F449453

General Info

Members Datasets Scaffolds Average Seq Length
465 247 930 359

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10086831|Ga0081455_100868312
Length 341
Sequence MTKRKLPSVFKAAWIYVGPHNDGGWSQAHDKGRMAVQNALGDKVETTFKENVPEGPQVSQVIDSLVRDGNTIIFATSFGFQGAMKAAAAKYPNVKFEMATGTYTSKNMAEYFGAGEDGIYLSGMAAGAATKKGTIGYIVPFAIPEVIRHANAFALGAQATHPGVKVKLIWTNSWFSPDKEKKAAENLHKLGGADVLGQNVDSPAAGQYAESAGIPWVGYDSNAKKFAPKQWLTAAVYNWGPYYTKRVKAAMSGTWKTGFYYGTMRDGMIGLAPYGPGVTAATKAAIAKKRALLVSGKWNEFDGPIYDQKGKLRIKKGTRPSVQDLYAMDWLVKGIIGSAKG

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
129 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
168 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
169 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 1.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 12.26
Rhizosphere 87.31
Stem 0
Stem Tuber 0
Unclassified 1.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10086831 3300005937 Bacteria 2547
2 ARcpr5yngRDRAFT_c004515 3300000043 Bacteria 1316
3 ARCol0yngRDRAFT_1001200 3300000652 Bacteria 2194
4 Ga0058862_12710919 3300004803 Unclassified 1380
5 Ga0070658_10044074 3300005327 Bacteria 3604
6 Ga0070658_10069198 3300005327 Bacteria 2887
7 Ga0070658_10140898 3300005327 Bacteria 2014
8 Ga0070683_100006996 3300005329 Bacteria 9492
9 Ga0070683_100056954 3300005329 Bacteria 3630
10 Ga0070683_100099838 3300005329 Bacteria 2732
11 Ga0070690_100032249 3300005330 Bacteria 3271
12 Ga0070680_100003945 3300005336 Bacteria 11097
13 Ga0070680_100012249 3300005336 Bacteria 6659
14 Ga0070680_100020663 3300005336 Bacteria 5226
15 Ga0070680_100022764 3300005336 Bacteria 4992
16 Ga0070680_100122798 3300005336 Bacteria 2169
17 Ga0070682_100039065 3300005337 Bacteria 2914
18 Ga0070682_100044551 3300005337 Bacteria 2747
19 Ga0070682_100134275 3300005337 Bacteria 1679
20 Ga0070682_100247872 3300005337 Bacteria 1282
21 Ga0070660_100003045 3300005339 Bacteria 11536
22 Ga0070660_100004482 3300005339 Bacteria 9650
23 Ga0070660_100013775 3300005339 Bacteria 5816
24 Ga0070660_100089496 3300005339 Bacteria 2425
25 Ga0070661_100026657 3300005344 Bacteria 4157
26 Ga0070675_100082098 3300005354 Bacteria 2689
27 Ga0070671_100120422 3300005355 Bacteria 2208
28 Ga0070673_100038270 3300005364 Bacteria 3662
29 Ga0070688_100003618 3300005365 Bacteria 7979
30 Ga0070659_100004761 3300005366 Bacteria 9700
31 Ga0070659_100009271 3300005366 Bacteria 7225
32 Ga0070659_100317584 3300005366 Bacteria 1302
33 Ga0070667_100225779 3300005367 Bacteria 1668
34 Ga0070709_10179801 3300005434 Bacteria 1484
35 Ga0070713_100197649 3300005436 Bacteria 1815
36 Ga0070705_100104393 3300005440 Bacteria 1797
37 Ga0070705_100175435 3300005440 Bacteria 1447
38 Ga0070694_100194272 3300005444 Bacteria 1509
39 Ga0070708_100066112 3300005445 Bacteria 3244
40 Ga0070663_100025439 3300005455 Bacteria 3996
41 Ga0070663_100360238 3300005455 Bacteria 1180
42 Ga0070678_100013281 3300005456 Bacteria 5157
43 Ga0070678_100085967 3300005456 Bacteria 2398
44 Ga0070662_100086867 3300005457 Bacteria 2340
45 Ga0070681_10005926 3300005458 Bacteria 11828
46 Ga0070681_10021294 3300005458 Bacteria 6498
47 Ga0070681_10040786 3300005458 Bacteria 4650
48 Ga0070681_10080049 3300005458 Bacteria 3223
49 Ga0070681_10290242 3300005458 Unclassified 1546
50 Ga0070706_100276562 3300005467 Bacteria 1567
51 Ga0070707_100001756 3300005468 Bacteria 20884
52 Ga0070707_100281619 3300005468 Bacteria 1616
53 Ga0070707_100334306 3300005468 Bacteria 1472
54 Ga0070698_100123790 3300005471 Bacteria 2544
55 Ga0070698_100154179 3300005471 Bacteria 2243
56 Ga0070698_100222526 3300005471 Bacteria 1821
57 Ga0070698_100239143 3300005471 Bacteria 1749
58 Ga0070699_100090708 3300005518 Bacteria 2671
59 Ga0070679_100010448 3300005530 Bacteria 8806
60 Ga0070679_100017038 3300005530 Bacteria 7024
61 Ga0070679_100020245 3300005530 Bacteria 6484
62 Ga0070679_100021092 3300005530 Bacteria 6357
63 Ga0070679_100026998 3300005530 Bacteria 5647
64 Ga0070679_100031415 3300005530 Bacteria 5245
65 Ga0070679_100052059 3300005530 Bacteria 4079
66 Ga0070679_100142285 3300005530 Bacteria 2377
67 Ga0070684_100012196 3300005535 Bacteria 6875
68 Ga0070684_100066825 3300005535 Bacteria 3156
69 Ga0070697_100151861 3300005536 Bacteria 1952
70 Ga0070672_100091391 3300005543 Bacteria 2456
71 Ga0070686_100127530 3300005544 Bacteria 1755
72 Ga0070696_100135563 3300005546 Archaea 1795
73 Ga0070693_100004438 3300005547 Bacteria 6635
