F449285

General Info

Members Datasets Scaffolds Average Seq Length
464 215 444 327

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10014866|Ga0105249_100148661
Length 339
Sequence MSLKILKAGMLDSIQDMGRFGYQQVGINPTGAMDKYAAAIANILVGNNSHVPVIEMHFPAATIFFEHPALIALSGADFSATIDGNSIPTNHAVIVNKNTTLQFHSLKNKSRCYLAIKGGIKLSKWLNSYSTNLKAEAGGFSGRRLLKDDIIELNSQFDHTNQHDENDPIAIGFKTLPWQANEDFGIEDTAQLLVLHGAEWNWLDKNSQEKFLRNPFFISHNSDRMGYRLASEPLQLITKTELVSSAVSFGTIQLLPDGQLIILMADHQTTGGYPRLGNIISVHLPMLAQLKAGDKIQFKFTDHPTAENLILKQQQHLTQLEIACKLRLENYIHEKGHNE

Samples

Sample ID Description Type Environment
1 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
2 2643221729 Bacillus sp. Root11 Isolate Unclassified
3 2643221730 Bacillus sp. Root131 Isolate Unclassified
4 2684622632 Bacillus cereus 905 Isolate Unclassified
5 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
6 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
7 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
8 2738541358 Bacillus sp. OV752 Isolate Unclassified
9 2738543006 Bacillus sp. OK077 Isolate Unclassified
10 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
11 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
12 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
13 2938917290 Bacillus sp. CR71 Isolate Unclassified
14 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
15 2965761152 Bacillus sp. COPE52 Isolate Unclassified
16 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
17 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
18 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
19 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
157 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
177 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
187 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
207 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
208 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
209 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
210 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
211 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
212 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
213 8022792930 Bacillus sp. Xin Isolate Rhizosphere
214 8023438354 Bacillus sp. BH2 Isolate Unclassified
215 8023444577 Bacillus sp. BH32 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.69
Metatranscriptomes 0
Isolates 4.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.03
Nodule 0
Rhizoplane 0.43
Rhizosphere 88.36
Stem 0
Stem Tuber 0
Unclassified 5.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000595 3300000549 Bacteria 5864
2 JGI24751J29686_10000819 3300002459 Bacteria 7231
3 JGI25151J46595_10002367 3300003187 Bacteria 11443
4 JGI25151J46595_10010816 3300003187 Bacteria 4222
5 JGI25151J46595_10050538 3300003187 Bacteria 1415
6 rootH1_10017103 3300003323 Bacteria 28716
7 JGI25160J50197_1000375 3300003354 Bacteria 29260
8 Ga0065704_10017429 3300005289 Bacteria 2067
9 Ga0065715_10292667 3300005293 Unclassified 1059
10 Ga0065707_10107729 3300005295 Unclassified 2541
11 Ga0070676_10001998 3300005328 Bacteria 10370
12 Ga0070676_10002273 3300005328 Bacteria 9809
13 Ga0070676_10157160 3300005328 Bacteria 1460
14 Ga0070676_10180166 3300005328 Bacteria 1373
15 Ga0070683_100001393 3300005329 Bacteria 18553
16 Ga0070683_100138769 3300005329 Bacteria 2303
17 Ga0070683_100192080 3300005329 Bacteria 1939
18 Ga0070690_100019989 3300005330 Bacteria 4076
19 Ga0070670_100016285 3300005331 Bacteria 6385
20 Ga0070670_100017437 3300005331 Bacteria 6159
21 Ga0070670_100314580 3300005331 Unclassified 1371
22 Ga0070677_10058933 3300005333 Bacteria 1578
23 Ga0068869_100001381 3300005334 Bacteria 14366
24 Ga0068869_100021050 3300005334 Bacteria 4483
25 Ga0068869_100030784 3300005334 Bacteria 3770
26 Ga0068869_100035572 3300005334 Bacteria 3530
27 Ga0068869_100037162 3300005334 Bacteria 3462
28 Ga0068869_100044864 3300005334 Unclassified 3180
29 Ga0068869_100097131 3300005334 Bacteria 2224
30 Ga0068869_100254069 3300005334 Unclassified 1405
31 Ga0070666_10031434 3300005335 Unclassified 3505
32 Ga0068868_100003353 3300005338 Bacteria 11144
33 Ga0068868_100004611 3300005338 Bacteria 9667
34 Ga0068868_100099700 3300005338 Bacteria 2350
35 Ga0068868_100131126 3300005338 Bacteria 2051
36 Ga0068868_100294674 3300005338 Bacteria 1376
37 Ga0070689_100015001 3300005340 Bacteria 5641
38 Ga0070689_100029334 3300005340 Bacteria 4163
39 Ga0070689_100038560 3300005340 Unclassified 3656
40 Ga0070689_100088515 3300005340 Bacteria 2437
41 Ga0070689_100158040 3300005340 Bacteria 1831
42 Ga0070687_100094320 3300005343 Bacteria 1662
43 Ga0070661_100000700 3300005344 Bacteria 24597
44 Ga0070661_100163744 3300005344 Unclassified 1685
45 Ga0070668_100008643 3300005347 Bacteria 7561
46 Ga0070668_100213752 3300005347 Bacteria 1587
47 Ga0070668_100255401 3300005347 Bacteria 1456
48 Ga0070669_100007779 3300005353 Bacteria 7656
49 Ga0070669_100040581 3300005353 Unclassified 3383
50 Ga0070669_100121804 3300005353 Bacteria 1991
51 Ga0070669_100153537 3300005353 Bacteria 1784
52 Ga0070675_100018008 3300005354 Bacteria 5622
53 Ga0070675_100145629 3300005354 Bacteria 2028
54 Ga0070675_100182146 3300005354 Bacteria 1817
55 Ga0070671_100142856 3300005355 Bacteria 2020
