3300025901 Bacteria 1100
162 Ga0207688_10510324 3300025901 Bacteria 753
163 Ga0207680_10519736 3300025903 Bacteria 849
164 Ga0207680_10532285 3300025903 Bacteria 838
165 Ga0207645_10133680 3300025907 Bacteria 1615
166 Ga0207645_10212090 3300025907 Bacteria 1276
167 Ga0207645_10215681 3300025907 Bacteria 1264
168 Ga0207643_10511409 3300025908 Bacteria 768
169 Ga0207705_10198088 3300025909 Bacteria 1521
170 Ga0207654_10997271 3300025911 Bacteria 609
171 Ga0207707_10469722 3300025912 Bacteria 1075
172 Ga0207695_10923216 3300025913 Bacteria 752
173 Ga0207662_10328317 3300025918 Bacteria 1023
174 Ga0207657_10342804 3300025919 Bacteria 1179
175 Ga0207649_10068384 3300025920 Bacteria 2258
176 Ga0207649_10558983 3300025920 Bacteria 876
177 Ga0207649_10805801 3300025920 Bacteria 733
178 Ga0207649_11355948 3300025920 Bacteria 563
179 Ga0207652_10673571 3300025921 Bacteria 924
180 Ga0207681_10462740 3300025923 Bacteria 1033
181 Ga0207650_10001567 3300025925 Bacteria 16344
182 Ga0207650_10230334 3300025925 Bacteria 1494
183 Ga0207650_10769467 3300025925 Bacteria 815
184 Ga0207659_10002689 3300025926 Bacteria 10592
185 Ga0207659_10035680 3300025926 Bacteria 3440
186 Ga0207659_10540157 3300025926 Bacteria 990
187 Ga0207644_10008230 3300025931 Bacteria 6831
188 Ga0207644_11483560 3300025931 Bacteria 569
189 Ga0207690_10222355 3300025932 Bacteria 1445
190 Ga0207690_10300432 3300025932 Bacteria 1256
191 Ga0207690_10684231 3300025932 Bacteria 842
192 Ga0207690_11512561 3300025932 Bacteria 561
193 Ga0207706_10188687 3300025933 Bacteria 1810
194 Ga0207706_10241005 3300025933 Bacteria 1581
195 Ga0207706_10385349 3300025933 Bacteria 1216
196 Ga0207706_10454882 3300025933 Bacteria 1107
197 Ga0207709_10421837 3300025935 Bacteria 1025
198 Ga0207709_10904443 3300025935 Bacteria 717
199 Ga0207669_10028755 3300025937 Bacteria 3063
200 Ga0207669_10654497 3300025937 Bacteria 859
201 Ga0207691_10098382 3300025940 Bacteria 2613
202 Ga0207711_10085160 3300025941 Bacteria 2769
203 Ga0207711_10252740 3300025941 Bacteria 1619
204 Ga0207711_11288754 3300025941 Bacteria 673
205 Ga0207689_10636293 3300025942 Bacteria 898
206 Ga0207689_10807318 3300025942 Bacteria 792
207 Ga0207679_10001466 3300025945 Bacteria 14785
208 Ga0207679_10024678 3300025945 Bacteria 4124
209 Ga0207679_11107021 3300025945 Bacteria 727
210 Ga0207679_11456442 3300025945 Bacteria 628
211 Ga0207667_11119504 3300025949 Bacteria 770
212 Ga0207651_10055024 3300025960 Bacteria 2730
213 Ga0207651_10437713 3300025960 Bacteria 1119
214 Ga0207651_10519582 3300025960 Bacteria 1031
215 Ga0207651_11248933 3300025960 Bacteria 667
216 Ga0207712_10455947 3300025961 Bacteria 1085
217 Ga0207668_10180850 3300025972 Bacteria 1663
218 Ga0207668_10586778 3300025972 Bacteria 969
219 Ga0207668_10651936 3300025972 Bacteria 921
220 Ga0207640_10427034 3300025981 Bacteria 1086
221 Ga0207640_10796826 3300025981 Bacteria 818
222 Ga0207658_10565635 3300025986 Bacteria 1018
223 Ga0207658_10573924 3300025986 Bacteria 1011
224 Ga0207658_10731143 3300025986 Bacteria 895
225 Ga0207703_12111800 3300026035 Bacteria 539
226 Ga0207639_11470864 3300026041 Bacteria 639
227 Ga0207678_10204969 3300026067 Bacteria 1687
228 Ga0207678_11026978 3300026067 Bacteria 730
229 Ga0207702_10879025 3300026078 Bacteria 888
230 Ga0207702_12153529 3300026078 Bacteria 547
231 Ga0207641_11997589 3300026088 Bacteria 581
232 Ga0207641_12092056 3300026088 Bacteria 567