74 Ga0070665_100043015 3300005548 Bacteria 4541
75 Ga0070665_100164666 3300005548 Bacteria 2220
76 Ga0070704_100088862 3300005549 Bacteria 2297
77 Ga0068855_100051284 3300005563 Bacteria 4860
78 Ga0068855_100086431 3300005563 Bacteria 3626
79 Ga0068855_100144941 3300005563 Bacteria 2704
80 Ga0068855_100309525 3300005563 Bacteria 1748
81 Ga0068857_100005172 3300005577 Bacteria 11093
82 Ga0068857_100124868 3300005577 Bacteria 2319
83 Ga0068852_100057470 3300005616 Bacteria 3366
84 Ga0068852_100074401 3300005616 Bacteria 2992
85 Ga0068864_100247421 3300005618 Bacteria 1654
86 Ga0068866_10029447 3300005718 Bacteria 2626
87 Ga0081455_10014205 3300005937 Bacteria 7817
88 Ga0081538_10088479 3300005981 Bacteria 1612
89 Ga0081539_10002764 3300005985 Bacteria 23615
90 Ga0075365_10158655 3300006038 Bacteria 1575
91 Ga0075364_10009980 3300006051 Bacteria 5717
92 Ga0075432_10002085 3300006058 Bacteria 6659
93 Ga0070715_10006511 3300006163 Bacteria 3975
94 Ga0070716_100040412 3300006173 Bacteria 2594
95 Ga0070712_100338054 3300006175 Bacteria 1228
96 Ga0097621_100032298 3300006237 Bacteria 4160
97 Ga0068871_100003811 3300006358 Bacteria 10395
98 Ga0075428_100000682 3300006844 Bacteria 34885
99 Ga0075433_10036448 3300006852 Bacteria 4237
100 Ga0075433_10056545 3300006852 Bacteria 3427
101 Ga0075429_100008062 3300006880 Bacteria 9158
102 Ga0075436_100008281 3300006914 Bacteria 7114
103 Ga0075436_100069408 3300006914 Bacteria 2435
104 Ga0099795_10027218 3300007788 Bacteria 1933
105 Ga0105240_10040342 3300009093 Bacteria 5972
106 Ga0105240_10079543 3300009093 Bacteria 4033
107 Ga0111539_10002341 3300009094 Bacteria 25232
108 Ga0105245_10000984 3300009098 Bacteria 25972
109 Ga0105245_10133297 3300009098 Bacteria 2332
110 Ga0105245_10142946 3300009098 Bacteria 2255
111 Ga0105245_10249091 3300009098 Bacteria 1725
112 Ga0114129_10005290 3300009147 Bacteria 18211
113 Ga0114129_10128994 3300009147 Bacteria 3475
114 Ga0105243_10013203 3300009148 Bacteria 6245
115 Ga0105243_10085962 3300009148 Bacteria 2579
116 Ga0105241_10196951 3300009174 Bacteria 1680
117 Ga0105248_10070131 3300009177 Bacteria 3936
118 Ga0105237_10031845 3300009545 Bacteria 5341
119 Ga0105237_10073211 3300009545 Bacteria 3419
120 Ga0105237_10210537 3300009545 Bacteria 1944
121 Ga0105239_10089521 3300010375 Bacteria 3394
122 Ga0105239_10186894 3300010375 Bacteria 2319
123 Ga0105239_10288553 3300010375 Bacteria 1848
124 Ga0105239_10624404 3300010375 Bacteria 1230
125 Ga0105246_10082707 3300011119 Bacteria 2292
126 Ga0157371_10298498 3300013102 Bacteria 1166
127 Ga0157370_10044925 3300013104 Bacteria 4242
128 Ga0157370_10135874 3300013104 Bacteria 2292
129 Ga0157370_10158068 3300013104 Bacteria 2109
130 Ga0157370_10182395 3300013104 Bacteria 1950
131 Ga0157370_10331199 3300013104 Bacteria 1404
132 Ga0157369_10018819 3300013105 Bacteria 7740
133 Ga0157369_10129167 3300013105 Bacteria 2678
134 Ga0157369_10135270 3300013105 Bacteria 2610
135 Ga0157374_10035543 3300013296 Bacteria 4559
136 Ga0157374_10152675 3300013296 Bacteria 2246
137 Ga0157378_10456962 3300013297 Bacteria 1268
138 Ga0163162_10317991 3300013306 Bacteria 1689
139 Ga0157372_10019525 3300013307 Bacteria 7306
140 Ga0157372_10068234 3300013307 Bacteria 3998
141 Ga0157372_10176524 3300013307 Bacteria 2472
142 Ga0157372_10208126 3300013307 Bacteria 2267
143 Ga0157375_10005283 3300013308 Bacteria 11216
144 Ga0157375_10045930 3300013308 Bacteria 4254
145 Ga0157375_10074336 3300013308 Bacteria 3420
146 Ga0157375_10263547 3300013308 Bacteria 1885
147 Ga0163163_10186468 3300014325 Bacteria 2122
148 Ga0163163_10289235 3300014325 Unclassified 1691
149 Ga0157377_10021249 3300014745 Bacteria 3412
150 Ga0157377_10023781 3300014745 Bacteria 3251
151 Ga0157377_10026815 3300014745 Bacteria 3088
152 Ga0157376_10022656 3300014969 Bacteria 4901
153 Ga0197907_10796261 3300020069 Bacteria 1775
154 Ga0206354_11548375 3300020081 Bacteria 2547
155 Ga0206353_10958814 3300020082 Bacteria 1449
156 Ga0206353_11165578 3300020082 Bacteria 3372
157 Ga0206353_11979020 3300020082 Bacteria 1529
158 Ga0207682_10051888 3300025893 Bacteria 1699
159 Ga0207688_10062202 3300025901 Bacteria 2104
160 Ga0207680_10124999 3300025903 Bacteria 1687
161 Ga0207699_10033784 3300025906 Bacteria 2894
162 Ga0207645_10043877 3300025907 Bacteria 2862
163 Ga0207643_10021486 3300025908 Bacteria 3547
164 Ga0207643_10058417 3300025908 Bacteria 2198
165 Ga0207705_10017761 3300025909 Bacteria 5088
166 Ga0207705_10046763 3300025909 Bacteria 3111