56 Ga0070671_100190488 3300005355 Bacteria 1738
57 Ga0070671_100368031 3300005355 Bacteria 1227
58 Ga0070674_100009129 3300005356 Bacteria 5931
59 Ga0070673_100074409 3300005364 Bacteria 2737
60 Ga0070688_100066159 3300005365 Bacteria 2299
61 Ga0070688_100104359 3300005365 Bacteria 1874
62 Ga0070659_100009106 3300005366 Bacteria 7281
63 Ga0070659_100097735 3300005366 Unclassified 2360
64 Ga0070678_100008731 3300005456 Bacteria 6087
65 Ga0070678_100068455 3300005456 Bacteria 2646
66 Ga0070662_100030379 3300005457 Bacteria 3780
67 Ga0070662_100039869 3300005457 Bacteria 3343
68 Ga0068867_100027376 3300005459 Bacteria 4096
69 Ga0068867_100065990 3300005459 Unclassified 2695
70 Ga0068867_100268707 3300005459 Bacteria 1393
71 Ga0070685_10023144 3300005466 Bacteria 3398
72 Ga0070685_10060660 3300005466 Bacteria 2212
73 Ga0070685_10163804 3300005466 Bacteria 1419
74 Ga0070698_100000850 3300005471 Bacteria 33482
75 Ga0070698_100018681 3300005471 Bacteria 7298
76 Ga0070684_100001259 3300005535 Bacteria 18156
77 Ga0070684_100142796 3300005535 Bacteria 2166
78 Ga0068853_100000395 3300005539 Bacteria 29784
79 Ga0068853_100009713 3300005539 Bacteria 7759
80 Ga0068853_100044279 3300005539 Unclassified 3810
81 Ga0068853_100212184 3300005539 Unclassified 1765
82 Ga0068853_100445188 3300005539 Unclassified 1218
83 Ga0070672_100042845 3300005543 Bacteria 3486
84 Ga0070672_100068671 3300005543 Bacteria 2811
85 Ga0070672_100073303 3300005543 Bacteria 2729
86 Ga0070672_100453453 3300005543 Bacteria 1105
87 Ga0070686_100030901 3300005544 Unclassified 3271
88 Ga0070696_100336304 3300005546 Bacteria 1166
89 Ga0070665_100084739 3300005548 Unclassified 3174
90 Ga0070665_100460902 3300005548 Bacteria 1281
91 Ga0070704_100282955 3300005549 Unclassified 1375
92 Ga0068855_100007582 3300005563 Bacteria 13129
93 Ga0068855_100192462 3300005563 Bacteria 2300
94 Ga0070664_100005564 3300005564 Bacteria 10120
95 Ga0070664_100017550 3300005564 Bacteria 5878
96 Ga0070664_100040027 3300005564 Unclassified 3951
97 Ga0070664_100074704 3300005564 Bacteria 2909
98 Ga0070664_100082492 3300005564 Bacteria 2773
99 Ga0068857_100003941 3300005577 Bacteria 12494
100 Ga0068857_100017630 3300005577 Bacteria 6261
101 Ga0068857_100047104 3300005577 Bacteria 3827
102 Ga0068857_100049009 3300005577 Bacteria 3748
103 Ga0068857_100065232 3300005577 Unclassified 3237
104 Ga0068857_100182275 3300005577 Bacteria 1911
105 Ga0068854_100038467 3300005578 Unclassified 3365
106 Ga0068854_100102151 3300005578 Bacteria 2151
107 Ga0068854_100110514 3300005578 Bacteria 2073
108 Ga0068854_100474517 3300005578 Unclassified 1049
109 Ga0070702_100022014 3300005615 Bacteria 3363
110 Ga0068852_100004088 3300005616 Bacteria 10268
111 Ga0068852_100534874 3300005616 Bacteria 1171
112 Ga0068859_100013961 3300005617 Bacteria 8056
113 Ga0068859_100016987 3300005617 Bacteria 7305
114 Ga0068859_100024704 3300005617 Bacteria 6030
115 Ga0068859_100038428 3300005617 Bacteria 4803
116 Ga0068859_100225128 3300005617 Bacteria 1964
117 Ga0068859_100519560 3300005617 Bacteria 1286
118 Ga0068864_100026128 3300005618 Bacteria 4922
119 Ga0068864_100042196 3300005618 Bacteria 3903
120 Ga0068864_100064184 3300005618 Unclassified 3184
121 Ga0068864_100506287 3300005618 Bacteria 1162
122 Ga0068864_100510614 3300005618 Bacteria 1157
123 Ga0068866_10088978 3300005718 Bacteria 1677
124 Ga0068861_100002332 3300005719 Bacteria 12331
125 Ga0068861_100003327 3300005719 Bacteria 10636
126 Ga0068861_100052469 3300005719 Bacteria 3099
127 Ga0068861_100056023 3300005719 Unclassified 3008
128 Ga0068870_10005159 3300005840 Bacteria 5685
129 Ga0068870_10006965 3300005840 Bacteria 5014
130 Ga0068870_10090773 3300005840 Bacteria 1707
131 Ga0068863_100024490 3300005841 Bacteria 5756
132 Ga0068863_100046824 3300005841 Unclassified 4105
133 Ga0068863_100324782 3300005841 Unclassified 1495
134 Ga0068858_100185784 3300005842 Bacteria 1963
135 Ga0068858_100227727 3300005842 Bacteria 1767
136 Ga0068860_100053218 3300005843 Bacteria 3850
137 Ga0068860_100053482 3300005843 Unclassified 3839
138 Ga0068860_100072941 3300005843 Bacteria 3263
139 Ga0068860_100354019 3300005843 Unclassified 1445
140 Ga0068862_100153106 3300005844 Bacteria 2053
141 Ga0068862_100187025 3300005844 Bacteria 1862
142 Ga0068862_100203701 3300005844 Bacteria 1785
143 Ga0070715_10106724 3300006163 Bacteria 1315
144 Ga0075366_10006034 3300006195 Bacteria 6602
145 Ga0075366_10022580 3300006195 Unclassified 3661
146 Ga0075366_10041904 3300006195 Bacteria 2711
147 Ga0097621_100008757 3300006237 Bacteria 7310
148 Ga0097621_100115982 3300006237 Bacteria 2267
149 Ga0097621_100335710 3300006237 Bacteria 1341
150 Ga0068871_100007800 3300006358 Bacteria 7664
151 Ga0068871_100026146 3300006358 Bacteria 4551
152 Ga0068871_100107366 3300006358 Bacteria 2345
153 Ga0068871_100286494 3300006358 Bacteria 1442
154 Ga0075428_100341128 3300006844 Bacteria 1609
155 Ga0075428_100469192 3300006844 Bacteria 1348
156 Ga0075428_100550785 3300006844 Unclassified 1233
157 Ga0075430_100003052 3300006846 Bacteria 14002
158 Ga0075430_100038623 3300006846 Bacteria 4043
159 Ga0075431_100006268 3300006847 Bacteria 11815
160 Ga0075434_100004332 3300006871 Bacteria 12765
161 Ga0075429_100022294 3300006880 Bacteria 5493
162 Ga0075429_100266392 3300006880 Unclassified 1500