233 Ga0207648_10201650 3300026089 Bacteria 1764
234 Ga0207648_10364114 3300026089 Bacteria 1305
235 Ga0207648_10738027 3300026089 Bacteria 914
236 Ga0207648_11502821 3300026089 Bacteria 633
237 Ga0207676_10425369 3300026095 Bacteria 1246
238 Ga0207674_10423949 3300026116 Bacteria 1286
239 Ga0207674_10496906 3300026116 Bacteria 1179
240 Ga0207675_100058362 3300026118 Bacteria 3601
241 Ga0207675_100218495 3300026118 Bacteria 1836
242 Ga0207675_101812539 3300026118 Bacteria 629
243 Ga0207683_10510065 3300026121 Bacteria 1111
244 Ga0207683_10901185 3300026121 Bacteria 821
245 Ga0207683_11234476 3300026121 Bacteria 692
246 Ga0209967_1012588 3300027364 Bacteria 1196
247 Ga0209981_1034893 3300027378 Bacteria 744
248 Ga0209982_1002629 3300027552 Bacteria 2525
249 Ga0209970_1078633 3300027614 Bacteria 618
250 Ga0210002_1030303 3300027617 Bacteria 898
251 Ga0209983_1012918 3300027665 Bacteria 1716
252 Ga0209974_10190617 3300027876 Bacteria 754
253 Ga0268266_10022523 3300028379 Bacteria 5368
254 Ga0268266_10093341 3300028379 Bacteria 2641
255 Ga0268266_10524799 3300028379 Bacteria 1132
256 Ga0268266_10977509 3300028379 Bacteria 819
257 Ga0268265_10133743 3300028380 Bacteria 2065
258 Ga0307408_100002738 3300031548 Bacteria 12231
259 Ga0307408_100471197 3300031548 Bacteria 1093
260 Ga0307408_100695155 3300031548 Bacteria 913
261 Ga0307408_101265108 3300031548 Bacteria 690
262 Ga0307408_101903228 3300031548 Bacteria 570
263 Ga0307405_10190065 3300031731 Bacteria 1482
264 Ga0307405_10589296 3300031731 Bacteria 905
265 Ga0307405_10731518 3300031731 Bacteria 822
266 Ga0307405_10780893 3300031731 Bacteria 798
267 Ga0307405_11296188 3300031731 Bacteria 633
268 Ga0307405_11859000 3300031731 Bacteria 536
269 Ga0307405_12053367 3300031731 Bacteria 512
270 Ga0307413_10028039 3300031824 Bacteria 3129
271 Ga0307413_10030478 3300031824 Bacteria 3030
272 Ga0307413_10350202 3300031824 Bacteria 1139
273 Ga0307413_10417690 3300031824 Bacteria 1055
274 Ga0307413_10465793 3300031824 Bacteria 1006
275 Ga0307413_10560286 3300031824 Bacteria 928
276 Ga0307413_10631927 3300031824 Bacteria 880
277 Ga0307413_11280120 3300031824 Bacteria 641
278 Ga0307413_11357186 3300031824 Bacteria 624
279 Ga0307413_11553106 3300031824 Bacteria 586
280 Ga0307413_11729209 3300031824 Bacteria 558
281 Ga0307410_10024402 3300031852 Bacteria 3776
282 Ga0307410_10060845 3300031852 Bacteria 2582
283 Ga0307410_10084382 3300031852 Bacteria 2239
284 Ga0307410_10136387 3300031852 Bacteria 1809
285 Ga0307410_10223905 3300031852 Bacteria 1448
286 Ga0307410_10395288 3300031852 Bacteria 1115
287 Ga0307410_10396034 3300031852 Bacteria 1114
288 Ga0307410_10405650 3300031852 Bacteria 1102
289 Ga0307410_10446426 3300031852 Bacteria 1054
290 Ga0307410_10448069 3300031852 Bacteria 1052
291 Ga0307410_10870149 3300031852 Bacteria 770
292 Ga0307410_11286218 3300031852 Bacteria 639
293 Ga0307410_11716656 3300031852 Bacteria 556
294 Ga0307410_11749069 3300031852 Bacteria 551
295 Ga0307406_10430525 3300031901 Bacteria 1053
296 Ga0307406_10470635 3300031901 Bacteria 1012
297 Ga0307406_10557599 3300031901 Bacteria 938
298 Ga0307406_10610645 3300031901 Bacteria 900
299 Ga0307406_10896815 3300031901 Bacteria 754
300 Ga0307406_10939381 3300031901 Bacteria 738
301 Ga0307406_11075721 3300031901 Bacteria 693
302 Ga0307406_11694433 3300031901 Bacteria 560
303 Ga0307406_11872778 3300031901 Bacteria 534