167 Ga0207705_10161610 3300025909 Bacteria 1683
168 Ga0207684_10095667 3300025910 Bacteria 2534
169 Ga0207684_10118403 3300025910 Bacteria 2269
170 Ga0207707_10018936 3300025912 Bacteria 6002
171 Ga0207707_10019079 3300025912 Bacteria 5984
172 Ga0207707_10042619 3300025912 Bacteria 3960
173 Ga0207707_10091703 3300025912 Bacteria 2655
174 Ga0207707_10160399 3300025912 Bacteria 1966
175 Ga0207695_10032583 3300025913 Bacteria 5700
176 Ga0207693_10049386 3300025915 Bacteria 3304
177 Ga0207693_10071661 3300025915 Bacteria 2713
178 Ga0207693_10161121 3300025915 Bacteria 1765
179 Ga0207663_10015548 3300025916 Bacteria 4201
180 Ga0207660_10007579 3300025917 Bacteria 7024
181 Ga0207660_10008192 3300025917 Bacteria 6763
182 Ga0207660_10087079 3300025917 Bacteria 2307
183 Ga0207660_10115856 3300025917 Bacteria 2023
184 Ga0207657_10000610 3300025919 Bacteria 37898
185 Ga0207657_10004617 3300025919 Bacteria 14547
186 Ga0207657_10007328 3300025919 Bacteria 11317
187 Ga0207657_10049618 3300025919 Bacteria 3656
188 Ga0207657_10097756 3300025919 Bacteria 2441
189 Ga0207649_10137898 3300025920 Bacteria 1665
190 Ga0207652_10019771 3300025921 Bacteria 5543
191 Ga0207652_10037213 3300025921 Bacteria 4119
192 Ga0207652_10053730 3300025921 Bacteria 3460
193 Ga0207652_10076019 3300025921 Bacteria 2927
194 Ga0207652_10081627 3300025921 Bacteria 2828
195 Ga0207646_10015563 3300025922 Bacteria 7179
196 Ga0207687_10010483 3300025927 Bacteria 6054
197 Ga0207687_10137865 3300025927 Bacteria 1847
198 Ga0207700_10012504 3300025928 Bacteria 5478
199 Ga0207700_10030222 3300025928 Bacteria 3833
200 Ga0207664_10004972 3300025929 Bacteria 9039
201 Ga0207664_10190965 3300025929 Bacteria 1763
202 Ga0207690_10011965 3300025932 Bacteria 5188
203 Ga0207706_10081879 3300025933 Bacteria 2837
204 Ga0207686_10060522 3300025934 Bacteria 2397
205 Ga0207686_10126284 3300025934 Bacteria 1748
206 Ga0207709_10066222 3300025935 Bacteria 2275
207 Ga0207709_10122309 3300025935 Bacteria 1759
208 Ga0207665_10160966 3300025939 Bacteria 1614
209 Ga0207711_10025713 3300025941 Bacteria 4937
210 Ga0207661_10095713 3300025944 Bacteria 2483
211 Ga0207661_10102606 3300025944 Bacteria 2405
212 Ga0207661_10197538 3300025944 Bacteria 1767
213 Ga0207661_10261780 3300025944 Bacteria 1541
214 Ga0207661_10318567 3300025944 Bacteria 1397
215 Ga0207667_10026171 3300025949 Bacteria 6378
216 Ga0207667_10035290 3300025949 Bacteria 5365
217 Ga0207651_10070650 3300025960 Bacteria 2471
218 Ga0207712_10140529 3300025961 Bacteria 1852
219 Ga0207640_10191435 3300025981 Bacteria 1542
220 Ga0207658_10009347 3300025986 Bacteria 6649
221 Ga0207639_10320381 3300026041 Bacteria 1376
222 Ga0207678_10216016 3300026067 Bacteria 1641
223 Ga0207708_10008151 3300026075 Bacteria 7759
224 Ga0207702_10047920 3300026078 Bacteria 3602
225 Ga0207702_10223180 3300026078 Bacteria 1757
226 Ga0207648_10004050 3300026089 Bacteria 15221
227 Ga0207648_10219443 3300026089 Bacteria 1690
228 Ga0207674_10099429 3300026116 Bacteria 2892
229 Ga0207674_10144529 3300026116 Bacteria 2337
230 Ga0207683_10004835 3300026121 Bacteria 11599
231 Ga0207683_10126407 3300026121 Bacteria 2298
232 Ga0207698_10091354 3300026142 Bacteria 2492
233 Ga0207698_10127771 3300026142 Bacteria 2165
234 Ga0207428_10000222 3300027907 Bacteria 78747
235 Ga0265327_10025375 3300031251 Bacteria 3457
236 Ga0265327_10037149 3300031251 Bacteria 2670
237 Ga0265314_10147034 3300031711 Bacteria 1450
238 Ga0307416_100399438 3300032002 Bacteria 1411
239 Ga0373940_0049312 3300035088 Unclassified 1179
240 Ga0373936_0010423 3300035113 Bacteria 3507
241 Ga0373945_0015949 3300035116 Bacteria 2532
242 Ga0373945_0018727 3300035116 Bacteria 2357
243 Ga0373945_0025806 3300035116 Bacteria 2044
244 Ga0373943_0001433 3300035170 Bacteria 10766
245 Ga0373943_0012963 3300035170 Bacteria 3759
246 Ga0373946_0016433 3300035171 Bacteria 2819
247 Ga0373955_0168416 3300035172 Bacteria 1296
248 Ga0373931_0032404 3300035691 Bacteria 2704
249 Ga0373931_0056844 3300035691 Bacteria 2097
250 Ga0373935_0137133 3300035692 Bacteria 1649
251 Ga0373927_0041850 3300035695 Bacteria 2971
252 Ga0373947_0000920 3300035725 Bacteria 17863
253 Ga0373947_0037401 3300035725 Bacteria 2880
254 Ga0373947_0046000 3300035725 Bacteria 2612
255 Ga0373925_0010924 3300037068 Bacteria 6590
256 Ga0373925_0015648 3300037068 Bacteria 5489
257 Ga0373925_0035986 3300037068 Bacteria 3654
258 Ga0395899_0066081 3300037312 Bacteria 2656
