F449379

General Info

Members Datasets Scaffolds Average Seq Length
464 388 928 242

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0357293|Ga0496126_0357293_181_963
Length 260
Sequence VFSARRAAKALTESQPMQLRFVGCGDAFGSGGRLNTCFHVSGRAANFLIDCGASALPALKRLDIDCNDIDLILVTHFHGDHFAGLPFFLLDAQFARRTRPLTIAGPQGIETKLTQVMEALFEHSSRTQQRFELNIVELVPGQSQSFGAVTVTPFPVVHGESGGPFLAYRIEAEGRTLAYSADTEWTETLIPLAHGTDLFIAEAYMYEKVVKNHLSLKTLEQHLPDIGTKRLVLTHMSDDVLSRLDDIKHLAAEDGMVLVF

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
40 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
59 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
60 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
61 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
62 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
100 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
101 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
102 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
103 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
120 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
121 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
122 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
123 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
124 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
125 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
126 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
131 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
141 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
142 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
147 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
150 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
151 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
179 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
180 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
181 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
182 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
183 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
184 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
185 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
186 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
187 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
188 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
189 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
190 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
191 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
192 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
193 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
194 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
195 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
196 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
197 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
198 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
199 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
200 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
201 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
202 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
203 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
204 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
205 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
206 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
207 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
208 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
210 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
211 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
212 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
213 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
214 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
215 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
216 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
217 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
218 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
219 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
220 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
221 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
222 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
223 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
224 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
225 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
226 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
227 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
228 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
229 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
230 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
231 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
232 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
233 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
234 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
235 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
236 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
237 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
238 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
239 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
240 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
241 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
242 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
243 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
244 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
245 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
246 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
247 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