304 Ga0307407_10125964 3300031903 Bacteria 1631
305 Ga0307407_10280615 3300031903 Bacteria 1153
306 Ga0307407_10379858 3300031903 Bacteria 1008
307 Ga0307407_10452103 3300031903 Bacteria 932
308 Ga0307407_10509423 3300031903 Bacteria 883
309 Ga0307407_11492393 3300031903 Bacteria 534
310 Ga0307412_10005349 3300031911 Bacteria 7203
311 Ga0307412_10083143 3300031911 Bacteria 2218
312 Ga0307412_10317908 3300031911 Bacteria 1237
313 Ga0307412_10612977 3300031911 Bacteria 923
314 Ga0307412_11368538 3300031911 Bacteria 639
315 Ga0307409_100161425 3300031995 Bacteria 1960
316 Ga0307409_100181335 3300031995 Bacteria 1864
317 Ga0307409_100191359 3300031995 Bacteria 1821
318 Ga0307409_100289380 3300031995 Bacteria 1518
319 Ga0307409_100348430 3300031995 Bacteria 1396
320 Ga0307409_100491903 3300031995 Bacteria 1192
321 Ga0307409_100582139 3300031995 Bacteria 1103
322 Ga0307409_100910507 3300031995 Bacteria 893
323 Ga0307409_101244161 3300031995 Bacteria 768
324 Ga0307409_101453569 3300031995 Bacteria 712
325 Ga0307409_102628307 3300031995 Bacteria 532
326 Ga0307409_102865700 3300031995 Bacteria 509
327 Ga0307409_102882582 3300031995 Bacteria 508
328 Ga0307416_100007111 3300032002 Bacteria 7076
329 Ga0307416_100013642 3300032002 Bacteria 5533
330 Ga0307416_100076982 3300032002 Bacteria 2799
331 Ga0307416_100086017 3300032002 Bacteria 2678
332 Ga0307416_100436359 3300032002 Bacteria 1358
333 Ga0307416_100489829 3300032002 Bacteria 1291
334 Ga0307416_100832965 3300032002 Bacteria 1020
335 Ga0307416_100945398 3300032002 Bacteria 963
336 Ga0307416_101472812 3300032002 Bacteria 786
337 Ga0307416_101561663 3300032002 Bacteria 765
338 Ga0307416_101610942 3300032002 Bacteria 754
339 Ga0307416_101634501 3300032002 Bacteria 749
340 Ga0307416_103755532 3300032002 Bacteria 508
341 Ga0307414_10007849 3300032004 Bacteria 6018
342 Ga0307414_10082408 3300032004 Bacteria 2358
343 Ga0307414_10148318 3300032004 Bacteria 1846
344 Ga0307414_10235494 3300032004 Bacteria 1512
345 Ga0307414_10922364 3300032004 Bacteria 801
346 Ga0307414_11054470 3300032004 Bacteria 749
347 Ga0307414_11558739 3300032004 Bacteria 615
348 Ga0307414_12303109 3300032004 Bacteria 503
349 Ga0307411_10004327 3300032005 Bacteria 6777
350 Ga0307411_10054529 3300032005 Bacteria 2625
351 Ga0307411_10188540 3300032005 Bacteria 1572
352 Ga0307411_10273153 3300032005 Bacteria 1341
353 Ga0307411_10484240 3300032005 Bacteria 1042
354 Ga0307411_10794927 3300032005 Bacteria 832
355 Ga0307411_10821123 3300032005 Bacteria 820
356 Ga0307411_10838213 3300032005 Bacteria 812
357 Ga0307411_12334811 3300032005 Bacteria 503
358 Ga0307415_100013861 3300032126 Bacteria 4719
359 Ga0307415_100054329 3300032126 Bacteria 2733
360 Ga0307415_100307231 3300032126 Bacteria 1316
361 Ga0307415_100310954 3300032126 Bacteria 1309
362 Ga0307415_100399750 3300032126 Bacteria 1172
363 Ga0307415_100624292 3300032126 Bacteria 962
364 Ga0373925_0073271 3300037068 Bacteria 2592
365 Ga0395900_0164414 3300037418 Bacteria 2262
366 Ga0395898_1152547 3300037466 Bacteria 707
367 Ga0395905_0138220 3300037471 Bacteria 2292
368 Ga0395905_0833567 3300037471 Bacteria 825
369 Ga0395901_0871334 3300038443 Bacteria 884
370 Ga0451787_267327 3300041441 Bacteria 676
371 Ga0451795_1720222 3300041456 Bacteria 564
372 Ga0451798_0444409 3300041458 Bacteria 626
373 Ga0439433_0049178 3300041999 Bacteria 992