259 Ga0395899_0158460 3300037312 Bacteria 1600
260 Ga0395900_0002584 3300037418 Bacteria 19827
261 Ga0395900_0002845 3300037418 Bacteria 18882
262 Ga0395900_0036550 3300037418 Bacteria 5063
263 Ga0395900_0044197 3300037418 Bacteria 4591
264 Ga0395900_0073794 3300037418 Bacteria 3508
265 Ga0395900_0413976 3300037418 Bacteria 1310
266 Ga0395898_0003052 3300037466 Bacteria 18969
267 Ga0395898_0005978 3300037466 Bacteria 13070
268 Ga0395898_0009809 3300037466 Bacteria 10035
269 Ga0395898_0020020 3300037466 Bacteria 6801
270 Ga0395905_0012888 3300037471 Bacteria 8036
271 Ga0395905_0135218 3300037471 Bacteria 2319
272 Ga0395905_0260714 3300037471 Bacteria 1618
273 Ga0395905_0286693 3300037471 Bacteria 1533
274 Ga0395901_0003307 3300038443 Bacteria 16233
275 Ga0395901_0053104 3300038443 Bacteria 4211
276 Ga0395901_0063892 3300038443 Bacteria 3831
277 Ga0395901_0064554 3300038443 Bacteria 3812
278 Ga0395901_0323112 3300038443 Bacteria 1596
279 Ga0395901_0368915 3300038443 Bacteria 1479
280 Ga0450923_001568 3300042125 Bacteria 3077
281 Ga0466965_0029916 3300044683 Bacteria 2652
282 Ga0466961_0003765 3300044693 Bacteria 9481
283 Ga0466961_0012947 3300044693 Bacteria 5335
284 Ga0466963_0003232 3300044694 Bacteria 9281
285 Ga0466963_0018587 3300044694 Bacteria 4348
286 Ga0466963_0054883 3300044694 Bacteria 2649
287 Ga0466963_0175863 3300044694 Bacteria 1493
288 Ga0466964_0040275 3300044706 Bacteria 1886
289 Ga0466971_0003271 3300044719 Bacteria 6914
290 Ga0466971_0035196 3300044719 Bacteria 2245
291 Ga0466957_0002386 3300044842 Bacteria 10090
292 Ga0466957_0011225 3300044842 Bacteria 5160
293 Ga0466957_0051472 3300044842 Bacteria 2507
294 Ga0466959_0006422 3300045049 Bacteria 8139
295 Ga0466958_0002914 3300045836 Bacteria 8743
296 Ga0466958_0012385 3300045836 Bacteria 4831
297 Ga0466958_0245256 3300045836 Bacteria 1145
298 Ga0466967_0008440 3300045976 Bacteria 7549
299 Ga0466967_0019956 3300045976 Bacteria 5403
300 Ga0466967_0075649 3300045976 Bacteria 3026
301 Ga0466967_0303145 3300045976 Bacteria 1537
302 Ga0495603_0001198 3300046455 Bacteria 15133
303 Ga0495629_0005183 3300046459 Bacteria 9753
304 Ga0495629_0192615 3300046459 Bacteria 1411
305 Ga0495641_0000331 3300046461 Bacteria 38511
306 Ga0495641_0001460 3300046461 Bacteria 20059
307 Ga0495641_0027517 3300046461 Bacteria 2764
308 Ga0495651_0023830 3300046462 Bacteria 4759
309 Ga0495651_0136406 3300046462 Bacteria 1784
310 Ga0495582_0000397 3300046473 Bacteria 23729
311 Ga0495582_0017946 3300046473 Bacteria 3868
312 Ga0495582_0081982 3300046473 Bacteria 1792
313 Ga0495639_0040884 3300046475 Bacteria 2087
314 Ga0495662_0001952 3300046476 Bacteria 10356
315 Ga0495664_0012466 3300046477 Bacteria 4816
316 Ga0495664_0014952 3300046477 Bacteria 4407
317 Ga0495664_0082682 3300046477 Bacteria 1926
318 Ga0495584_0047979 3300046491 Bacteria 2154
319 Ga0495594_0005945 3300046499 Bacteria 6274
320 Ga0495608_0063154 3300046511 Bacteria 2431
321 Ga0495618_0050449 3300046514 Bacteria 2628
322 Ga0495618_0095199 3300046514 Bacteria 1904
323 Ga0495630_0004168 3300046517 Bacteria 10126
324 Ga0495630_0010205 3300046517 Bacteria 6775
325 Ga0495630_0037756 3300046517 Bacteria 3612
326 Ga0495630_0050804 3300046517 Bacteria 3103
327 Ga0495631_0068855 3300046518 Bacteria 1531
328 Ga0495644_0051373 3300046523 Bacteria 1548
329 Ga0495666_0023295 3300046526 Bacteria 3062
330 Ga0495652_0157069 3300046529 Bacteria 1770
331 Ga0495665_0000713 3300046531 Bacteria 17149
332 Ga0495640_0017431 3300046533 Bacteria 5354
333 Ga0495609_0091547 3300046538 Bacteria 1323
334 Ga0495645_0040941 3300046543 Bacteria 3378
335 Ga0495667_0005500 3300046559 Bacteria 8559
336 Ga0495656_0031836 3300046615 Bacteria 2142
337 Ga0495635_0169917 3300046663 Bacteria 1483
338 Ga0495659_0059507 3300046664 Bacteria 1408
339 Ga0495657_0138265 3300046675 Bacteria 1520
340 Ga0495599_0063460 3300046678 Bacteria 2308
341 Ga0495623_0206893 3300046679 Bacteria 1125
342 Ga0495646_0072735 3300046680 Bacteria 2021
343 Ga0495647_0005342 3300046681 Bacteria 4206
344 Ga0495647_0017286 3300046681 Bacteria 2550
345 Ga0495658_0001079 3300046683 Bacteria 14352
346 Ga0495658_0004629 3300046683 Bacteria 6765
347 Ga0495658_0023571 3300046683 Bacteria 3268
348 Ga0495613_0003522 3300046689 Bacteria 11722
349 Ga0495624_0079435 3300046690 Bacteria 2034
350 Ga0495670_0130066 3300046691 Bacteria 1312
351 Ga0495581_0004936 3300047315 Bacteria 7720
352 Ga0495604_0033580 3300047317 Bacteria 4061
353 Ga0495604_0113120 3300047317 Bacteria 1976