163 Ga0068865_100016453 3300006881 Unclassified 4733
164 Ga0097620_100013961 3300006931 Bacteria 8056
165 Ga0097620_100016985 3300006931 Bacteria 7305
166 Ga0097620_100024706 3300006931 Bacteria 6030
167 Ga0097620_100038428 3300006931 Bacteria 4803
168 Ga0097620_100225139 3300006931 Bacteria 1964
169 Ga0097620_100519559 3300006931 Bacteria 1286
170 Ga0105251_10009303 3300009011 Bacteria 5814
171 Ga0105251_10061904 3300009011 Bacteria 1759
172 Ga0105244_10000740 3300009036 Bacteria 27926
173 Ga0105250_10004788 3300009092 Bacteria 6170
174 Ga0105250_10004885 3300009092 Bacteria 6095
175 Ga0105250_10040358 3300009092 Bacteria 1872
176 Ga0105240_10123321 3300009093 Bacteria 3118
177 Ga0111539_10014976 3300009094 Bacteria 9667
178 Ga0111539_10547244 3300009094 Bacteria 1348
179 Ga0111539_10829735 3300009094 Bacteria 1076
180 Ga0105247_10000408 3300009101 Bacteria 36396
181 Ga0105247_10056073 3300009101 Unclassified 2433
182 Ga0114129_10043242 3300009147 Bacteria 6338
183 Ga0114129_10114584 3300009147 Bacteria 3717
184 Ga0114129_10650798 3300009147 Bacteria 1360
185 Ga0105241_10052115 3300009174 Unclassified 3123
186 Ga0105242_10018955 3300009176 Bacteria 5389
187 Ga0105242_10036758 3300009176 Bacteria 3930
188 Ga0105242_10125704 3300009176 Bacteria 2207
189 Ga0105242_10129466 3300009176 Bacteria 2176
190 Ga0105249_10004239 3300009553 Bacteria 12401
191 Ga0105249_10004712 3300009553 Bacteria 11773
192 Ga0105249_10014866 3300009553 Bacteria 6884
193 Ga0105249_10052693 3300009553 Bacteria 3716
194 Ga0105249_10312189 3300009553 Bacteria 1581
195 Ga0105239_10047696 3300010375 Bacteria 4694
196 Ga0105239_10135830 3300010375 Bacteria 2738
197 Ga0105246_10192145 3300011119 Bacteria 1581
198 Ga0157373_10032564 3300013100 Bacteria 3752
199 Ga0157371_10106169 3300013102 Bacteria 1993
200 Ga0157374_10001463 3300013296 Bacteria 19961
201 Ga0157374_10059289 3300013296 Bacteria 3578
202 Ga0157374_10219893 3300013296 Bacteria 1864
203 Ga0157378_10044156 3300013297 Bacteria 3957
204 Ga0157378_10230621 3300013297 Bacteria 1764
205 Ga0163162_10009462 3300013306 Bacteria 9474
206 Ga0163162_10042818 3300013306 Unclassified 4533
207 Ga0163162_10114845 3300013306 Unclassified 2792
208 Ga0163162_10128471 3300013306 Bacteria 2642
209 Ga0157372_10333463 3300013307 Bacteria 1767
210 Ga0157372_10442655 3300013307 Bacteria 1515
211 Ga0157375_10016593 3300013308 Bacteria 6622
212 Ga0157375_10096531 3300013308 Unclassified 3029
213 Ga0157375_10132746 3300013308 Bacteria 2611
214 Ga0157375_10244191 3300013308 Bacteria 1955
215 Ga0157375_10447920 3300013308 Bacteria 1457
216 Ga0163163_10000343 3300014325 Bacteria 44866
217 Ga0163163_10092101 3300014325 Unclassified 3046
218 Ga0163163_10111839 3300014325 Bacteria 2760
219 Ga0163163_10259565 3300014325 Bacteria 1788
220 Ga0163163_10346427 3300014325 Bacteria 1541
221 Ga0157380_10483634 3300014326 Unclassified 1198
222 Ga0157377_10001764 3300014745 Bacteria 9426
223 Ga0157377_10003672 3300014745 Bacteria 6963
224 Ga0157379_10038921 3300014968 Unclassified 4242
225 Ga0157379_10173957 3300014968 Bacteria 1944
226 Ga0157376_10340494 3300014969 Bacteria 1432
227 Ga0157376_10571117 3300014969 Bacteria 1122
228 Ga0163161_10052098 3300017792 Bacteria 2967
229 Ga0163161_10206474 3300017792 Bacteria 1516
230 Ga0163161_10225143 3300017792 Bacteria 1454
231 Ga0213876_10000389 3300021384 Bacteria 36929
232 Ga0213876_10020307 3300021384 Unclassified 3511
233 Ga0209130_1000192 3300025284 Bacteria 85073
234 Ga0209130_1001290 3300025284 Bacteria 17317
235 Ga0209130_1002569 3300025284 Bacteria 8844
236 Ga0209025_1000915 3300025294 Bacteria 45383
237 Ga0209025_1001333 3300025294 Bacteria 33361
238 Ga0209025_1001933 3300025294 Bacteria 23996
239 Ga0209025_1003383 3300025294 Bacteria 15215
240 Ga0209025_1006511 3300025294 Bacteria 9033
241 Ga0209025_1008222 3300025294 Bacteria 7545
242 Ga0209025_1008660 3300025294 Bacteria 7275
243 Ga0209025_1013771 3300025294 Bacteria 5049
244 Ga0209025_1038108 3300025294 Bacteria 2120
245 Ga0207426_1000026 3300025302 Bacteria 515228
246 Ga0207656_10025952 3300025321 Bacteria 2384
247 Ga0207696_1009280 3300025711 Bacteria 3677
248 Ga0207655_1003331 3300025728 Bacteria 12030
249 Ga0207642_10016844 3300025899 Bacteria 2765
250 Ga0207680_10090460 3300025903 Bacteria 1945
251 Ga0207645_10000748 3300025907 Bacteria 27039
252 Ga0207645_10018693 3300025907 Bacteria 4551
253 Ga0207643_10003520 3300025908 Bacteria 8423
254 Ga0207643_10007286 3300025908 Bacteria 5935
255 Ga0207643_10016684 3300025908 Bacteria 4005
256 Ga0207662_10044009 3300025918 Bacteria 2635
257 Ga0207649_10001123 3300025920 Bacteria 16235
258 Ga0207649_10029432 3300025920 Unclassified 3243
259 Ga0207681_10003075 3300025923 Bacteria 10485
260 Ga0207681_10015202 3300025923 Bacteria 4799
261 Ga0207681_10042217 3300025923 Unclassified 3045
262 Ga0207681_10044196 3300025923 Bacteria 2985
263 Ga0207681_10057984 3300025923 Bacteria 2649
264 Ga0207650_10089645 3300025925 Bacteria 2348
265 Ga0207650_10154792 3300025925 Unclassified 1812
266 Ga0207659_10009012 3300025926 Bacteria 6222
267 Ga0207659_10151559 3300025926 Bacteria 1811
268 Ga0207690_10003439 3300025932 Bacteria 9449
269 Ga0207706_10016620 3300025933 Bacteria 6641
270 Ga0207706_10023769 3300025933 Bacteria 5499