248 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
249 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
250 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
251 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
252 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
253 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
254 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
255 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
256 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
257 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
258 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
259 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
260 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
261 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
262 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
263 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
264 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
265 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
266 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
267 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
268 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
269 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
270 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
271 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
272 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
273 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
274 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
275 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
276 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
277 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
278 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
279 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
280 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
281 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
282 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
283 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
284 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
285 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
286 2904699407
287 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
288 2906610324
289 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
290 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
291 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
292 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
293 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
294 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
295 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
296 2922368715
297 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
298 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
299 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
300 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
301 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
302 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
303 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
304 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
305 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
306 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
307 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
308 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
309 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
310 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
311 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
312 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
313 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
314 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
315 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
316 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
317 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
318 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
319 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
320 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
321 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
322 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
323 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
324 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
325 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
326 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
327 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
328 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
329 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
330 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
331 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
332 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
333 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
334 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
335 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
336 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
337 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
338 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
339 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
340 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
341 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
342 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
343 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
344 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
345 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
346 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
347 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
348 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
349 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
350 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
351 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
352 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
353 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
354 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
355 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
356 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
357 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
358 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
359 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
360 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
361 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
362 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
363 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
364 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
365 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
366 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
367 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
368 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
369 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
370 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
371 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
372 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
373 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
374 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
375 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
376 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
377 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
378 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
379 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
380 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
381 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
382 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
383 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
384 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
385 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
386 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
387 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
388 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 61.82
Metatranscriptomes 0
Isolates 38.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.09
Nodule 31.68
Rhizoplane 4.09
Rhizosphere 33.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0357293 3300048929 Bacteria 1194
2 JGI25153J46596_10002724 3300003215 Bacteria 10071
3 JGI25404J52841_10026773 3300003659 Bacteria 1241
4 Ga0055526_1033133 3300003771 Bacteria 1440
5 Ga0055524_1056225 3300003775 Bacteria 849
6 Ga0055531_10006527 3300003794 Bacteria 6609
7 Ga0065165_1002780 3300005262 Bacteria 13845
8 Ga0065165_1004042 3300005262 Bacteria 9532
9 Ga0070683_100031957 3300005329 Bacteria 4790
10 Ga0070680_100031076 3300005336 Bacteria 4292
11 Ga0068868_100515999 3300005338 Bacteria 1049
12 Ga0070668_100292484 3300005347 Bacteria 1364
13 Ga0070671_100308929 3300005355 Bacteria 1347
14 Ga0070709_10396256 3300005434 Bacteria 1030
15 Ga0070714_100029988 3300005435 Bacteria 4525
16 Ga0070713_100385835 3300005436 Bacteria 1306
17 Ga0070663_100292665 3300005455 Bacteria 1301
18 Ga0070681_10033862 3300005458 Bacteria 5129
19 Ga0070679_100076441 3300005530 Bacteria 3338
20 Ga0070684_100040027 3300005535 Bacteria 4033
21 Ga0068853_100205944 3300005539 Bacteria 1792
22 Ga0068853_100304177 3300005539 Bacteria 1475
23 Ga0068855_100055564 3300005563 Bacteria 4649
24 Ga0068856_100162266 3300005614 Bacteria 2246
25 Ga0068852_100421468 3300005616 Bacteria 1317
26 Ga0068863_100385662 3300005841 Bacteria 1369
27 Ga0081455_10036986 3300005937 Bacteria 4340
28 Ga0081455_10070988 3300005937 Bacteria 2889
29 Ga0081538_10088138 3300005981 Bacteria 1616
30 Ga0081540_1002008 3300005983 Bacteria 16982
31 Ga0081540_1004358 3300005983 Bacteria 10825
32 Ga0081540_1058758 3300005983 Bacteria 1850
33 Ga0081540_1069966 3300005983 Bacteria 1628
34 Ga0081540_1150084 3300005983 Bacteria 921
35 Ga0081539_10000902 3300005985 Bacteria 56412
36 Ga0070717_10089741 3300006028 Bacteria 2593
37 Ga0070717_10127050 3300006028 Bacteria 2189
38 Ga0075365_10025042 3300006038 Bacteria 3773
39 Ga0075365_10060957 3300006038 Bacteria 2518
40 Ga0075368_10002408 3300006042 Bacteria 6098
41 Ga0075364_10089293 3300006051 Bacteria 2044
42 Ga0070712_100281435 3300006175 Bacteria 1340
43 Ga0075362_10014331 3300006177 Bacteria 3196
44 Ga0075367_10079893 3300006178 Bacteria 1977
45 Ga0075369_10116858 3300006186 Bacteria 1205
46 Ga0075370_10043541 3300006353 Bacteria 2537
47 Ga0075436_100069190 3300006914 Bacteria 2439
48 Ga0099825_1045439 3300006941 Bacteria 1104
49 Ga0099823_1042897 3300006944 Bacteria 3145
50 Ga0099795_10061091 3300007788 Bacteria 1398
51 Ga0105250_10101363 3300009092 Bacteria 1175
52 Ga0105240_10019882 3300009093 Bacteria 8969
53 Ga0105240_10098933 3300009093 Bacteria 3551
54 Ga0105240_10143012 3300009093 Bacteria 2858
55 Ga0105240_10328349 3300009093 Bacteria 1741
56 Ga0105240_11008763 3300009093 Bacteria 890
57 Ga0105247_10122301 3300009101 Bacteria 1688
58 Ga0105243_10202319 3300009148 Bacteria 1742
59 Ga0105243_10669633 3300009148 Bacteria 1008
60 Ga0105241_10109593 3300009174 Bacteria 2208
61 Ga0105241_10783675 3300009174 Bacteria 877
62 Ga0105237_10590556 3300009545 Bacteria 1117
63 Ga0105237_10720577 3300009545 Bacteria 1004
64 Ga0105237_10727644 3300009545 Bacteria 999
65 Ga0105238_10794089 3300009551 Bacteria 962
66 Ga0099796_10115708 3300010159 Bacteria 1025
67 Ga0105246_10159510 3300011119 Bacteria 1717
68 Ga0157370_10232227 3300013104 Bacteria 1707
69 Ga0157369_10004460 3300013105 Bacteria 16494