374 Ga0439432_167525 3300042006 Bacteria 642
375 Ga0439449_0114628 3300042007 Bacteria 999
376 Ga0439449_0144536 3300042007 Bacteria 886
377 Ga0439454_092364 3300042011 Bacteria 561
378 Ga0439457_119747 3300042014 Bacteria 622
379 Ga0450912_012603 3300042116 Bacteria 749
380 Ga0450920_013034 3300042122 Bacteria 1564
381 Ga0450890_081318 3300042127 Bacteria 529
382 Ga0450900_030168 3300042136 Bacteria 786
383 Ga0450906_073899 3300042145 Bacteria 612
384 Ga0450909_051756 3300042185 Bacteria 642
385 Ga0451577_0363580 3300042876 Bacteria 1313
386 Ga0453684_0589842 3300044712 Bacteria 1219
387 Ga0466960_0748957 3300044901 Bacteria 589
388 Ga0495638_0029061 3300046460 Bacteria 3565
389 Ga0495585_0183374 3300046492 Bacteria 1075
390 Ga0495663_0011738 3300046525 Bacteria 2439
391 Ga0495663_0205681 3300046525 Bacteria 688
392 Ga0495598_0001912 3300046537 Bacteria 4214
393 Ga0495621_0001529 3300046539 Bacteria 6017
394 Ga0495633_0001763 3300046558 Bacteria 16049
395 Ga0495656_0142011 3300046615 Bacteria 1152
396 Ga0495668_0190581 3300046616 Bacteria 1123
397 Ga0495668_0270652 3300046616 Bacteria 930
398 Ga0495669_0006879 3300046684 Bacteria 4762
399 Ga0495669_0093949 3300046684 Bacteria 1387
400 Ga0495669_0120430 3300046684 Bacteria 1229
401 Ga0495669_0198265 3300046684 Bacteria 959
402 Ga0495670_0192156 3300046691 Bacteria 1079
403 Ga0495677_0013756 3300047445 Bacteria 2945
404 Ga0495677_0106396 3300047445 Bacteria 1064
405 Ga0495685_253041 3300047447 Bacteria 558
406 Ga0496102_0073258 3300048905 Bacteria 3148
407 Ga0496103_0248535 3300048906 Bacteria 1144
408 Ga0496107_1007155 3300048910 Bacteria 604
409 Ga0496108_0009781 3300048911 Bacteria 7768
410 Ga0496108_0193561 3300048911 Bacteria 1763
411 Ga0496109_0483138 3300048912 Bacteria 1169
412 Ga0496109_0788086 3300048912 Bacteria 888
413 Ga0496109_1239394 3300048912 Bacteria 682
414 Ga0496110_0080321 3300048913 Bacteria 2905
415 Ga0496111_0131164 3300048914 Bacteria 1854
416 Ga0496111_0322907 3300048914 Bacteria 1143
417 Ga0496112_0174129 3300048915 Bacteria 2117
418 Ga0496113_0515188 3300048916 Bacteria 960
419 Ga0496113_0518501 3300048916 Bacteria 957
420 Ga0496114_0676653 3300048917 Bacteria 906
421 Ga0496115_0081679 3300048918 Bacteria 2632
422 Ga0501306_005125 3300049127 Bacteria 1492
423 Ga0501308_007923 3300049128 Bacteria 1124
424 Ga0501309_004805 3300049129 Bacteria 1586
425 Ga0501309_054730 3300049129 Bacteria 633
426 Ga0501310_008117 3300049130 Bacteria 1135
427 Ga0501304_004169 3300049160 Bacteria 1090
428 Ga0501305_017256 3300049161 Bacteria 1036
429 Ga0501307_004071 3300049162 Bacteria 1472
430 Ga0501307_024722 3300049162 Bacteria 803
431 Ga0501311_046059 3300049527 Bacteria 673
432 Ga0501312_044938 3300049528 Bacteria 731
433 Ga0501313_045825 3300049529 Bacteria 596
434 Ga0501316_034065 3300049532 Bacteria 691
435 Ga0501320_004119 3300049536 Bacteria 1265
436 Ga0501321_015700 3300049537 Bacteria 894
437 Ga0501322_024156 3300049538 Bacteria 548
438 Ga0501323_006794 3300049539 Bacteria 1288
439 Ga0501324_003639 3300049540 Bacteria 1191
440 Ga0501325_004923 3300049541 Bacteria 1043
441 Ga0501326_11402 3300049542 Bacteria 541
442 Ga0501340_009129 3300049556 Bacteria 709
443 Ga0501076_1250402 3300049592 Bacteria 611
444 Ga0501076_1632155 3300049592 Bacteria 529
445 Ga0501239_064183 3300049672 Bacteria 559
446 Ga0501268_014046 3300049765 Bacteria 1301
447 Ga0501270_170079 3300049767 Bacteria 509