271 Ga0207706_10041996 3300025933 Unclassified 4052
272 Ga0207706_10047636 3300025933 Bacteria 3792
273 Ga0207686_10008363 3300025934 Bacteria 5586
274 Ga0207686_10074316 3300025934 Bacteria 2196
275 Ga0207686_10156791 3300025934 Bacteria 1591
276 Ga0207670_10013585 3300025936 Bacteria 4806
277 Ga0207670_10037891 3300025936 Unclassified 3145
278 Ga0207670_10260082 3300025936 Bacteria 1345
279 Ga0207669_10105515 3300025937 Bacteria 1875
280 Ga0207669_10225658 3300025937 Unclassified 1378
281 Ga0207704_10258772 3300025938 Bacteria 1311
282 Ga0207691_10002072 3300025940 Bacteria 19564
283 Ga0207691_10023350 3300025940 Bacteria 5821
284 Ga0207691_10055044 3300025940 Unclassified 3627
285 Ga0207691_10084065 3300025940 Bacteria 2857
286 Ga0207689_10000628 3300025942 Bacteria 33617
287 Ga0207689_10001062 3300025942 Bacteria 26443
288 Ga0207689_10001418 3300025942 Bacteria 22893
289 Ga0207689_10011584 3300025942 Bacteria 7555
290 Ga0207689_10012010 3300025942 Bacteria 7422
291 Ga0207689_10051348 3300025942 Bacteria 3399
292 Ga0207689_10114740 3300025942 Bacteria 2214
293 Ga0207689_10172239 3300025942 Unclassified 1785
294 Ga0207661_10001802 3300025944 Bacteria 14637
295 Ga0207661_10103006 3300025944 Unclassified 2401
296 Ga0207661_10198269 3300025944 Unclassified 1764
297 Ga0207679_10000768 3300025945 Bacteria 21047
298 Ga0207679_10038248 3300025945 Bacteria 3417
299 Ga0207679_10163867 3300025945 Bacteria 1823
300 Ga0207667_10008843 3300025949 Bacteria 11920
301 Ga0207651_10137371 3300025960 Bacteria 1882
302 Ga0207651_10237253 3300025960 Unclassified 1484
303 Ga0207712_10001226 3300025961 Bacteria 17716
304 Ga0207712_10006083 3300025961 Bacteria 7617
305 Ga0207668_10336009 3300025972 Bacteria 1258
306 Ga0207668_10429814 3300025972 Bacteria 1123
307 Ga0207640_10058074 3300025981 Unclassified 2548
308 Ga0207640_10185392 3300025981 Bacteria 1564
309 Ga0207658_10181390 3300025986 Bacteria 1743
310 Ga0207658_10364004 3300025986 Bacteria 1262
311 Ga0207677_10016754 3300026023 Bacteria 4350
312 Ga0207677_10067814 3300026023 Bacteria 2501
313 Ga0207677_10357342 3300026023 Bacteria 1226
314 Ga0207703_10033475 3300026035 Bacteria 4074
315 Ga0207703_10050397 3300026035 Unclassified 3370
316 Ga0207703_10138458 3300026035 Bacteria 2110
317 Ga0207703_10298241 3300026035 Bacteria 1469
318 Ga0207639_10000365 3300026041 Bacteria 31332
319 Ga0207639_10139389 3300026041 Unclassified 2019
320 Ga0207639_10168179 3300026041 Bacteria 1854
321 Ga0207639_10230928 3300026041 Bacteria 1603
322 Ga0207639_10247274 3300026041 Bacteria 1554
323 Ga0207678_10081581 3300026067 Bacteria 2769
324 Ga0207708_10248516 3300026075 Bacteria 1432
325 Ga0207641_10011229 3300026088 Bacteria 7347
326 Ga0207641_10027154 3300026088 Unclassified 4727
327 Ga0207641_10090357 3300026088 Bacteria 2678
328 Ga0207641_10115974 3300026088 Bacteria 2382
329 Ga0207648_10000372 3300026089 Bacteria 49262
330 Ga0207648_10002066 3300026089 Bacteria 21890
331 Ga0207648_10009587 3300026089 Bacteria 9263
332 Ga0207648_10015759 3300026089 Bacteria 6934
333 Ga0207648_10025791 3300026089 Bacteria 5231
334 Ga0207648_10092895 3300026089 Bacteria 2639
335 Ga0207648_10093426 3300026089 Unclassified 2630
336 Ga0207648_10359075 3300026089 Bacteria 1314
337 Ga0207676_10009647 3300026095 Bacteria 6869
338 Ga0207676_10046670 3300026095 Bacteria 3353
339 Ga0207676_10051016 3300026095 Bacteria 3228
340 Ga0207674_10005900 3300026116 Bacteria 14502
341 Ga0207674_10018901 3300026116 Bacteria 7472
342 Ga0207674_10021791 3300026116 Bacteria 6896
343 Ga0207674_10039622 3300026116 Bacteria 4883
344 Ga0207674_10110778 3300026116 Unclassified 2720
345 Ga0207674_10128989 3300026116 Unclassified 2493
346 Ga0207675_100000051 3300026118 Bacteria 83288
347 Ga0207675_100019278 3300026118 Bacteria 6363
348 Ga0207675_100073698 3300026118 Bacteria 3194
349 Ga0207675_100121039 3300026118 Unclassified 2476
350 Ga0207675_100129619 3300026118 Unclassified 2391
351 Ga0207675_100131880 3300026118 Bacteria 2370
352 Ga0207675_100201491 3300026118 Bacteria 1912
353 Ga0207683_10001617 3300026121 Bacteria 20205
354 Ga0207683_10020692 3300026121 Bacteria 5629
355 Ga0207698_10134207 3300026142 Bacteria 2121
356 Ga0207698_10215145 3300026142 Bacteria 1732
357 Ga0207698_10284809 3300026142 Bacteria 1530
358 Ga0209974_10076721 3300027876 Bacteria 1145
359 Ga0207428_10190180 3300027907 Bacteria 1548
360 Ga0207428_10273842 3300027907 Bacteria 1254
361 Ga0268266_10182107 3300028379 Bacteria 1913
362 Ga0268266_10337496 3300028379 Bacteria 1414
363 Ga0268265_10007190 3300028380 Bacteria 7522
364 Ga0268265_10080013 3300028380 Bacteria 2576
365 Ga0268265_10118239 3300028380 Unclassified 2179
366 Ga0268264_10039936 3300028381 Bacteria 3877
367 Ga0268264_10059527 3300028381 Bacteria 3200
368 Ga0268264_10195116 3300028381 Bacteria 1848
369 Ga0268264_10349896 3300028381 Bacteria 1406
370 Ga0265324_10012776 3300029957 Bacteria 3155
371 Ga0237817_10067 3300030083 Bacteria 33740
372 Ga0265327_10020718 3300031251 Bacteria 3995
373 Ga0265327_10041792 3300031251 Bacteria 2467
374 Ga0307509_10202134 3300031507 Bacteria 1822
375 Ga0307408_100011004 3300031548 Bacteria 5969
376 Ga0307408_100120347 3300031548 Bacteria 2033
377 Ga0307405_10009755 3300031731 Bacteria 4937