70 Ga0157378_10268087 3300013297 Bacteria 1641
71 Ga0157372_10045484 3300013307 Bacteria 4870
72 Ga0163163_10149952 3300014325 Bacteria 2376
73 Ga0157379_10331322 3300014968 Bacteria 1391
74 Ga0157376_10503268 3300014969 Bacteria 1191
75 Ga0214544_1000003 3300021320 Bacteria 643752
76 Ga0214542_1000003 3300021321 Bacteria 435700
77 Ga0214545_1000004 3300021324 Bacteria 453352
78 Ga0214543_1000007 3300021327 Bacteria 414744
79 Ga0209677_100434 3300025253 Bacteria 24570
80 Ga0209233_1001815 3300025261 Bacteria 8212
81 Ga0209233_1008918 3300025261 Bacteria 3073
82 Ga0209455_1002067 3300025272 Bacteria 8110
83 Ga0209455_1025985 3300025272 Bacteria 1057
84 Ga0209564_1010640 3300025295 Bacteria 4210
85 Ga0209758_1000015 3300025297 Bacteria 851943
86 Ga0209758_1000389 3300025297 Bacteria 75919
87 Ga0209758_1001056 3300025297 Bacteria 36006
88 Ga0209256_1016418 3300025299 Bacteria 2525
89 Ga0209256_1026032 3300025299 Bacteria 1693
90 Ga0207426_1000380 3300025302 Bacteria 76046
91 Ga0209257_1001378 3300025304 Bacteria 29161
92 Ga0209257_1009836 3300025304 Bacteria 5003
93 Ga0207697_10083365 3300025315 Bacteria 1349
94 Ga0207692_10047480 3300025898 Bacteria 2156
95 Ga0207710_10173089 3300025900 Bacteria 1056
96 Ga0207688_10102200 3300025901 Bacteria 1656
97 Ga0207647_10001208 3300025904 Bacteria 19845
98 Ga0207647_10114833 3300025904 Bacteria 1590
99 Ga0207647_10212150 3300025904 Bacteria 1118
100 Ga0207699_10024886 3300025906 Bacteria 3279
101 Ga0207654_10171867 3300025911 Bacteria 1408
102 Ga0207707_10001012 3300025912 Bacteria 26958
103 Ga0207695_10106934 3300025913 Bacteria 2783
104 Ga0207695_10212399 3300025913 Bacteria 1845
105 Ga0207695_10578122 3300025913 Bacteria 1005
106 Ga0207660_10024162 3300025917 Bacteria 4111
107 Ga0207681_10477613 3300025923 Bacteria 1018
108 Ga0207694_10057116 3300025924 Bacteria 3033
109 Ga0207694_10077784 3300025924 Bacteria 2600
110 Ga0207700_10292874 3300025928 Bacteria 1403
111 Ga0207664_10003852 3300025929 Bacteria 10076
112 Ga0207706_10139948 3300025933 Bacteria 2129
113 Ga0207686_10491730 3300025934 Bacteria 950
114 Ga0207689_10054191 3300025942 Bacteria 3304
115 Ga0207661_10000462 3300025944 Bacteria 26255
116 Ga0207667_10023472 3300025949 Bacteria 6791
117 Ga0207667_10038547 3300025949 Bacteria 5102
118 Ga0207667_10487250 3300025949 Bacteria 1251
119 Ga0207640_10050268 3300025981 Bacteria 2703
120 Ga0207677_10254221 3300026023 Bacteria 1429
121 Ga0207639_10352905 3300026041 Bacteria 1314
122 Ga0207639_10355919 3300026041 Bacteria 1309
123 Ga0207678_10234708 3300026067 Bacteria 1570
124 Ga0207702_10078592 3300026078 Bacteria 2857
125 Ga0207641_10137064 3300026088 Bacteria 2204
126 Ga0207676_10084335 3300026095 Bacteria 2590
127 Ga0207675_100660575 3300026118 Bacteria 1052
128 Ga0207683_10296226 3300026121 Bacteria 1480
129 Ga0207683_10325744 3300026121 Bacteria 1408
130 Ga0207698_10127697 3300026142 Bacteria 2166
131 Ga0209389_1000168 3300027296 Bacteria 52990
132 Ga0209389_1000180 3300027296 Bacteria 49331
133 Ga0209589_1000570 3300027357 Bacteria 52985
134 Ga0209489_101190 3300027361 Bacteria 52985
135 Ga0209489_101411 3300027361 Bacteria 49331
136 Ga0209700_101443 3300027363 Bacteria 49345
137 Ga0265328_10024177 3300031239 Bacteria 2297
138 Ga0307513_10062632 3300031456 Bacteria 3930
139 Ga0307509_10175518 3300031507 Bacteria 2016
140 Ga0265313_10116798 3300031595 Bacteria 1168
141 Ga0307508_10024306 3300031616 Bacteria 5498
142 Ga0265314_10006019 3300031711 Bacteria 10810
143 Ga0307516_10079013 3300031730 Bacteria 3135
144 Ga0307405_10293550 3300031731 Bacteria 1230
145 Ga0307507_10189209 3300033179 Bacteria 1451
146 Ga0307510_10076470 3300033180 Bacteria 3293
147 Ga0307510_10093573 3300033180 Bacteria 2836
148 Ga0315911_1000017 3300033442 Bacteria 161609
149 Ga0373925_0294917 3300037068 Bacteria 1308
150 Ga0395900_0000937 3300037418 Bacteria 38218
151 Ga0395900_0013063 3300037418 Bacteria 8486
152 Ga0395900_0214916 3300037418 Bacteria 1941
153 Ga0395900_0322035 3300037418 Bacteria 1526
154 Ga0395898_0011586 3300037466 Bacteria 9156
155 Ga0395898_0024070 3300037466 Bacteria 6146
156 Ga0395898_0149521 3300037466 Bacteria 2235
157 Ga0395905_0008317 3300037471 Bacteria 10237
158 Ga0395905_0519735 3300037471 Bacteria 1091
159 Ga0395905_0557223 3300037471 Bacteria 1047
160 Ga0395901_0056407 3300038443 Bacteria 4086
161 Ga0395901_0197670 3300038443 Bacteria 2108
162 Ga0395901_0320497 3300038443 Bacteria 1604
163 Ga0451787_083916 3300041441 Bacteria 898
164 Ga0451807_0364670 3300041486 Bacteria 888
165 Ga0451833_0927339 3300041491 Bacteria 1339
166 Ga0439455_0090730 3300042012 Bacteria 838
167 Ga0439459_0066547 3300042438 Bacteria 825
168 Ga0466969_0017721 3300044656 Bacteria 3716
169 Ga0466972_0000171 3300044658 Bacteria 50915
170 Ga0466965_0033206 3300044683 Bacteria 2522
171 Ga0466965_0078318 3300044683 Bacteria 1669
172 Ga0466966_0000287 3300044684 Bacteria 33106
173 Ga0466961_0000126 3300044693 Bacteria 51032
174 Ga0466963_0013151 3300044694 Bacteria 5077
175 Ga0466963_0025316 3300044694 Bacteria 3784
176 Ga0466964_0058352 3300044706 Bacteria 1600
177 Ga0466968_0142233 3300044735 Bacteria 1098
178 Ga0466957_0083305 3300044842 Bacteria 1995
179 Ga0466960_0209454 3300044901 Bacteria 1068
180 Ga0466959_0003926 3300045049 Bacteria 9876
181 Ga0466967_0020160 3300045976 Bacteria 5380
182 Ga0495603_0018353 3300046455 Bacteria 4232
183 Ga0495638_0018982 3300046460 Bacteria 4554
184 Ga0495605_0062577 3300046474 Bacteria 1778
185 Ga0495606_0122131 3300046507 Bacteria 1558
186 Ga0495606_0198746 3300046507 Bacteria 1144
187 Ga0495616_0045329 3300046513 Bacteria 2226
188 Ga0495620_0135516 3300046515 Bacteria 965
189 Ga0495643_0007944 3300046522 Bacteria 6767