448 nmdc:mga03683_25364_c1 3300050489 Bacteria 2328
449 nmdc:mga03683_58959_c1 3300050489 Bacteria 1619
450 nmdc:mga03683_91515_c1 3300050489 Bacteria 1327
451 nmdc:mga03n38_136467_c1 3300050490 Bacteria 1221
452 nmdc:mga03n38_601758_c1 3300050490 Bacteria 626
453 nmdc:mga03n38_8514_c1 3300050490 Bacteria 3685
454 nmdc:mga00v17_21650_c1 3300050491 Bacteria 3698
455 nmdc:mga00v17_782177_c1 3300050491 Bacteria 609
456 nmdc:mga0k408_33683_c1 3300050493 Bacteria 1662
457 nmdc:mga07m45_63491_c1 3300050496 Bacteria 2094
458 nmdc:mga07m45_738165_c1 3300050496 Bacteria 565
459 nmdc:mga07m45_799508_c1 3300050496 Bacteria 541
460 nmdc:mga08x19_353875_c1 3300050514 Bacteria 1026
461 nmdc:mga0sz30_104722_c2 3300050516 Bacteria 588
462 Ga0500595_040349 3300053119 Bacteria 1506
463 Ga0590071_196900 3300059421 Bacteria 530
464 Ga0590074_097239 3300059423 Bacteria 572
465 Ga0590077_063628 3300059426 Bacteria 838
466 Ga0439437_017586
467 JGI24739J22299_10099339
468 JGI24738J21930_10027584
469 JGI24744J21845_10103561
470 JGI24033J26618_1046317
471 Ga0058863_10693721
472 Ga0065712_10155000
473 Ga0065712_10327270
474 Ga0065715_10249216
475 Ga0065715_10583706
476 Ga0065715_10610176
477 Ga0070658_11148008
478 Ga0070676_10078650
479 Ga0070676_10342605
480 Ga0070676_10507378
481 Ga0070683_102115168
482 Ga0070670_100094293
483 Ga0070677_10064728
484 Ga0070677_10183277
485 Ga0070677_10335713
486 Ga0068869_101954430
487 Ga0070666_10058140
488 Ga0070666_10152132
489 Ga0070666_10320059
490 Ga0070666_10498256
491 Ga0070680_100567104
492 Ga0070682_100055962
493 Ga0070660_100235491
494 Ga0070660_100317858
495 Ga0070687_100054716
496 Ga0070661_100274858
497 Ga0070661_100281337
498 Ga0070661_101003118
499 Ga0070661_101068680
500 Ga0070668_100166462
501 Ga0070668_101217789
502 Ga0070668_101870119
503 Ga0070669_100477131
504 Ga0070669_100724052
505 Ga0070669_100801210
506 Ga0070675_100048237
507 Ga0070675_100070917
508 Ga0070675_100136010
509 Ga0070675_100549311
510 Ga0070671_100431944
511 Ga0070671_100586924
512 Ga0070671_100830231
513 Ga0070671_101650669
514 Ga0070674_100167258
515 Ga0070674_100288610
516 Ga0070674_100926015
517 Ga0070674_101453562
518 Ga0070673_100197404
519 Ga0070673_100393058
520 Ga0070673_100836082
521 Ga0070673_100849942
522 Ga0070673_101514793
523 Ga0070659_100207119
524 Ga0070659_100242409
525 Ga0070659_100372483
526 Ga0070659_100406096
527 Ga0070659_102169909
528 Ga0070667_100105612
529 Ga0070667_100274832
530 Ga0070667_100331074
531 Ga0070667_100740877
532 Ga0070667_101763307
533 Ga0070708_100271215
534 Ga0070663_100352780
535 Ga0070663_100709709
536 Ga0070678_100812468
537 Ga0070678_101577233
538 Ga0070662_100054942
539 Ga0070662_100125769
540 Ga0070662_100348057
541 Ga0070662_100365666
542 Ga0070681_10761364
543 Ga0068867_100252891
544 Ga0068867_101027929
545 Ga0068867_101212444
546 Ga0068867_102101306
547 Ga0070685_10429520
548 Ga0070699_100375517
549 Ga0070679_100084951
550 Ga0070697_101825858
551 Ga0070672_100029768
552 Ga0070672_100398475
553 Ga0070672_100755583
554 Ga0070686_101174616
555 Ga0070696_100665105
556 Ga0070665_100043393
557 Ga0070665_100111059
558 Ga0070665_100464752
559 Ga0070665_100478823
560 Ga0068855_100341685
561 Ga0070664_100026594
562 Ga0070664_100070110
563 Ga0070664_101234403
564 Ga0070664_101927755
565 Ga0068857_100490878
566 Ga0068857_100714810
567 Ga0068854_100178480
568 Ga0068854_100189556