354 Ga0495674_0027170 3300047319 Bacteria 5232
355 Ga0495674_0057706 3300047319 Bacteria 3397
356 Ga0495674_0125283 3300047319 Bacteria 2168
357 Ga0495676_0000268 3300047321 Bacteria 42236
358 Ga0495676_0125643 3300047321 Bacteria 1859
359 Ga0495680_0006633 3300047322 Bacteria 10715
360 Ga0495680_0021767 3300047322 Bacteria 5359
361 Ga0495675_0150729 3300047444 Bacteria 1437
362 Ga0495684_0002909 3300047471 Bacteria 13482
363 Ga0495684_0140589 3300047471 Bacteria 1810
364 Ga0495593_0038983 3300047673 Bacteria 2564
365 Ga0495593_0082374 3300047673 Bacteria 1663
366 Ga0495602_0109250 3300048088 Bacteria 2250
367 Ga0495614_0015590 3300048089 Bacteria 3313
368 Ga0496100_0010600 3300048903 Bacteria 5222
369 Ga0496100_0198538 3300048903 Unclassified 1460
370 Ga0496101_0014039 3300048904 Bacteria 5380
371 Ga0496101_0039448 3300048904 Bacteria 3358
372 Ga0496101_0061603 3300048904 Bacteria 2725
373 Ga0496101_0213927 3300048904 Bacteria 1494
374 Ga0496102_0009721 3300048905 Bacteria 8270
375 Ga0496102_0041227 3300048905 Bacteria 4178
376 Ga0496102_0068679 3300048905 Bacteria 3252
377 Ga0496103_0011777 3300048906 Bacteria 5188
378 Ga0496103_0023752 3300048906 Bacteria 3697
379 Ga0496104_0000381 3300048907 Bacteria 38927
380 Ga0496104_0004306 3300048907 Bacteria 12376
381 Ga0496104_0060400 3300048907 Bacteria 3591
382 Ga0496104_0066151 3300048907 Bacteria 3431
383 Ga0496104_0081688 3300048907 Bacteria 3082
384 Ga0496104_0256744 3300048907 Bacteria 1660
385 Ga0496105_0001183 3300048908 Bacteria 18155
386 Ga0496105_0013005 3300048908 Bacteria 6594
387 Ga0496105_0215434 3300048908 Unclassified 1564
388 Ga0496106_0025807 3300048909 Bacteria 4372
389 Ga0496106_0094431 3300048909 Bacteria 2312
390 Ga0496106_0137424 3300048909 Bacteria 1921
391 Ga0496107_0071223 3300048910 Bacteria 2525
392 Ga0496107_0104534 3300048910 Bacteria 2078
393 Ga0496107_0249792 3300048910 Bacteria 1320
394 Ga0496108_0001352 3300048911 Bacteria 19278
395 Ga0496109_0000533 3300048912 Bacteria 32234
396 Ga0496109_0001686 3300048912 Bacteria 18402
397 Ga0496109_0032903 3300048912 Bacteria 4664
398 Ga0496109_0043076 3300048912 Bacteria 4091
399 Ga0496109_0045794 3300048912 Bacteria 3971
400 Ga0496109_0114994 3300048912 Bacteria 2503
401 Ga0496110_0003303 3300048913 Bacteria 12313
402 Ga0496110_0006347 3300048913 Bacteria 9346
403 Ga0496110_0022630 3300048913 Bacteria 5338
404 Ga0496110_0064010 3300048913 Bacteria 3249
405 Ga0496110_0141794 3300048913 Bacteria 2172
406 Ga0496110_0246308 3300048913 Bacteria 1627
407 Ga0496111_0013798 3300048914 Bacteria 5507
408 Ga0496111_0023365 3300048914 Bacteria 4339
409 Ga0496111_0092266 3300048914 Bacteria 2219
410 Ga0496112_0000145 3300048915 Bacteria 44395
411 Ga0496112_0007867 3300048915 Bacteria 9492
412 Ga0496112_0033580 3300048915 Bacteria 4988
413 Ga0496112_0034183 3300048915 Bacteria 4946
414 Ga0496112_0041700 3300048915 Bacteria 4491
415 Ga0496112_0116914 3300048915 Bacteria 2637
416 Ga0496113_0079033 3300048916 Bacteria 2517
417 Ga0496114_0026001 3300048917 Bacteria 4789
418 Ga0496114_0118741 3300048917 Bacteria 2272
419 Ga0496114_0188968 3300048917 Bacteria 1801
420 Ga0496115_0014224 3300048918 Bacteria 6022
421 Ga0496115_0035521 3300048918 Bacteria 3943
422 Ga0496115_0066624 3300048918 Bacteria 2910
423 Ga0496115_0072793 3300048918 Bacteria 2788
424 Ga0496115_0159911 3300048918 Bacteria 1861
425 Ga0501038_0140709 3300049574 Bacteria 1974
426 Ga0501039_0004476 3300049575 Bacteria 10549
427 Ga0501040_0164045 3300049576 Bacteria 1571
428 Ga0501041_0029481 3300049577 Bacteria 3310
429 Ga0501047_0064525 3300049581 Bacteria 3532
430 Ga0501048_0110147 3300049582 Bacteria 1944
431 Ga0501067_0006133 3300049583 Bacteria 6665
432 Ga0501069_0001512 3300049585 Bacteria 11507
433 Ga0501070_0025060 3300049586 Bacteria 5002
434 Ga0501070_0176626 3300049586 Bacteria 1758
435 Ga0501071_0004604 3300049587 Bacteria 8749
436 Ga0501072_0007484 3300049588 Bacteria 8287
437 Ga0501073_0096130 3300049589 Bacteria 2057
438 Ga0501073_0214180 3300049589 Bacteria 1331
439 Ga0501074_0094887 3300049590 Bacteria 2136
440 Ga0501075_0036711 3300049591 Bacteria 3658
441 Ga0501076_0009272 3300049592 Bacteria 7260
442 Ga0501077_0001913 3300049593 Bacteria 12613
443 Ga0501079_0001953 3300049741 Bacteria 14766
444 Ga0501080_0004393 3300049742 Bacteria 12529
445 Ga0501080_0042342 3300049742 Bacteria 4241
446 Ga0501080_0109453 3300049742 Bacteria 2561