378 Ga0307413_10027835 3300031824 Unclassified 3139
379 Ga0307410_10070501 3300031852 Bacteria 2421
380 Ga0307410_10106483 3300031852 Bacteria 2021
381 Ga0307410_10350975 3300031852 Bacteria 1179
382 Ga0307406_10005517 3300031901 Bacteria 6922
383 Ga0307406_10222282 3300031901 Bacteria 1404
384 Ga0307407_10015437 3300031903 Unclassified 3775
385 Ga0307407_10233867 3300031903 Bacteria 1250
386 Ga0307412_10008114 3300031911 Bacteria 5981
387 Ga0307412_10094675 3300031911 Unclassified 2098
388 Ga0307409_100063064 3300031995 Bacteria 2905
389 Ga0307411_10002692 3300032005 Bacteria 7974
390 Ga0307411_10274093 3300032005 Bacteria 1339
391 Ga0373943_0042816 3300035170 Bacteria 2196
392 Ga0373947_0057206 3300035725 Bacteria 2359
393 Ga0373937_0034971 3300036401 Bacteria 4570
394 Ga0395900_0046426 3300037418 Bacteria 4473
395 Ga0395900_0341127 3300037418 Unclassified 1474
396 Ga0395901_0184561 3300038443 Unclassified 2188
397 Ga0237819_00368 3300038705 Bacteria 16014
398 Ga0237819_07815 3300038705 Bacteria 1509
399 Ga0436365_0281233 3300039437 Unclassified 3739
400 Ga0436365_0312284 3300039437 Bacteria 3689
401 Ga0436365_1933142 3300039437 Bacteria 64226
402 Ga0439449_0011903 3300042007 Bacteria 3271
403 Ga0450923_006545 3300042125 Bacteria 1937
404 Ga0466969_0000033 3300044656 Bacteria 82227
405 Ga0466972_0000091 3300044658 Bacteria 81829
406 Ga0466966_0000170 3300044684 Bacteria 42809
407 Ga0453684_0461754 3300044712 Unclassified 1412
408 Ga0466957_0003977 3300044842 Bacteria 8171
409 Ga0466959_0000089 3300045049 Bacteria 57482
410 Ga0451576_0132125 3300045051 Bacteria 2602
411 Ga0466967_0000284 3300045976 Bacteria 22491
412 Ga0495638_0087723 3300046460 Bacteria 1879
413 Ga0495650_0032493 3300046471 Bacteria 2333
414 Ga0495608_0072130 3300046511 Unclassified 2253
415 Ga0495652_0214196 3300046529 Bacteria 1452
416 Ga0495645_0264309 3300046543 Bacteria 1138
417 Ga0495634_0095460 3300046642 Unclassified 1926
418 Ga0495672_0012491 3300047320 Bacteria 5924
419 Ga0495672_0045884 3300047320 Unclassified 2611
420 Ga0495686_0018229 3300047472 Bacteria 4715
421 Ga0496110_0049203 3300048913 Unclassified 3697
422 Ga0496113_0585449 3300048916 Bacteria 894
423 Ga0501034_0028055 3300049571 Bacteria 5725
424 Ga0501034_0206682 3300049571 Bacteria 1919
425 Ga0501047_0174333 3300049581 Unclassified 2019
426 Ga0501044_0013458 3300049823 Bacteria 8848
427 Ga0501044_0016574 3300049823 Bacteria 7909
428 nmdc:mga0k408_43315_c1 3300050493 Bacteria 2593
429 nmdc:mga05p37_489696_c1 3300050507 Bacteria 1414
430 nmdc:mga05p37_9961_c1 3300050507 Bacteria 11286
431 nmdc:mga09592_80226_c1 3300050508 Bacteria 2779
432 nmdc:mga0qj67_20468_c1 3300050509 Bacteria 5065
433 nmdc:mga0qj67_27147_c1 3300050509 Bacteria 4435
434 nmdc:mga06r32_181755_c1 3300050510 Bacteria 2089
435 nmdc:mga08y16_19178_c1 3300050511 Bacteria 7207
436 nmdc:mga08y16_421660_c1 3300050511 Bacteria 1364
437 Ga0495619_0079934 3300053085 Bacteria 2200
438 Ga0500578_0017678 3300053086 Bacteria 4582
439 Ga0500583_0000002 3300053092 Bacteria 232826
440 Ga0500583_0000356 3300053092 Bacteria 15053
441 Ga0500568_0000532 3300053139 Bacteria 28130
442 Ga0500577_0002134 3300053142 Bacteria 5048
443 Ga0500589_007446 3300053147 Bacteria 4476
444 Ga0500611_000038 3300053727 Bacteria 71407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042007 Ga0439449_0011903 Ga0439449_0011903_2378_3244 274
2 3300009092 Ga0105250_10040358 Ga0105250_100403583 275
3 3300048916 Ga0496113_0585449 Ga0496113_0585449_35_874 278
4 3300037418 Ga0395900_0046426 Ga0395900_0046426_1592_2485 283
5 3300038443 Ga0395901_0184561 Ga0395901_0184561_220_1113 283
6 3300005366 Ga0070659_100097735 Ga0070659_1000977352 284
7 3300005616 Ga0068852_100004088 Ga0068852_1000040886 284
8 3300053086 Ga0500578_0017678 Ga0500578_0017678_60_956 284
9 3300044712 Ga0453684_0461754 Ga0453684_0461754_487_1392 286
10 3300005289 Ga0065704_10017429 Ga0065704_100174292 287
11 3300021384 Ga0213876_10020307 Ga0213876_100203072 289
12 3300039437 Ga0436365_0281233 Ga0436365_0281233_532_1479 289
13 3300031901 Ga0307406_10222282 Ga0307406_102222821 302
14 3300005328 Ga0070676_10001998 Ga0070676_100019987 303
15 3300005334 Ga0068869_100021050 Ga0068869_1000210505 303
16 3300005338 Ga0068868_100003353 Ga0068868_1000033537 303
17 3300005347 Ga0070668_100255401 Ga0070668_1002554012 303
18 3300005353 Ga0070669_100040581 Ga0070669_1000405812 303
19 3300005354 Ga0070675_100182146 Ga0070675_1001821462 303
20 3300005459 Ga0068867_100027376 Ga0068867_1000273762 303
21 3300005578 Ga0068854_100038467 Ga0068854_1000384673 303
22 3300005617 Ga0068859_100038428 Ga0068859_1000384284 303
23 3300005719 Ga0068861_100052469 Ga0068861_1000524692 303
24 3300006931 Ga0097620_100038428 Ga0097620_1000384284 303
25 3300013306 Ga0163162_10009462 Ga0163162_100094627 303
26 3300013308 Ga0157375_10132746 Ga0157375_101327463 303
27 3300014745 Ga0157377_10001764 Ga0157377_100017647 303
28 3300025907 Ga0207645_10018693 Ga0207645_100186935 303
29 3300025923 Ga0207681_10042217 Ga0207681_100422172 303
30 3300025981 Ga0207640_10058074 Ga0207640_100580743 303
31 3300026089 Ga0207648_10025791 Ga0207648_100257913 303
32 3300026118 Ga0207675_100019278 Ga0207675_1000192788 303
33 3300031824 Ga0307413_10027835 Ga0307413_100278353 303