569 Ga0068854_100339428
570 Ga0068856_101864336
571 Ga0070702_100587653
572 Ga0068852_100412083
573 Ga0068859_100176135
574 Ga0068864_100100283
575 Ga0068870_10048181
576 Ga0068870_10714633
577 Ga0068863_100030104
578 Ga0068863_101374760
579 Ga0068862_100178721
580 Ga0068862_101765688
581 Ga0075363_100197142
582 Ga0075363_100344168
583 Ga0075364_10024908
584 Ga0075364_10866717
585 Ga0075362_10010315
586 Ga0075362_10031458
587 Ga0075366_10053468
588 Ga0075366_10322441
589 Ga0075370_10049359
590 Ga0068871_100681516
591 Ga0068871_100707881
592 Ga0068871_101687665
593 Ga0068865_100719844
594 Ga0075436_100289425
595 Ga0097620_100176136
596 Ga0105240_11187584
597 Ga0105243_10392213
598 Ga0105243_10871297
599 Ga0105243_12963795
600 Ga0105241_11756006
601 Ga0105242_12388995
602 Ga0105248_10221513
603 Ga0105249_10133308
604 Ga0105249_10267839
605 Ga0105249_12369422
606 Ga0105239_12323613
607 Ga0105246_10162779
608 Ga0157343_1009480
609 Ga0157316_1039418
610 Ga0157327_1026809
611 Ga0157373_10196666
612 Ga0157373_10517864
613 Ga0163162_12422386
614 Ga0157372_10833560
615 Ga0157375_10077381
616 Ga0157375_11270402
617 Ga0157375_12761512
618 Ga0157380_11653539
619 Ga0163161_10208320
620 Ga0163161_10664619
621 Ga0207666_1007694
622 Ga0207673_1055421
623 Ga0207697_10468689
624 Ga0207682_10004483
625 Ga0207682_10079304
626 Ga0207688_10238346
627 Ga0207688_10510324
628 Ga0207680_10519736
629 Ga0207680_10532285
630 Ga0207645_10133680
631 Ga0207645_10212090
632 Ga0207645_10215681
633 Ga0207643_10511409
634 Ga0207705_10198088
635 Ga0207654_10997271
636 Ga0207707_10469722
637 Ga0207695_10923216
638 Ga0207662_10328317
639 Ga0207657_10342804
640 Ga0207649_10068384
641 Ga0207649_10558983
642 Ga0207649_10805801
643 Ga0207649_11355948
644 Ga0207652_10673571
645 Ga0207681_10462740
646 Ga0207650_10001567
647 Ga0207650_10230334
648 Ga0207650_10769467
649 Ga0207659_10002689
650 Ga0207659_10035680
651 Ga0207659_10540157
652 Ga0207644_10008230
653 Ga0207644_11483560
654 Ga0207690_10222355
655 Ga0207690_10300432
656 Ga0207690_10684231
657 Ga0207690_11512561
658 Ga0207706_10188687
659 Ga0207706_10241005
660 Ga0207706_10385349
661 Ga0207706_10454882
662 Ga0207709_10421837
663 Ga0207709_10904443
664 Ga0207669_10028755
665 Ga0207669_10654497
666 Ga0207691_10098382
667 Ga0207711_10085160
668 Ga0207711_10252740
669 Ga0207711_11288754
670 Ga0207689_10636293
671 Ga0207689_10807318
672 Ga0207679_10001466
673 Ga0207679_10024678
674 Ga0207679_11107021
675 Ga0207679_11456442
676 Ga0207667_11119504
677 Ga0207651_10055024
678 Ga0207651_10437713
679 Ga0207651_10519582
680 Ga0207651_11248933
681 Ga0207712_10455947
682 Ga0207668_10180850
683 Ga0207668_10586778
684 Ga0207668_10651936
685 Ga0207640_10427034
686 Ga0207640_10796826
687 Ga0207658_10565635
688 Ga0207658_10573924
689 Ga0207658_10731143
690 Ga0207703_12111800
691 Ga0207639_11470864
692 Ga0207678_10204969
693 Ga0207678_11026978
694 Ga0207702_10879025
695 Ga0207702_12153529
696 Ga0207641_11997589
697 Ga0207641_12092056
698 Ga0207648_10201650
699 Ga0207648_10364114
700 Ga0207648_10738027
701 Ga0207648_11502821
702 Ga0207676_10425369
703 Ga0207674_10423949
704 Ga0207674_10496906
705 Ga0207675_100058362
706 Ga0207675_100218495
707 Ga0207675_101812539
708 Ga0207683_10510065
709 Ga0207683_10901185
710 Ga0207683_11234476
711 Ga0209967_1012588
712 Ga0209981_1034893
713 Ga0209982_1002629
714 Ga0209970_1078633