190 Ga0495648_0093161 3300046524 Bacteria 1681
191 Ga0495625_0047118 3300046660 Bacteria 3109
192 Ga0495625_0100049 3300046660 Bacteria 1993
193 Ga0495625_0110135 3300046660 Bacteria 1883
194 Ga0495588_0005976 3300046674 Bacteria 5458
195 Ga0495671_0116582 3300046692 Bacteria 1304
196 Ga0495581_0182836 3300047315 Bacteria 1226
197 Ga0495676_0076061 3300047321 Bacteria 2565
198 Ga0495683_0161543 3300047323 Bacteria 1036
199 Ga0495687_065314 3300047443 Bacteria 1482
200 Ga0495673_0022363 3300047469 Bacteria 3101
201 Ga0495602_0214510 3300048088 Bacteria 1458
202 Ga0496100_0100995 3300048903 Bacteria 1988
203 Ga0496102_0019762 3300048905 Bacteria 5937
204 Ga0496102_0289460 3300048905 Bacteria 1544
205 Ga0496102_0303766 3300048905 Bacteria 1504
206 Ga0496102_0508569 3300048905 Bacteria 1127
207 Ga0496103_0041417 3300048906 Bacteria 2831
208 Ga0496104_0014354 3300048907 Bacteria 7155
209 Ga0496105_0004596 3300048908 Bacteria 10399
210 Ga0496105_0016902 3300048908 Bacteria 5838
211 Ga0496106_0388692 3300048909 Bacteria 1121
212 Ga0496108_0095878 3300048911 Bacteria 2526
213 Ga0496108_0228475 3300048911 Bacteria 1618
214 Ga0496112_0722176 3300048915 Bacteria 924
215 Ga0496113_0029699 3300048916 Bacteria 3951
216 Ga0496113_0122933 3300048916 Bacteria 2031
217 Ga0496115_0041722 3300048918 Bacteria 3653
218 Ga0496115_0057548 3300048918 Bacteria 3127
219 Ga0496116_0053113 3300048919 Bacteria 2679
220 Ga0496116_0063780 3300048919 Bacteria 2372
221 Ga0496116_0124713 3300048919 Bacteria 1482
222 Ga0496117_0044061 3300048920 Bacteria 3235
223 Ga0496117_0156477 3300048920 Bacteria 1341
224 Ga0496117_0179693 3300048920 Bacteria 1218
225 Ga0496117_0191287 3300048920 Bacteria 1165
226 Ga0496118_0021634 3300048921 Bacteria 5653
227 Ga0496118_0099007 3300048921 Bacteria 1978
228 Ga0496118_0153464 3300048921 Bacteria 1437
229 Ga0496119_0030902 3300048922 Bacteria 3602
230 Ga0496121_0000416 3300048924 Bacteria 84469
231 Ga0496121_0011106 3300048924 Bacteria 10051
232 Ga0496121_0015708 3300048924 Bacteria 7892
233 Ga0496121_0072330 3300048924 Bacteria 2768
234 Ga0496121_0134745 3300048924 Bacteria 1842
235 Ga0496123_0101046 3300048926 Bacteria 1678
236 Ga0496125_0035946 3300048928 Bacteria 4334
237 Ga0496126_0476003 3300048929 Bacteria 1001
238 Ga0496126_0478141 3300048929 Bacteria 998
239 Ga0501047_0182866 3300049581 Bacteria 1962
240 Ga0501070_0017328 3300049586 Bacteria 6048
241 Ga0501044_0254998 3300049823 Bacteria 1694
242 nmdc:mga03n38_27115_c1 3300050490 Bacteria 2373
243 nmdc:mga00v17_119808_c1 3300050491 Bacteria 1675
244 nmdc:mga00v17_32231_c1 3300050491 Bacteria 3096
245 nmdc:mga0yw44_14698_c1 3300050492 Bacteria 4166
246 nmdc:mga0k408_32125_c1 3300050493 Bacteria 2999
247 nmdc:mga08x19_60206_c1 3300050514 Bacteria 2459
248 nmdc:mga0sz30_33721_c1 3300050516 Bacteria 2129
249 Ga0500610_0074278 3300053079 Bacteria 1773
250 Ga0500578_0074537 3300053086 Bacteria 2162
251 Ga0500578_0222436 3300053086 Bacteria 1147
252 Ga0500643_000278 3300053087 Bacteria 44354
253 Ga0500583_0048514 3300053092 Bacteria 1960
254 Ga0500566_0002106 3300053094 Bacteria 11741
255 Ga0500566_0004396 3300053094 Bacteria 8415
256 Ga0500566_0087435 3300053094 Bacteria 1726
257 Ga0500566_0088900 3300053094 Bacteria 1709
258 Ga0500640_030834 3300053095 Bacteria 2349
259 Ga0500641_0017084 3300053096 Bacteria 2708
260 Ga0500554_000740 3300053102 Bacteria 6582
261 Ga0500555_001487 3300053103 Bacteria 7124
262 Ga0500557_000028 3300053105 Bacteria 78414
263 Ga0500562_006678 3300053108 Bacteria 2908
264 Ga0500572_013804 3300053111 Bacteria 2006
265 Ga0500592_021247 3300053116 Bacteria 1044
266 Ga0500595_000653 3300053119 Bacteria 20857
267 Ga0500607_068036 3300053121 Bacteria 1843
268 Ga0500608_056826 3300053122 Bacteria 1875
269 Ga0500642_0000590 3300053130 Bacteria 10893
270 Ga0500559_0131615 3300053136 Bacteria 1168
271 Ga0500577_0065705 3300053142 Bacteria 1409
272 Ga0500585_040537 3300053144 Bacteria 1641
273 Ga0500588_0067030 3300053146 Bacteria 1167
274 Ga0500590_192955 3300053148 Bacteria 870
275 Ga0500603_001985 3300053150 Bacteria 4538
276 Ga0500616_0097299 3300053153 Bacteria 1445
277 Ga0500620_043073 3300053155 Bacteria 1489
278 Ga0500622_0038166 3300053156 Bacteria 2506
279 Ga0500636_0000059 3300053177 Bacteria 52601
280 Ga0500636_0141591 3300053177 Bacteria 1330
281 Ga0500637_0002557 3300053178 Bacteria 8127
282 Ga0500637_0214007 3300053178 Bacteria 1092
283 Ga0500625_083066 3300053729 Bacteria 1392
284 Ga0500645_083019 3300053730 Bacteria 913
285 Ga0530510_0172389 3300061734 Bacteria 1603
286 2507505722 2507262055 Bacteria 8048963
287 2508539921 2508501009 Bacteria 7784016
288 2508695986 2508501042 Bacteria 8719808
289 2511397036 2511231028 Bacteria 8046582
290 2513626658 2513237092 Bacteria 8341956
291 2513648142 2513237095 Bacteria 8976980
292 2513657403 2513237096 Bacteria 8722461
293 2513677978 2513237098 Bacteria 9902361
294 2513705499 2513237102 Bacteria 7703324
295 2513715567 2513237104 Bacteria 10034502
296 2513857167 2513237137 Bacteria 9558895
297 2513875699 2513237139 Bacteria 8737671
298 2513916656 2513237145 Bacteria 8979722
299 2514016365 2513237161 Bacteria 8871253
300 2515627750 2515154112 Bacteria 8294334
301 2517106998 2517093001 Bacteria 9002274
302 2517888110 2517572143 Bacteria 9484767
303 2524435609 2524023205 Bacteria 8918781
304 2524468342 2524023210 Bacteria 9029266
305 2524533291 2524023228 Bacteria 10118060
306 2528858119 2528768022 Bacteria 10457665
307 2617352930 2617270735 Bacteria 9163226
308 2617374253 2617270741 Bacteria 8201522
309 2745079865 2744054633 Bacteria 8678936
310 2793063227 2791355196 Bacteria 7323613
311 2793073989 2791355197 Bacteria 8420563
312 2805919375 2802429603 Bacteria 8777136
313 2818237142 2816332527 Bacteria 8933356