447 Ga0501081_0003898 3300049743 Bacteria 9555
448 Ga0501083_0078368 3300049744 Bacteria 2192
449 Ga0501045_0013791 3300049824 Bacteria 5714
450 nmdc:mga05p37_4573_c1 3300050507 Bacteria 4623
451 nmdc:mga09592_7053_c1 3300050508 Bacteria 9129
452 nmdc:mga08y16_20971_c1 3300050511 Bacteria 6898
453 nmdc:mga08x19_78759_c1 3300050514 Bacteria 2160
454 nmdc:mga0a205_102601_c1 3300050515 Bacteria 2759
455 Ga0495601_0062600 3300053077 Bacteria 2363
456 Ga0495601_0173776 3300053077 Unclassified 1408
457 Ga0495595_0016135 3300053084 Bacteria 3190
458 Ga0495619_0221839 3300053085 Bacteria 1309
459 Ga0501084_0120350 3300054114 Bacteria 2207
460 Ga0501084_0424060 3300054114 Bacteria 1125
461 Ga0587077_018373 3300059493 Bacteria 1203
462 Ga0501082_0294265 3300060353 Bacteria 1414
463 Ga0466962_0001750 3300061719 Bacteria 10213
464 Ga0530510_0018114 3300061734 Bacteria 4992
465 Ga0530510_0062815 3300061734 Bacteria 2689
466 Ga0081455_10086831
467 ARcpr5yngRDRAFT_c004515
468 ARCol0yngRDRAFT_1001200
469 Ga0058862_12710919
470 Ga0070658_10044074
471 Ga0070658_10069198
472 Ga0070658_10140898
473 Ga0070683_100006996
474 Ga0070683_100056954
475 Ga0070683_100099838
476 Ga0070690_100032249
477 Ga0070680_100003945
478 Ga0070680_100012249
479 Ga0070680_100020663
480 Ga0070680_100022764
481 Ga0070680_100122798
482 Ga0070682_100039065
483 Ga0070682_100044551
484 Ga0070682_100134275
485 Ga0070682_100247872
486 Ga0070660_100003045
487 Ga0070660_100004482
488 Ga0070660_100013775
489 Ga0070660_100089496
490 Ga0070661_100026657
491 Ga0070675_100082098
492 Ga0070671_100120422
493 Ga0070673_100038270
494 Ga0070688_100003618
495 Ga0070659_100004761
496 Ga0070659_100009271
497 Ga0070659_100317584
498 Ga0070667_100225779
499 Ga0070709_10179801
500 Ga0070713_100197649
501 Ga0070705_100104393
502 Ga0070705_100175435
503 Ga0070694_100194272
504 Ga0070708_100066112
505 Ga0070663_100025439
506 Ga0070663_100360238
507 Ga0070678_100013281
508 Ga0070678_100085967
509 Ga0070662_100086867
510 Ga0070681_10005926
511 Ga0070681_10021294
512 Ga0070681_10040786
513 Ga0070681_10080049
514 Ga0070681_10290242
515 Ga0070706_100276562
516 Ga0070707_100001756
517 Ga0070707_100281619
518 Ga0070707_100334306
519 Ga0070698_100123790
520 Ga0070698_100154179
521 Ga0070698_100222526
522 Ga0070698_100239143
523 Ga0070699_100090708
524 Ga0070679_100010448
525 Ga0070679_100017038
526 Ga0070679_100020245
527 Ga0070679_100021092
528 Ga0070679_100026998
529 Ga0070679_100031415
530 Ga0070679_100052059
531 Ga0070679_100142285
532 Ga0070684_100012196
533 Ga0070684_100066825
534 Ga0070697_100151861
535 Ga0070672_100091391
536 Ga0070686_100127530
537 Ga0070696_100135563
538 Ga0070693_100004438
539 Ga0070665_100043015
540 Ga0070665_100164666
541 Ga0070704_100088862
542 Ga0068855_100051284
543 Ga0068855_100086431
544 Ga0068855_100144941
545 Ga0068855_100309525
546 Ga0068857_100005172
547 Ga0068857_100124868
548 Ga0068852_100057470
549 Ga0068852_100074401
550 Ga0068864_100247421
551 Ga0068866_10029447
552 Ga0081455_10014205
553 Ga0081538_10088479
554 Ga0081539_10002764
555 Ga0075365_10158655
556 Ga0075364_10009980
557 Ga0075432_10002085
558 Ga0070715_10006511
559 Ga0070716_100040412
560 Ga0070712_100338054
561 Ga0097621_100032298
562 Ga0068871_100003811
563 Ga0075428_100000682
564 Ga0075433_10036448
565 Ga0075433_10056545
566 Ga0075429_100008062
567 Ga0075436_100008281
568 Ga0075436_100069408
569 Ga0099795_10027218
570 Ga0105240_10040342
571 Ga0105240_10079543
572 Ga0111539_10002341
573 Ga0105245_10000984
574 Ga0105245_10133297
575 Ga0105245_10142946
576 Ga0105245_10249091
577 Ga0114129_10005290
578 Ga0114129_10128994
579 Ga0105243_10013203
580 Ga0105243_10085962
581 Ga0105241_10196951
582 Ga0105248_10070131
583 Ga0105237_10031845
584 Ga0105237_10073211
585 Ga0105237_10210537
586 Ga0105239_10089521
587 Ga0105239_10186894
588 Ga0105239_10288553
589 Ga0105239_10624404
590 Ga0105246_10082707
591 Ga0157371_10298498
592 Ga0157370_10044925
593 Ga0157370_10135874
594 Ga0157370_10158068
595 Ga0157370_10182395
596 Ga0157370_10331199
597 Ga0157369_10018819
598 Ga0157369_10129167
599 Ga0157369_10135270
600 Ga0157374_10035543
601 Ga0157374_10152675
602 Ga0157378_10456962
603 Ga0163162_10317991
604 Ga0157372_10019525
605 Ga0157372_10068234
606 Ga0157372_10176524
607 Ga0157372_10208126
608 Ga0157375_10005283
609 Ga0157375_10045930
610 Ga0157375_10074336
611 Ga0157375_10263547
612 Ga0163163_10186468
613 Ga0163163_10289235
614 Ga0157377_10021249
615 Ga0157377_10023781