715 Ga0210002_1030303
716 Ga0209983_1012918
717 Ga0209974_10190617
718 Ga0268266_10022523
719 Ga0268266_10093341
720 Ga0268266_10524799
721 Ga0268266_10977509
722 Ga0268265_10133743
723 Ga0307408_100002738
724 Ga0307408_100471197
725 Ga0307408_100695155
726 Ga0307408_101265108
727 Ga0307408_101903228
728 Ga0307405_10190065
729 Ga0307405_10589296
730 Ga0307405_10731518
731 Ga0307405_10780893
732 Ga0307405_11296188
733 Ga0307405_11859000
734 Ga0307405_12053367
735 Ga0307413_10028039
736 Ga0307413_10030478
737 Ga0307413_10350202
738 Ga0307413_10417690
739 Ga0307413_10465793
740 Ga0307413_10560286
741 Ga0307413_10631927
742 Ga0307413_11280120
743 Ga0307413_11357186
744 Ga0307413_11553106
745 Ga0307413_11729209
746 Ga0307410_10024402
747 Ga0307410_10060845
748 Ga0307410_10084382
749 Ga0307410_10136387
750 Ga0307410_10223905
751 Ga0307410_10395288
752 Ga0307410_10396034
753 Ga0307410_10405650
754 Ga0307410_10446426
755 Ga0307410_10448069
756 Ga0307410_10870149
757 Ga0307410_11286218
758 Ga0307410_11716656
759 Ga0307410_11749069
760 Ga0307406_10430525
761 Ga0307406_10470635
762 Ga0307406_10557599
763 Ga0307406_10610645
764 Ga0307406_10896815
765 Ga0307406_10939381
766 Ga0307406_11075721
767 Ga0307406_11694433
768 Ga0307406_11872778
769 Ga0307407_10125964
770 Ga0307407_10280615
771 Ga0307407_10379858
772 Ga0307407_10452103
773 Ga0307407_10509423
774 Ga0307407_11492393
775 Ga0307412_10005349
776 Ga0307412_10083143
777 Ga0307412_10317908
778 Ga0307412_10612977
779 Ga0307412_11368538
780 Ga0307409_100161425
781 Ga0307409_100181335
782 Ga0307409_100191359
783 Ga0307409_100289380
784 Ga0307409_100348430
785 Ga0307409_100491903
786 Ga0307409_100582139
787 Ga0307409_100910507
788 Ga0307409_101244161
789 Ga0307409_101453569
790 Ga0307409_102628307
791 Ga0307409_102865700
792 Ga0307409_102882582
793 Ga0307416_100007111
794 Ga0307416_100013642
795 Ga0307416_100076982
796 Ga0307416_100086017
797 Ga0307416_100436359
798 Ga0307416_100489829
799 Ga0307416_100832965
800 Ga0307416_100945398
801 Ga0307416_101472812
802 Ga0307416_101561663
803 Ga0307416_101610942
804 Ga0307416_101634501
805 Ga0307416_103755532
806 Ga0307414_10007849
807 Ga0307414_10082408
808 Ga0307414_10148318
809 Ga0307414_10235494
810 Ga0307414_10922364
811 Ga0307414_11054470
812 Ga0307414_11558739
813 Ga0307414_12303109
814 Ga0307411_10004327
815 Ga0307411_10054529
816 Ga0307411_10188540
817 Ga0307411_10273153
818 Ga0307411_10484240
819 Ga0307411_10794927
820 Ga0307411_10821123
821 Ga0307411_10838213
822 Ga0307411_12334811
823 Ga0307415_100013861
824 Ga0307415_100054329
825 Ga0307415_100307231
826 Ga0307415_100310954
827 Ga0307415_100399750
828 Ga0307415_100624292
829 Ga0373925_0073271
830 Ga0395900_0164414
831 Ga0395898_1152547
832 Ga0395905_0138220
833 Ga0395905_0833567
834 Ga0395901_0871334
835 Ga0451787_267327
836 Ga0451795_1720222
837 Ga0451798_0444409
838 Ga0439433_0049178
839 Ga0439432_167525
840 Ga0439449_0114628
841 Ga0439449_0144536
842 Ga0439454_092364
843 Ga0439457_119747
844 Ga0450912_012603
845 Ga0450920_013034
846 Ga0450890_081318
847 Ga0450900_030168
848 Ga0450906_073899
849 Ga0450909_051756
850 Ga0451577_0363580
851 Ga0453684_0589842
852 Ga0466960_0748957
853 Ga0495638_0029061
854 Ga0495585_0183374
855 Ga0495663_0011738
856 Ga0495663_0205681
857 Ga0495598_0001912
858 Ga0495621_0001529
859 Ga0495633_0001763
860 Ga0495656_0142011
861 Ga0495668_0190581