314 2824608405 2824600985 Bacteria 8488197
315 2824617433 2824609381 Bacteria 8672835
316 2824625074 2824617872 Bacteria 8814715
317 2824632509 2824626560 Bacteria 8813858
318 2824642295 2824635225 Bacteria 8785348
319 2824649652 2824644064 Bacteria 8743947
320 2824659992 2824653114 Bacteria 8493680
321 2824669192 2824661429 Bacteria 9877870
322 2824674752 2824671348 Bacteria 8369588
323 2824694624 2824687955 Bacteria 8360029
324 2824702116 2824696289 Bacteria 8335049
325 2824709381 2824704595 Bacteria 9667483
326 2824719621 2824714736 Bacteria 8717648
327 2824730082 2824723954 Bacteria 8758240
328 2824752980 2824746037 Bacteria 7911610
329 2824761940 2824753945 Bacteria 9787441
330 2824770589 2824763712 Bacteria 9792355
331 2824779849 2824773399 Bacteria 8360218
332 2838130227 2838122688 Bacteria 8803140
333 2841944330 2841941048 Bacteria 8688029
334 2841954493 2841949485 Bacteria 8680857
335 2841962941 2841957949 Bacteria 8652217
336 2841969107 2841966195 Bacteria 8673214
337 2841979881 2841974524 Bacteria 8931498
338 2841990938 2841983080 Bacteria 8395090
339 2842044014 2842038055 Bacteria 8002051
340 2842051997 2842045827 Bacteria 8006841
341 2847939658 2847930680 Bacteria 9342022
342 2847941626 2847939898 Bacteria 8606328
343 2849082548 2849076700 Bacteria 7039503
344 2857511435 2857509624 Bacteria 7472071
345 2874615574 2874612657 Bacteria 8252029
346 2874624303 2874620515 Bacteria 8290088
347 2874634057 2874628541 Bacteria 8630250
348 2876764519 2876761206 Bacteria 10111113
349 2879090539 2879083081 Bacteria 8587928
350 2879099950 2879099564 Bacteria 10442239
351 2879147330 2879142872 Bacteria 8267021
352 2881364968 2881364244 Bacteria 7710352
353 2881672291 2881665667 Bacteria 8175609
354 2885368124 2885366525 Bacteria 8326213
355 2885375943 2885374607 Bacteria 8927485
356 2885410942 2885409591 Bacteria 9235467
357 2888380149 2888378607 Bacteria 9652610
358 2903755896 2903748898 Bacteria 9972761
359 2903773442 2903768456 Bacteria 9749579
360 2904672358 2904666416 Bacteria 8226587
361 2904695691 2904690495 Bacteria 9412302
362 2904709697
363 2904717952 2904711408 Bacteria 9771557
364 2906614539
365 2906630227 2906626472 Bacteria 8826946
366 2906639931 2906635258 Bacteria 8601019
367 2906651303 2906643746 Bacteria 8722424
368 2906666536 2906660503 Bacteria 8595048
369 2908746640 2908739725 Bacteria 8628932
370 2908764201 2908756301 Bacteria 8864324
371 2908776730 2908775508 Bacteria 8092255
372 2922378499
373 2922400237 2922393267 Bacteria 8285685
374 2929622414 2929615660 Bacteria 9193770
375 2929631369 2929624759 Bacteria 9339455
376 2932786213 2932784394 Bacteria 9704911
377 2932794826 2932794094 Bacteria 7915132
378 2932805382 2932801729 Bacteria 7987968
379 2932816854 2932809354 Bacteria 9135765
380 2932825994 2932818245 Bacteria 9955613
381 2932829451 2932828146 Bacteria 9745859
382 2933584506 2933577622 Bacteria 9116884
383 2935614776 2935608549 Bacteria 8203142
384 2935617883 2935616580 Bacteria 9032984
385 2935641633 2935638405 Bacteria 10015038
386 2935649169 2935648319 Bacteria 8801166
387 2935658059 2935656913 Bacteria 8965014
388 2935669309 2935665750 Bacteria 9571747
389 2935678095 2935675223 Bacteria 9928132
390 2935693586 2935684952 Bacteria 9590419
391 2935702906 2935694250 Bacteria 9291695
392 2935707132 2935703347 Bacteria 10242284
393 2935716950 2935713505 Bacteria 9608509
394 2935730216 2935722832 Bacteria 9608746
395 2935738389 2935732158 Bacteria 9706831
396 2935750177 2935741537 Bacteria 9707219
397 2935759771 2935750917 Bacteria 9590372
398 2935764578 2935760218 Bacteria 9817913
399 2935777106 2935769743 Bacteria 7878163
400 2935777966 2935777560 Bacteria 8077691
401 2935787170 2935785616 Bacteria 7962367
402 2935796042 2935793552 Bacteria 8012592
403 2935804487 2935801545 Bacteria 9301974
404 2935819112 2935810662 Bacteria 9401221
405 2935826184 2935819856 Bacteria 8261050
406 2935831364 2935827899 Bacteria 10038562
407 2935841973 2935837841 Bacteria 9454360
408 2935853680 2935847175 Bacteria 8228321
409 2935856618 2935855204 Bacteria 9035059
410 2935870233 2935864058 Bacteria 9784707
411 2935874442 2935873716 Bacteria 9632195
412 2935887536 2935883170 Bacteria 7964738
413 2935910902 2935908558 Bacteria 8568796
414 2935922084 2935916978 Bacteria 9113783
415 2935929779 2935926038 Bacteria 8601059
416 2935937447 2935934488 Bacteria 8602579
417 2935948154 2935942939 Bacteria 8599779
418 2935957625 2935951376 Bacteria 8602333
419 2935964278 2935959822 Bacteria 7869783
420 2935971096 2935967501 Bacteria 8603075
421 2935978415 2935975950 Bacteria 8347125
422 2935985453 2935984226 Bacteria 8302647
423 2935993903 2935992306 Bacteria 9802711
424 2936005086 2936002035 Bacteria 9362176
425 2936012278 2936011229 Bacteria 8801034
426 2936020641 2936019824 Bacteria 8804134
427 2936029571 2936028420 Bacteria 8965941
428 2936045737 2936037263 Bacteria 9446081
429 2936051964 2936046547 Bacteria 8903709
430 2936056779 2936055302 Bacteria 8785755
431 2940565775 2940556831 Bacteria 9590747
432 2941547024 2941538514 Bacteria 9402094
433 3005490967 3005483717 Bacteria 7877331
434 3005509667 3005506211 Bacteria 6943378
435 3005602045 3005594810 Bacteria 8716512
436 3005724827 3005718088 Bacteria 8283608
437 8016518785 8016511872 Bacteria 9921665
438 8016526734 8016522445 Bacteria 8156687
439 8016545026 8016539877 Bacteria 8155419
440 8016565402 8016557553 Bacteria 8154380
441 8016570100 8016566248 Bacteria 8158151
442 8016582671 8016575299 Bacteria 8154085
443 8016585653 8016583857 Bacteria 10421953
444 8016603039 8016595262 Bacteria 8149947
445 8016605937 8016603502 Bacteria 8731218
446 8016617826 8016613128 Bacteria 8794220
447 8016623748 8016622563 Bacteria 7999408
448 8016635118 8016630954 Bacteria 9217207