34 3300031903 Ga0307407_10015437 Ga0307407_100154372 303
35 3300031911 Ga0307412_10094675 Ga0307412_100946752 303
36 3300032005 Ga0307411_10274093 Ga0307411_102740931 303
37 3300005546 Ga0070696_100336304 Ga0070696_1003363041 304
38 3300006237 Ga0097621_100335710 Ga0097621_1003357102 305
39 3300013308 Ga0157375_10447920 Ga0157375_104479202 305
40 3300009094 Ga0111539_10547244 Ga0111539_105472442 306
41 3300009094 Ga0111539_10829735 Ga0111539_108297352 306
42 3300014325 Ga0163163_10346427 Ga0163163_103464272 306
43 3300039437 Ga0436365_0312284 Ga0436365_0312284_482_1468 308
44 3300049571 Ga0501034_0028055 Ga0501034_0028055_3450_4421 308
45 3300049571 Ga0501034_0206682 Ga0501034_0206682_277_1248 308
46 3300049823 Ga0501044_0013458 Ga0501044_0013458_6027_6998 308
47 3300049823 Ga0501044_0016574 Ga0501044_0016574_3159_4130 308
48 3300005355 Ga0070671_100190488 Ga0070671_1001904882 309
49 3300025923 Ga0207681_10057984 Ga0207681_100579842 309
50 iso_pu_bacteria 2884791551 2884791957 311
51 3300005844 Ga0068862_100187025 Ga0068862_1001870252 312
52 3300025903 Ga0207680_10090460 Ga0207680_100904602 312
53 3300025942 Ga0207689_10114740 Ga0207689_101147402 312
54 3300009094 Ga0111539_10014976 Ga0111539_100149763 313
55 3300027907 Ga0207428_10190180 Ga0207428_101901802 313
56 3300049581 Ga0501047_0174333 Ga0501047_0174333_422_1405 313
57 3300050511 nmdc:mga08y16_19178_c1 nmdc:mga08y16_19178_c1_1725_2714 313
58 iso_pu_bacteria 2551306519 2553395699 313
59 iso_pu_bacteria 2643221729 2644701974 313
60 iso_pu_bacteria 2643221730 2644710891 313
61 iso_pu_bacteria 2684622632 2685151036 313
62 iso_pu_bacteria 2695420987 2698322206 313
63 iso_pu_bacteria 2703719227 2705994925 313
64 iso_pu_bacteria 2718218445 2721506288 313
65 iso_pu_bacteria 2738541358 2739155606 313
66 iso_pu_bacteria 2738543006 2739208385 313
67 iso_pu_bacteria 2818991443 2819580107 313
68 iso_pu_bacteria 2929233124 2929236738 313
69 iso_pu_bacteria 2938917290 2938920652 313
70 iso_pu_bacteria 2947426588 2947429761 313
71 iso_pu_bacteria 2965761152 2965764295 313
72 iso_pu_bacteria 2979083700 2979086702 313
73 iso_pu_bacteria 8022621104 8022623058 313
74 iso_pu_bacteria 8022792930 8022794203 313
75 iso_pu_bacteria 8023438354 8023441724 313
76 iso_pu_bacteria 8023444577 8023446720 313
77 3300005328 Ga0070676_10157160 Ga0070676_101571602 314
78 3300005328 Ga0070676_10180166 Ga0070676_101801662 314
79 3300005329 Ga0070683_100001393 Ga0070683_10000139312 314
80 3300005329 Ga0070683_100138769 Ga0070683_1001387692 314
81 3300005329 Ga0070683_100192080 Ga0070683_1001920802 314
82 3300005330 Ga0070690_100019989 Ga0070690_1000199892 314
83 3300005334 Ga0068869_100001381 Ga0068869_1000013819 314
84 3300005334 Ga0068869_100097131 Ga0068869_1000971312 314
85 3300005335 Ga0070666_10031434 Ga0070666_100314343 314
86 3300005338 Ga0068868_100099700 Ga0068868_1000997002 314
87 3300005338 Ga0068868_100131126 Ga0068868_1001311261 314
88 3300005338 Ga0068868_100294674 Ga0068868_1002946741 314
89 3300005340 Ga0070689_100015001 Ga0070689_1000150012 314
90 3300005340 Ga0070689_100038560 Ga0070689_1000385602 314
91 3300005340 Ga0070689_100158040 Ga0070689_1001580402 314
92 3300005344 Ga0070661_100000700 Ga0070661_10000070012 314
93 3300005344 Ga0070661_100163744 Ga0070661_1001637441 314
94 3300005353 Ga0070669_100153537 Ga0070669_1001535372 314
95 3300005355 Ga0070671_100142856 Ga0070671_1001428562 314
96 3300005355 Ga0070671_100368031 Ga0070671_1003680312 314
97 3300005364 Ga0070673_100074409 Ga0070673_1000744092 314
98 3300005365 Ga0070688_100104359 Ga0070688_1001043592 314
99 3300005366 Ga0070659_100009106 Ga0070659_1000091065 314
100 3300005457 Ga0070662_100030379 Ga0070662_1000303792 314
101 3300005466 Ga0070685_10163804 Ga0070685_101638042 314
102 3300005535 Ga0070684_100001259 Ga0070684_1000012592 314
103 3300005535 Ga0070684_100142796 Ga0070684_1001427962 314
104 3300005539 Ga0068853_100000395 Ga0068853_1000003952 314
105 3300005539 Ga0068853_100212184 Ga0068853_1002121842 314
106 3300005544 Ga0070686_100030901 Ga0070686_1000309013 314
107 3300005563 Ga0068855_100192462 Ga0068855_1001924621 314
108 3300005564 Ga0070664_100005564 Ga0070664_1000055645 314
109 3300005564 Ga0070664_100017550 Ga0070664_1000175505 314
110 3300005564 Ga0070664_100040027 Ga0070664_1000400273 314
111 3300005564 Ga0070664_100074704 Ga0070664_1000747042 314
112 3300005564 Ga0070664_100082492 Ga0070664_1000824923 314
113 3300005577 Ga0068857_100003941 Ga0068857_1000039417 314
114 3300005577 Ga0068857_100065232 Ga0068857_1000652323 314
115 3300005578 Ga0068854_100102151 Ga0068854_1001021512 314
116 3300005578 Ga0068854_100110514 Ga0068854_1001105142 314
117 3300005578 Ga0068854_100474517 Ga0068854_1004745171 314
118 3300005617 Ga0068859_100016987 Ga0068859_1000169873 314
119 3300005617 Ga0068859_100225128 Ga0068859_1002251282 314
120 3300005618 Ga0068864_100026128 Ga0068864_1000261286 314
121 3300005718 Ga0068866_10088978 Ga0068866_100889782 314
122 3300005719 Ga0068861_100003327 Ga0068861_1000033272 314
123 3300005841 Ga0068863_100324782 Ga0068863_1003247822 314
124 3300005843 Ga0068860_100354019 Ga0068860_1003540192 314
125 3300006163 Ga0070715_10106724 Ga0070715_101067242 314
126 3300006358 Ga0068871_100107366 Ga0068871_1001073662 314
127 3300006871 Ga0075434_100004332 Ga0075434_1000043328 314