862 Ga0495668_0270652
863 Ga0495669_0006879
864 Ga0495669_0093949
865 Ga0495669_0120430
866 Ga0495669_0198265
867 Ga0495670_0192156
868 Ga0495677_0013756
869 Ga0495677_0106396
870 Ga0495685_253041
871 Ga0496102_0073258
872 Ga0496103_0248535
873 Ga0496107_1007155
874 Ga0496108_0009781
875 Ga0496108_0193561
876 Ga0496109_0483138
877 Ga0496109_0788086
878 Ga0496109_1239394
879 Ga0496110_0080321
880 Ga0496111_0131164
881 Ga0496111_0322907
882 Ga0496112_0174129
883 Ga0496113_0515188
884 Ga0496113_0518501
885 Ga0496114_0676653
886 Ga0496115_0081679
887 Ga0501306_005125
888 Ga0501308_007923
889 Ga0501309_004805
890 Ga0501309_054730
891 Ga0501310_008117
892 Ga0501304_004169
893 Ga0501305_017256
894 Ga0501307_004071
895 Ga0501307_024722
896 Ga0501311_046059
897 Ga0501312_044938
898 Ga0501313_045825
899 Ga0501316_034065
900 Ga0501320_004119
901 Ga0501321_015700
902 Ga0501322_024156
903 Ga0501323_006794
904 Ga0501324_003639
905 Ga0501325_004923
906 Ga0501326_11402
907 Ga0501340_009129
908 Ga0501076_1250402
909 Ga0501076_1632155
910 Ga0501239_064183
911 Ga0501268_014046
912 Ga0501270_170079
913 nmdc:mga03683_25364_c1
914 nmdc:mga03683_58959_c1
915 nmdc:mga03683_91515_c1
916 nmdc:mga03n38_136467_c1
917 nmdc:mga03n38_601758_c1
918 nmdc:mga03n38_8514_c1
919 nmdc:mga00v17_21650_c1
920 nmdc:mga00v17_782177_c1
921 nmdc:mga0k408_33683_c1
922 nmdc:mga07m45_63491_c1
923 nmdc:mga07m45_738165_c1
924 nmdc:mga07m45_799508_c1
925 nmdc:mga08x19_353875_c1
926 nmdc:mga0sz30_104722_c2
927 Ga0500595_040349
928 Ga0590071_196900
929 Ga0590074_097239
930 Ga0590077_063628

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00831

Ribosomal_L29

Ribosomal L29 protein

11

67

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p7r-assembly1.cif.gz_1 poxta-eq2 antibiotic resistance abcf bound to e. faecalis 70s ribosome, state i 0.9829 6 61
7pjs-assembly1.cif.gz_Y structure of the 70s ribosome with trnas in the classical pre-translocation state and apramycin (c) 0.977 7 61
4ybb-assembly1.cif.gz_DZ high-resolution structure of the escherichia coli ribosome 0.9768 6 63
8fn2-assembly1.cif.gz_a the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9768 10 58
5kcr-assembly1.cif.gz_12 cryo-em structure of the escherichia coli 70s ribosome in complex with antibiotic avilamycin c, mrna and p-site trna at 3.6a resolution 0.9762 6 63
ID Description Score Start End Superfamily
4wceV00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9759 10 62 1.10.287.310
4wfaV00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.971 12 62 1.10.287.310
4wf9V00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9626 12 62 1.10.287.310
3cc7V00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9424 6 63 1.10.287.310
4hubV00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9402 6 63 1.10.287.310
ID Description Score Start End GO Terms
AF-A0A1F6LYV1-F1-model_v4 Large ribosomal subunit protein uL29 1.002 6 63 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-H5UTV8-F1-model_v4 Large ribosomal subunit protein uL29 0.9992 8 62 GO:0003735
GO:0006412
GO:0022625
AF-A0A6B1GJ41-F1-model_v4 Large ribosomal subunit protein uL29 0.9986 6 69 GO:0003735
GO:0006412
GO:0022625
AF-A0A6B1B6K0-F1-model_v4 Large ribosomal subunit protein uL29 0.9984 6 69 GO:0003735
GO:0006412
GO:0022625
AF-A0A7Y5LM99-F1-model_v4 Large ribosomal subunit protein uL29 0.997 6 69 GO:0003735
GO:0006412
GO:0022625

Map