449 8019531647 8019530166 Bacteria 8155624
450 8019539889 8019538911 Bacteria 7872763
451 8019550768 8019547302 Bacteria 7996444
452 8019577830 8019576017 Bacteria 10049540
453 8019595932 8019586578 Bacteria 10212056
454 8019605823 8019597564 Bacteria 10041141
455 8019622175 8019619141 Bacteria 9218857
456 8019631138 8019629233 Bacteria 8687553
457 8019639484 8019638758 Bacteria 9062356
458 8019651914 8019648815 Bacteria 10014479
459 8019667943 8019659431 Bacteria 8577854
460 8019677363 8019668869 Bacteria 8791617
461 8019687590 8019678201 Bacteria 8863603
462 8019695683 8019687851 Bacteria 8712826
463 8055750865 8055742211 Bacteria 9226248
464 8056975548 8056967851 Bacteria 9038162
465 Ga0496126_0357293
466 JGI25153J46596_10002724
467 JGI25404J52841_10026773
468 Ga0055526_1033133
469 Ga0055524_1056225
470 Ga0055531_10006527
471 Ga0065165_1002780
472 Ga0065165_1004042
473 Ga0070683_100031957
474 Ga0070680_100031076
475 Ga0068868_100515999
476 Ga0070668_100292484
477 Ga0070671_100308929
478 Ga0070709_10396256
479 Ga0070714_100029988
480 Ga0070713_100385835
481 Ga0070663_100292665
482 Ga0070681_10033862
483 Ga0070679_100076441
484 Ga0070684_100040027
485 Ga0068853_100205944
486 Ga0068853_100304177
487 Ga0068855_100055564
488 Ga0068856_100162266
489 Ga0068852_100421468
490 Ga0068863_100385662
491 Ga0081455_10036986
492 Ga0081455_10070988
493 Ga0081538_10088138
494 Ga0081540_1002008
495 Ga0081540_1004358
496 Ga0081540_1058758
497 Ga0081540_1069966
498 Ga0081540_1150084
499 Ga0081539_10000902
500 Ga0070717_10089741
501 Ga0070717_10127050
502 Ga0075365_10025042
503 Ga0075365_10060957
504 Ga0075368_10002408
505 Ga0075364_10089293
506 Ga0070712_100281435
507 Ga0075362_10014331
508 Ga0075367_10079893
509 Ga0075369_10116858
510 Ga0075370_10043541
511 Ga0075436_100069190
512 Ga0099825_1045439
513 Ga0099823_1042897
514 Ga0099795_10061091
515 Ga0105250_10101363
516 Ga0105240_10019882
517 Ga0105240_10098933
518 Ga0105240_10143012
519 Ga0105240_10328349
520 Ga0105240_11008763
521 Ga0105247_10122301
522 Ga0105243_10202319
523 Ga0105243_10669633
524 Ga0105241_10109593
525 Ga0105241_10783675
526 Ga0105237_10590556
527 Ga0105237_10720577
528 Ga0105237_10727644
529 Ga0105238_10794089
530 Ga0099796_10115708
531 Ga0105246_10159510
532 Ga0157370_10232227
533 Ga0157369_10004460
534 Ga0157378_10268087
535 Ga0157372_10045484
536 Ga0163163_10149952
537 Ga0157379_10331322
538 Ga0157376_10503268
539 Ga0214544_1000003
540 Ga0214542_1000003
541 Ga0214545_1000004
542 Ga0214543_1000007
543 Ga0209677_100434
544 Ga0209233_1001815
545 Ga0209233_1008918
546 Ga0209455_1002067
547 Ga0209455_1025985
548 Ga0209564_1010640
549 Ga0209758_1000015
550 Ga0209758_1000389
551 Ga0209758_1001056
552 Ga0209256_1016418
553 Ga0209256_1026032
554 Ga0207426_1000380
555 Ga0209257_1001378
556 Ga0209257_1009836
557 Ga0207697_10083365
558 Ga0207692_10047480
559 Ga0207710_10173089
560 Ga0207688_10102200
561 Ga0207647_10001208
562 Ga0207647_10114833
563 Ga0207647_10212150
564 Ga0207699_10024886
565 Ga0207654_10171867
566 Ga0207707_10001012
567 Ga0207695_10106934
568 Ga0207695_10212399
569 Ga0207695_10578122
570 Ga0207660_10024162
571 Ga0207681_10477613
572 Ga0207694_10057116
573 Ga0207694_10077784
574 Ga0207700_10292874
575 Ga0207664_10003852
576 Ga0207706_10139948
577 Ga0207686_10491730
578 Ga0207689_10054191
579 Ga0207661_10000462
580 Ga0207667_10023472
581 Ga0207667_10038547
582 Ga0207667_10487250
583 Ga0207640_10050268
584 Ga0207677_10254221
585 Ga0207639_10352905
586 Ga0207639_10355919
587 Ga0207678_10234708
588 Ga0207702_10078592
589 Ga0207641_10137064
590 Ga0207676_10084335
591 Ga0207675_100660575
592 Ga0207683_10296226
593 Ga0207683_10325744
594 Ga0207698_10127697
595 Ga0209389_1000168
596 Ga0209389_1000180
597 Ga0209589_1000570
598 Ga0209489_101190
599 Ga0209489_101411
600 Ga0209700_101443
601 Ga0265328_10024177
602 Ga0307513_10062632
603 Ga0307509_10175518
604 Ga0265313_10116798
605 Ga0307508_10024306
606 Ga0265314_10006019
607 Ga0307516_10079013
608 Ga0307405_10293550
609 Ga0307507_10189209
610 Ga0307510_10076470
611 Ga0307510_10093573
612 Ga0315911_1000017
613 Ga0373925_0294917
614 Ga0395900_0000937
615 Ga0395900_0013063
616 Ga0395900_0214916
617 Ga0395900_0322035
618 Ga0395898_0011586
619 Ga0395898_0024070
620 Ga0395898_0149521
621 Ga0395905_0008317
622 Ga0395905_0519735
623 Ga0395905_0557223
624 Ga0395901_0056407
625 Ga0395901_0197670
626 Ga0395901_0320497
627 Ga0451787_083916
628 Ga0451807_0364670
629 Ga0451833_0927339
630 Ga0439455_0090730
631 Ga0439459_0066547
632 Ga0466969_0017721
633 Ga0466972_0000171
634 Ga0466965_0033206
635 Ga0466965_0078318
636 Ga0466966_0000287
637 Ga0466961_0000126
638 Ga0466963_0013151
639 Ga0466963_0025316
640 Ga0466964_0058352
641 Ga0466968_0142233
642 Ga0466957_0083305
643 Ga0466960_0209454
644 Ga0466959_0003926
645 Ga0466967_0020160
646 Ga0495603_0018353
647 Ga0495638_0018982
648 Ga0495605_0062577
649 Ga0495606_0122131
650 Ga0495606_0198746
651 Ga0495616_0045329
652 Ga0495620_0135516
653 Ga0495643_0007944
654 Ga0495648_0093161
655 Ga0495625_0047118
656 Ga0495625_0100049
657 Ga0495625_0110135
658 Ga0495588_0005976
659 Ga0495671_0116582
660 Ga0495581_0182836
661 Ga0495676_0076061
662 Ga0495683_0161543
663 Ga0495687_065314
664 Ga0495673_0022363
665 Ga0495602_0214510
666 Ga0496100_0100995
667 Ga0496102_0019762
668 Ga0496102_0289460
669 Ga0496102_0303766
670 Ga0496102_0508569
671 Ga0496103_0041417
672 Ga0496104_0014354
673 Ga0496105_0004596
674 Ga0496105_0016902
675 Ga0496106_0388692
676 Ga0496108_0095878
677 Ga0496108_0228475
678 Ga0496112_0722176
679 Ga0496113_0029699
680 Ga0496113_0122933
681 Ga0496115_0041722
682 Ga0496115_0057548
683 Ga0496116_0053113
684 Ga0496116_0063780
685 Ga0496116_0124713
686 Ga0496117_0044061
687 Ga0496117_0156477