128 3300006931 Ga0097620_100016985 Ga0097620_1000169857 314
129 3300006931 Ga0097620_100225139 Ga0097620_1002251392 314
130 3300009101 Ga0105247_10056073 Ga0105247_100560733 314
131 3300009176 Ga0105242_10125704 Ga0105242_101257042 314
132 3300010375 Ga0105239_10135830 Ga0105239_101358302 314
133 3300011119 Ga0105246_10192145 Ga0105246_101921451 314
134 3300013296 Ga0157374_10001463 Ga0157374_1000146317 314
135 3300013296 Ga0157374_10059289 Ga0157374_100592892 314
136 3300013297 Ga0157378_10230621 Ga0157378_102306212 314
137 3300013306 Ga0163162_10042818 Ga0163162_100428183 314
138 3300013306 Ga0163162_10114845 Ga0163162_101148452 314
139 3300013307 Ga0157372_10333463 Ga0157372_103334632 314
140 3300013308 Ga0157375_10016593 Ga0157375_100165933 314
141 3300013308 Ga0157375_10096531 Ga0157375_100965313 314
142 3300013308 Ga0157375_10244191 Ga0157375_102441912 314
143 3300014325 Ga0163163_10000343 Ga0163163_100003438 314
144 3300014325 Ga0163163_10092101 Ga0163163_100921012 314
145 3300014968 Ga0157379_10038921 Ga0157379_100389213 314
146 3300014968 Ga0157379_10173957 Ga0157379_101739572 314
147 3300014969 Ga0157376_10340494 Ga0157376_103404942 314
148 3300017792 Ga0163161_10225143 Ga0163161_102251432 314
149 3300021384 Ga0213876_10000389 Ga0213876_1000038924 314
150 3300025920 Ga0207649_10001123 Ga0207649_100011239 314
151 3300025920 Ga0207649_10029432 Ga0207649_100294323 314
152 3300025923 Ga0207681_10015202 Ga0207681_100152023 314
153 3300025932 Ga0207690_10003439 Ga0207690_100034394 314
154 3300025933 Ga0207706_10041996 Ga0207706_100419963 314
155 3300025933 Ga0207706_10047636 Ga0207706_100476362 314
156 3300025936 Ga0207670_10013585 Ga0207670_100135852 314
157 3300025936 Ga0207670_10037891 Ga0207670_100378913 314
158 3300025936 Ga0207670_10260082 Ga0207670_102600822 314
159 3300025938 Ga0207704_10258772 Ga0207704_102587721 314
160 3300025940 Ga0207691_10055044 Ga0207691_100550443 314
161 3300025942 Ga0207689_10001062 Ga0207689_100010628 314
162 3300025944 Ga0207661_10001802 Ga0207661_1000180213 314
163 3300025944 Ga0207661_10103006 Ga0207661_101030062 314
164 3300025944 Ga0207661_10198269 Ga0207661_101982692 314
165 3300025945 Ga0207679_10000768 Ga0207679_100007689 314
166 3300025945 Ga0207679_10038248 Ga0207679_100382482 314
167 3300025945 Ga0207679_10163867 Ga0207679_101638671 314
168 3300025981 Ga0207640_10185392 Ga0207640_101853922 314
169 3300025986 Ga0207658_10181390 Ga0207658_101813902 314
170 3300026023 Ga0207677_10067814 Ga0207677_100678142 314
171 3300026035 Ga0207703_10050397 Ga0207703_100503973 314
172 3300026035 Ga0207703_10298241 Ga0207703_102982412 314
173 3300026041 Ga0207639_10000365 Ga0207639_1000036528 314
174 3300026041 Ga0207639_10139389 Ga0207639_101393893 314
175 3300026067 Ga0207678_10081581 Ga0207678_100815813 314
176 3300026088 Ga0207641_10115974 Ga0207641_101159741 314
177 3300026089 Ga0207648_10009587 Ga0207648_100095875 314
178 3300026089 Ga0207648_10093426 Ga0207648_100934262 314
179 3300026095 Ga0207676_10009647 Ga0207676_100096476 314
180 3300026116 Ga0207674_10005900 Ga0207674_1000590010 314
181 3300026116 Ga0207674_10039622 Ga0207674_100396226 314
182 3300026116 Ga0207674_10110778 Ga0207674_101107783 314
183 3300026121 Ga0207683_10020692 Ga0207683_100206924 314
184 3300026142 Ga0207698_10134207 Ga0207698_101342073 314
185 3300026142 Ga0207698_10215145 Ga0207698_102151452 314
186 3300028381 Ga0268264_10195116 Ga0268264_101951162 314
187 3300031548 Ga0307408_100120347 Ga0307408_1001203472 314
188 3300031852 Ga0307410_10106483 Ga0307410_101064832 314
189 3300031852 Ga0307410_10350975 Ga0307410_103509751 314
190 3300035725 Ga0373947_0057206 Ga0373947_0057206_1065_2057 314
191 3300036401 Ga0373937_0034971 Ga0373937_0034971_2938_3921 314
192 3300039437 Ga0436365_1933142 Ga0436365_1933142_48279_49265 314
193 3300045051 Ga0451576_0132125 Ga0451576_0132125_1378_2346 314
194 3300046511 Ga0495608_0072130 Ga0495608_0072130_379_1362 314
195 3300046529 Ga0495652_0214196 Ga0495652_0214196_172_1155 314
196 3300046642 Ga0495634_0095460 Ga0495634_0095460_741_1724 314
197 3300048913 Ga0496110_0049203 Ga0496110_0049203_957_1967 314
198 3300002459 JGI24751J29686_10000819 JGI24751J29686_100008197 315
199 3300003354 JGI25160J50197_1000375 JGI25160J50197_100037519 315
200 3300005328 Ga0070676_10002273 Ga0070676_100022732 315
201 3300005331 Ga0070670_100017437 Ga0070670_1000174376 315
202 3300005334 Ga0068869_100030784 Ga0068869_1000307842 315
203 3300005334 Ga0068869_100035572 Ga0068869_1000355722 315
204 3300005334 Ga0068869_100037162 Ga0068869_1000371623 315
205 3300005334 Ga0068869_100044864 Ga0068869_1000448643 315
206 3300005338 Ga0068868_100004611 Ga0068868_10000461111 315
207 3300005340 Ga0070689_100088515 Ga0070689_1000885152 315
208 3300005347 Ga0070668_100008643 Ga0070668_1000086433 315
209 3300005347 Ga0070668_100213752 Ga0070668_1002137521 315
210 3300005353 Ga0070669_100007779 Ga0070669_1000077796 315
211 3300005353 Ga0070669_100121804 Ga0070669_1001218042 315
212 3300005354 Ga0070675_100018008 Ga0070675_1000180085 315
213 3300005356 Ga0070674_100009129 Ga0070674_1000091296 315
214 3300005365 Ga0070688_100066159 Ga0070688_1000661592 315
215 3300005456 Ga0070678_100008731 Ga0070678_1000087317 315