616 Ga0157377_10026815
617 Ga0157376_10022656
618 Ga0197907_10796261
619 Ga0206354_11548375
620 Ga0206353_10958814
621 Ga0206353_11165578
622 Ga0206353_11979020
623 Ga0207682_10051888
624 Ga0207688_10062202
625 Ga0207680_10124999
626 Ga0207699_10033784
627 Ga0207645_10043877
628 Ga0207643_10021486
629 Ga0207643_10058417
630 Ga0207705_10017761
631 Ga0207705_10046763
632 Ga0207705_10161610
633 Ga0207684_10095667
634 Ga0207684_10118403
635 Ga0207707_10018936
636 Ga0207707_10019079
637 Ga0207707_10042619
638 Ga0207707_10091703
639 Ga0207707_10160399
640 Ga0207695_10032583
641 Ga0207693_10049386
642 Ga0207693_10071661
643 Ga0207693_10161121
644 Ga0207663_10015548
645 Ga0207660_10007579
646 Ga0207660_10008192
647 Ga0207660_10087079
648 Ga0207660_10115856
649 Ga0207657_10000610
650 Ga0207657_10004617
651 Ga0207657_10007328
652 Ga0207657_10049618
653 Ga0207657_10097756
654 Ga0207649_10137898
655 Ga0207652_10019771
656 Ga0207652_10037213
657 Ga0207652_10053730
658 Ga0207652_10076019
659 Ga0207652_10081627
660 Ga0207646_10015563
661 Ga0207687_10010483
662 Ga0207687_10137865
663 Ga0207700_10012504
664 Ga0207700_10030222
665 Ga0207664_10004972
666 Ga0207664_10190965
667 Ga0207690_10011965
668 Ga0207706_10081879
669 Ga0207686_10060522
670 Ga0207686_10126284
671 Ga0207709_10066222
672 Ga0207709_10122309
673 Ga0207665_10160966
674 Ga0207711_10025713
675 Ga0207661_10095713
676 Ga0207661_10102606
677 Ga0207661_10197538
678 Ga0207661_10261780
679 Ga0207661_10318567
680 Ga0207667_10026171
681 Ga0207667_10035290
682 Ga0207651_10070650
683 Ga0207712_10140529
684 Ga0207640_10191435
685 Ga0207658_10009347
686 Ga0207639_10320381
687 Ga0207678_10216016
688 Ga0207708_10008151
689 Ga0207702_10047920
690 Ga0207702_10223180
691 Ga0207648_10004050
692 Ga0207648_10219443
693 Ga0207674_10099429
694 Ga0207674_10144529
695 Ga0207683_10004835
696 Ga0207683_10126407
697 Ga0207698_10091354
698 Ga0207698_10127771
699 Ga0207428_10000222
700 Ga0265327_10025375
701 Ga0265327_10037149
702 Ga0265314_10147034
703 Ga0307416_100399438
704 Ga0373940_0049312
705 Ga0373936_0010423
706 Ga0373945_0015949
707 Ga0373945_0018727
708 Ga0373945_0025806
709 Ga0373943_0001433
710 Ga0373943_0012963
711 Ga0373946_0016433
712 Ga0373955_0168416
713 Ga0373931_0032404
714 Ga0373931_0056844
715 Ga0373935_0137133
716 Ga0373927_0041850
717 Ga0373947_0000920
718 Ga0373947_0037401
719 Ga0373947_0046000
720 Ga0373925_0010924
721 Ga0373925_0015648
722 Ga0373925_0035986
723 Ga0395899_0066081
724 Ga0395899_0158460
725 Ga0395900_0002584
726 Ga0395900_0002845
727 Ga0395900_0036550
728 Ga0395900_0044197
729 Ga0395900_0073794
730 Ga0395900_0413976
731 Ga0395898_0003052
732 Ga0395898_0005978
733 Ga0395898_0009809
734 Ga0395898_0020020
735 Ga0395905_0012888
736 Ga0395905_0135218
737 Ga0395905_0260714
738 Ga0395905_0286693
739 Ga0395901_0003307
740 Ga0395901_0053104
741 Ga0395901_0063892
742 Ga0395901_0064554
743 Ga0395901_0323112
744 Ga0395901_0368915
745 Ga0450923_001568
746 Ga0466965_0029916
747 Ga0466961_0003765
748 Ga0466961_0012947
749 Ga0466963_0003232
750 Ga0466963_0018587
751 Ga0466963_0054883
752 Ga0466963_0175863
753 Ga0466964_0040275
754 Ga0466971_0003271
755 Ga0466971_0035196
756 Ga0466957_0002386
757 Ga0466957_0011225
758 Ga0466957_0051472
759 Ga0466959_0006422
760 Ga0466958_0002914
761 Ga0466958_0012385
762 Ga0466958_0245256
763 Ga0466967_0008440
764 Ga0466967_0019956
765 Ga0466967_0075649
766 Ga0466967_0303145
767 Ga0495603_0001198
768 Ga0495629_0005183
769 Ga0495629_0192615
770 Ga0495641_0000331
771 Ga0495641_0001460
772 Ga0495641_0027517
773 Ga0495651_0023830
774 Ga0495651_0136406
775 Ga0495582_0000397
776 Ga0495582_0017946
777 Ga0495582_0081982
778 Ga0495639_0040884
779 Ga0495662_0001952
780 Ga0495664_0012466
781 Ga0495664_0014952
782 Ga0495664_0082682
783 Ga0495584_0047979
784 Ga0495594_0005945
785 Ga0495608_0063154
786 Ga0495618_0050449
787 Ga0495618_0095199
788 Ga0495630_0004168
789 Ga0495630_0010205
790 Ga0495630_0037756
791 Ga0495630_0050804
792 Ga0495631_0068855
793 Ga0495644_0051373
794 Ga0495666_0023295
795 Ga0495652_0157069
796 Ga0495665_0000713
797 Ga0495640_0017431
798 Ga0495609_0091547
799 Ga0495645_0040941
800 Ga0495667_0005500
801 Ga0495656_0031836
802 Ga0495635_0169917
803 Ga0495659_0059507
804 Ga0495657_0138265
805 Ga0495599_0063460
806 Ga0495623_0206893
807 Ga0495646_0072735
808 Ga0495647_0005342
809 Ga0495647_0017286
810 Ga0495658_0001079
811 Ga0495658_0004629
812 Ga0495658_0023571
813 Ga0495613_0003522