688 Ga0496117_0179693
689 Ga0496117_0191287
690 Ga0496118_0021634
691 Ga0496118_0099007
692 Ga0496118_0153464
693 Ga0496119_0030902
694 Ga0496121_0000416
695 Ga0496121_0011106
696 Ga0496121_0015708
697 Ga0496121_0072330
698 Ga0496121_0134745
699 Ga0496123_0101046
700 Ga0496125_0035946
701 Ga0496126_0476003
702 Ga0496126_0478141
703 Ga0501047_0182866
704 Ga0501070_0017328
705 Ga0501044_0254998
706 nmdc:mga03n38_27115_c1
707 nmdc:mga00v17_119808_c1
708 nmdc:mga00v17_32231_c1
709 nmdc:mga0yw44_14698_c1
710 nmdc:mga0k408_32125_c1
711 nmdc:mga08x19_60206_c1
712 nmdc:mga0sz30_33721_c1
713 Ga0500610_0074278
714 Ga0500578_0074537
715 Ga0500578_0222436
716 Ga0500643_000278
717 Ga0500583_0048514
718 Ga0500566_0002106
719 Ga0500566_0004396
720 Ga0500566_0087435
721 Ga0500566_0088900
722 Ga0500640_030834
723 Ga0500641_0017084
724 Ga0500554_000740
725 Ga0500555_001487
726 Ga0500557_000028
727 Ga0500562_006678
728 Ga0500572_013804
729 Ga0500592_021247
730 Ga0500595_000653
731 Ga0500607_068036
732 Ga0500608_056826
733 Ga0500642_0000590
734 Ga0500559_0131615
735 Ga0500577_0065705
736 Ga0500585_040537
737 Ga0500588_0067030
738 Ga0500590_192955
739 Ga0500603_001985
740 Ga0500616_0097299
741 Ga0500620_043073
742 Ga0500622_0038166
743 Ga0500636_0000059
744 Ga0500636_0141591
745 Ga0500637_0002557
746 Ga0500637_0214007
747 Ga0500625_083066
748 Ga0500645_083019
749 Ga0530510_0172389
750 2507505722
751 2508539921
752 2508695986
753 2511397036
754 2513626658
755 2513648142
756 2513657403
757 2513677978
758 2513705499
759 2513715567
760 2513857167
761 2513875699
762 2513916656
763 2514016365
764 2515627750
765 2517106998
766 2517888110
767 2524435609
768 2524468342
769 2524533291
770 2528858119
771 2617352930
772 2617374253
773 2745079865
774 2793063227
775 2793073989
776 2805919375
777 2818237142
778 2824608405
779 2824617433
780 2824625074
781 2824632509
782 2824642295
783 2824649652
784 2824659992
785 2824669192
786 2824674752
787 2824694624
788 2824702116
789 2824709381
790 2824719621
791 2824730082
792 2824752980
793 2824761940
794 2824770589
795 2824779849
796 2838130227
797 2841944330
798 2841954493
799 2841962941
800 2841969107
801 2841979881
802 2841990938
803 2842044014
804 2842051997
805 2847939658
806 2847941626
807 2849082548
808 2857511435
809 2874615574
810 2874624303
811 2874634057
812 2876764519
813 2879090539
814 2879099950
815 2879147330
816 2881364968
817 2881672291
818 2885368124
819 2885375943
820 2885410942
821 2888380149
822 2903755896
823 2903773442
824 2904672358
825 2904695691
826 2904709697
827 2904717952
828 2906614539
829 2906630227
830 2906639931
831 2906651303
832 2906666536
833 2908746640
834 2908764201
835 2908776730
836 2922378499
837 2922400237
838 2929622414
839 2929631369
840 2932786213
841 2932794826
842 2932805382
843 2932816854
844 2932825994
845 2932829451
846 2933584506
847 2935614776
848 2935617883
849 2935641633
850 2935649169
851 2935658059
852 2935669309
853 2935678095
854 2935693586
855 2935702906
856 2935707132
857 2935716950
858 2935730216
859 2935738389
860 2935750177
861 2935759771
862 2935764578
863 2935777106
864 2935777966
865 2935787170
866 2935796042
867 2935804487
868 2935819112
869 2935826184
870 2935831364
871 2935841973
872 2935853680
873 2935856618
874 2935870233
875 2935874442
876 2935887536
877 2935910902
878 2935922084
879 2935929779
880 2935937447
881 2935948154
882 2935957625
883 2935964278
884 2935971096
885 2935978415
886 2935985453
887 2935993903
888 2936005086
889 2936012278
890 2936020641
891 2936029571
892 2936045737
893 2936051964
894 2936056779
895 2940565775
896 2941547024
897 3005490967
898 3005509667
899 3005602045
900 3005724827
901 8016518785
902 8016526734
903 8016545026
904 8016565402
905 8016570100
906 8016582671
907 8016585653
908 8016603039
909 8016605937
910 8016617826
911 8016623748
912 8016635118
913 8019531647
914 8019539889
915 8019550768
916 8019577830
917 8019595932
918 8019605823
919 8019622175
920 8019631138
921 8019639484
922 8019651914
923 8019667943
924 8019677363
925 8019687590
926 8019695683
927 8055750865
928 8056975548

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

45

236

0.89

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

30

221

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cbn-assembly1.cif.gz_A-2 crystal structure of zipd from escherichia coli 0.8582 2 242
4gcw-assembly1.cif.gz_A crystal structure of rnase z in complex with precursor trna(thr) 0.8548 1 243
1y44-assembly1.cif.gz_A crystal structure of rnase z 0.853 1 243
8gyg-assembly1.cif.gz_A purification ,crystallization and x-ray diffraction analysis of a novel arysulfatase from pseudoalteromonas atlantica t6c 0.8522 2 243
4gcw-assembly1.cif.gz_A crystal structure of rnase z in complex with precursor trna(thr) 0.8483 1 243
ID Description Score Start End Superfamily
af_P0A8V0_1_305_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8645 1 244 3.60.15.10
af_P0A8V0_1_305_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8612 1 244 3.60.15.10
af_Q8MKW7_59_305_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8301 3 157 3.60.15.10
af_Q2FY67_1_306_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.828 1 244 3.60.15.10
af_P9WGC1_17_267_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8249 2 242 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A353YC37-F1-model_v4 MBL fold metallo-hydrolase 0.9341 1 178 GO:0042781
AF-A0A7C1HLX9-F1-model_v4 MBL fold metallo-hydrolase 0.9302 3 121 GO:0042781
AF-A0A353YC37-F1-model_v4 MBL fold metallo-hydrolase 0.9291 1 178 GO:0042781
AF-A0A543FRE7-F1-model_v4 Ribonuclease BN (tRNA processing enzyme) 0.9246 1 180 GO:0042781
AF-A0A376AEN2-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9233 33 244 GO:0042781

Map