814 Ga0495624_0079435
815 Ga0495670_0130066
816 Ga0495581_0004936
817 Ga0495604_0033580
818 Ga0495604_0113120
819 Ga0495674_0027170
820 Ga0495674_0057706
821 Ga0495674_0125283
822 Ga0495676_0000268
823 Ga0495676_0125643
824 Ga0495680_0006633
825 Ga0495680_0021767
826 Ga0495675_0150729
827 Ga0495684_0002909
828 Ga0495684_0140589
829 Ga0495593_0038983
830 Ga0495593_0082374
831 Ga0495602_0109250
832 Ga0495614_0015590
833 Ga0496100_0010600
834 Ga0496100_0198538
835 Ga0496101_0014039
836 Ga0496101_0039448
837 Ga0496101_0061603
838 Ga0496101_0213927
839 Ga0496102_0009721
840 Ga0496102_0041227
841 Ga0496102_0068679
842 Ga0496103_0011777
843 Ga0496103_0023752
844 Ga0496104_0000381
845 Ga0496104_0004306
846 Ga0496104_0060400
847 Ga0496104_0066151
848 Ga0496104_0081688
849 Ga0496104_0256744
850 Ga0496105_0001183
851 Ga0496105_0013005
852 Ga0496105_0215434
853 Ga0496106_0025807
854 Ga0496106_0094431
855 Ga0496106_0137424
856 Ga0496107_0071223
857 Ga0496107_0104534
858 Ga0496107_0249792
859 Ga0496108_0001352
860 Ga0496109_0000533
861 Ga0496109_0001686
862 Ga0496109_0032903
863 Ga0496109_0043076
864 Ga0496109_0045794
865 Ga0496109_0114994
866 Ga0496110_0003303
867 Ga0496110_0006347
868 Ga0496110_0022630
869 Ga0496110_0064010
870 Ga0496110_0141794
871 Ga0496110_0246308
872 Ga0496111_0013798
873 Ga0496111_0023365
874 Ga0496111_0092266
875 Ga0496112_0000145
876 Ga0496112_0007867
877 Ga0496112_0033580
878 Ga0496112_0034183
879 Ga0496112_0041700
880 Ga0496112_0116914
881 Ga0496113_0079033
882 Ga0496114_0026001
883 Ga0496114_0118741
884 Ga0496114_0188968
885 Ga0496115_0014224
886 Ga0496115_0035521
887 Ga0496115_0066624
888 Ga0496115_0072793
889 Ga0496115_0159911
890 Ga0501038_0140709
891 Ga0501039_0004476
892 Ga0501040_0164045
893 Ga0501041_0029481
894 Ga0501047_0064525
895 Ga0501048_0110147
896 Ga0501067_0006133
897 Ga0501069_0001512
898 Ga0501070_0025060
899 Ga0501070_0176626
900 Ga0501071_0004604
901 Ga0501072_0007484
902 Ga0501073_0096130
903 Ga0501073_0214180
904 Ga0501074_0094887
905 Ga0501075_0036711
906 Ga0501076_0009272
907 Ga0501077_0001913
908 Ga0501079_0001953
909 Ga0501080_0004393
910 Ga0501080_0042342
911 Ga0501080_0109453
912 Ga0501081_0003898
913 Ga0501083_0078368
914 Ga0501045_0013791
915 nmdc:mga05p37_4573_c1
916 nmdc:mga09592_7053_c1
917 nmdc:mga08y16_20971_c1
918 nmdc:mga08x19_78759_c1
919 nmdc:mga0a205_102601_c1
920 Ga0495601_0062600
921 Ga0495601_0173776
922 Ga0495595_0016135
923 Ga0495619_0221839
924 Ga0501084_0120350
925 Ga0501084_0424060
926 Ga0587077_018373
927 Ga0501082_0294265
928 Ga0466962_0001750
929 Ga0530510_0018114
930 Ga0530510_0062815

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02608

Bmp

ABC transporter substrate-binding protein PnrA-like

9

296

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pi5-assembly4.cif.gz_D the evolving story of atzt, a periplasmic binding protein 0.9743 46 375
3s99-assembly1.cif.gz_A crystal structure of a basic membrane lipoprotein from brucella melitensis, iodide soak 0.9722 48 378
3s99-assembly1.cif.gz_A crystal structure of a basic membrane lipoprotein from brucella melitensis, iodide soak 0.9693 48 378
6pi5-assembly4.cif.gz_D the evolving story of atzt, a periplasmic binding protein 0.9657 46 375
7x0r-assembly1.cif.gz_A crystal structure of substrate binding protein lbp complexed wtih guanosine from clostridium thermocellum 0.922 48 336
ID Description Score Start End Superfamily
3s99A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9829 48 306 3.40.50.2300
3s99A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9687 48 306 3.40.50.2300
3s99A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9536 155 378 3.40.50.2300
3s99A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.944 155 378 3.40.50.2300
2fqwA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.88 48 152 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A356AUD0-F1-model_v4 BMP family ABC transporter substrate-binding protein 0.9903 168 378 GO:0005886
AF-A0A0S7YW74-F1-model_v4 ABC transporter substrate-binding protein PnrA-like domain-containing protein 0.9825 47 378 GO:0005886
AF-A0A536H3A4-F1-model_v4 BMP family ABC transporter substrate-binding protein 0.9818 125 380 GO:0005886
AF-A0A3G9J5A1-F1-model_v4 ABC transporter substrate-binding protein PnrA-like domain-containing protein 0.9815 121 379 GO:0005886
AF-A0A7V2UIT2-F1-model_v4 BMP family ABC transporter substrate-binding protein 0.9814 72 379 GO:0005886

Map