216 3300005456 Ga0070678_100068455 Ga0070678_1000684552 315
217 3300005457 Ga0070662_100039869 Ga0070662_1000398693 315
218 3300005459 Ga0068867_100065990 Ga0068867_1000659901 315
219 3300005466 Ga0070685_10060660 Ga0070685_100606602 315
220 3300005471 Ga0070698_100000850 Ga0070698_10000085015 315
221 3300005471 Ga0070698_100018681 Ga0070698_1000186815 315
222 3300005539 Ga0068853_100044279 Ga0068853_1000442793 315
223 3300005539 Ga0068853_100445188 Ga0068853_1004451882 315
224 3300005543 Ga0070672_100042845 Ga0070672_1000428453 315
225 3300005543 Ga0070672_100068671 Ga0070672_1000686713 315
226 3300005543 Ga0070672_100073303 Ga0070672_1000733033 315
227 3300005543 Ga0070672_100453453 Ga0070672_1004534531 315
228 3300005548 Ga0070665_100084739 Ga0070665_1000847392 315
229 3300005548 Ga0070665_100460902 Ga0070665_1004609022 315
230 3300005549 Ga0070704_100282955 Ga0070704_1002829552 315
231 3300005577 Ga0068857_100047104 Ga0068857_1000471043 315
232 3300005577 Ga0068857_100049009 Ga0068857_1000490093 315
233 3300005615 Ga0070702_100022014 Ga0070702_1000220143 315
234 3300005616 Ga0068852_100534874 Ga0068852_1005348741 315
235 3300005617 Ga0068859_100024704 Ga0068859_1000247042 315
236 3300005618 Ga0068864_100064184 Ga0068864_1000641842 315
237 3300005618 Ga0068864_100506287 Ga0068864_1005062871 315
238 3300005719 Ga0068861_100002332 Ga0068861_10000233212 315
239 3300005719 Ga0068861_100056023 Ga0068861_1000560232 315
240 3300005840 Ga0068870_10005159 Ga0068870_100051596 315
241 3300005840 Ga0068870_10006965 Ga0068870_100069655 315
242 3300005840 Ga0068870_10090773 Ga0068870_100907732 315
243 3300005841 Ga0068863_100024490 Ga0068863_1000244904 315
244 3300005841 Ga0068863_100046824 Ga0068863_1000468244 315
245 3300005842 Ga0068858_100227727 Ga0068858_1002277271 315
246 3300005843 Ga0068860_100053218 Ga0068860_1000532186 315
247 3300005843 Ga0068860_100072941 Ga0068860_1000729412 315
248 3300005844 Ga0068862_100153106 Ga0068862_1001531062 315
249 3300006195 Ga0075366_10006034 Ga0075366_100060344 315
250 3300006195 Ga0075366_10022580 Ga0075366_100225801 315
251 3300006237 Ga0097621_100008757 Ga0097621_1000087577 315
252 3300006237 Ga0097621_100115982 Ga0097621_1001159822 315
253 3300006358 Ga0068871_100007800 Ga0068871_1000078009 315
254 3300006358 Ga0068871_100026146 Ga0068871_1000261463 315
255 3300006844 Ga0075428_100341128 Ga0075428_1003411282 315
256 3300006844 Ga0075428_100469192 Ga0075428_1004691922 315
257 3300006846 Ga0075430_100003052 Ga0075430_1000030528 315
258 3300006846 Ga0075430_100038623 Ga0075430_1000386233 315
259 3300006847 Ga0075431_100006268 Ga0075431_1000062683 315
260 3300006880 Ga0075429_100022294 Ga0075429_1000222948 315
261 3300006880 Ga0075429_100266392 Ga0075429_1002663922 315
262 3300006881 Ga0068865_100016453 Ga0068865_1000164534 315
263 3300006931 Ga0097620_100024706 Ga0097620_1000247062 315
264 3300009101 Ga0105247_10000408 Ga0105247_100004083 315
265 3300009147 Ga0114129_10043242 Ga0114129_100432422 315
266 3300009147 Ga0114129_10114584 Ga0114129_101145843 315
267 3300009174 Ga0105241_10052115 Ga0105241_100521153 315
268 3300009176 Ga0105242_10018955 Ga0105242_100189554 315
269 3300009176 Ga0105242_10036758 Ga0105242_100367584 315
270 3300009176 Ga0105242_10129466 Ga0105242_101294662 315
271 3300009553 Ga0105249_10004239 Ga0105249_100042395 315
272 3300009553 Ga0105249_10004712 Ga0105249_1000471211 315
273 3300009553 Ga0105249_10312189 Ga0105249_103121892 315
274 3300013102 Ga0157371_10106169 Ga0157371_101061692 315
275 3300013296 Ga0157374_10219893 Ga0157374_102198932 315
276 3300013297 Ga0157378_10044156 Ga0157378_100441564 315
277 3300013306 Ga0163162_10128471 Ga0163162_101284712 315
278 3300013307 Ga0157372_10442655 Ga0157372_104426552 315
279 3300014325 Ga0163163_10259565 Ga0163163_102595652 315
280 3300014745 Ga0157377_10003672 Ga0157377_100036726 315
281 3300017792 Ga0163161_10206474 Ga0163161_102064742 315
282 3300025302 Ga0207426_1000026 Ga0207426_1000026265 315
283 3300025321 Ga0207656_10025952 Ga0207656_100259522 315
284 3300025899 Ga0207642_10016844 Ga0207642_100168443 315
285 3300025907 Ga0207645_10000748 Ga0207645_1000074819 315
286 3300025908 Ga0207643_10003520 Ga0207643_100035207 315
287 3300025908 Ga0207643_10007286 Ga0207643_100072862 315
288 3300025908 Ga0207643_10016684 Ga0207643_100166843 315
289 3300025918 Ga0207662_10044009 Ga0207662_100440093 315
290 3300025923 Ga0207681_10003075 Ga0207681_100030755 315
291 3300025923 Ga0207681_10044196 Ga0207681_100441962 315
292 3300025925 Ga0207650_10089645 Ga0207650_100896452 315
293 3300025926 Ga0207659_10009012 Ga0207659_100090123 315
294 3300025933 Ga0207706_10016620 Ga0207706_100166205 315
295 3300025933 Ga0207706_10023769 Ga0207706_100237696 315
296 3300025934 Ga0207686_10008363 Ga0207686_100083632 315
297 3300025934 Ga0207686_10074316 Ga0207686_100743162 315
298 3300025934 Ga0207686_10156791 Ga0207686_101567912 315
299 3300025937 Ga0207669_10105515 Ga0207669_101055151 315
300 3300025940 Ga0207691_10002072 Ga0207691_1000207213 315
301 3300025940 Ga0207691_10084065 Ga0207691_100840653 315
302 3300025942 Ga0207689_10000628 Ga0207689_100006286 315
303 3300025942 Ga0207689_10001418 Ga0207689_1000141816 315
304 3300025942 Ga0207689_10011584 Ga0207689_100115846 315
305 3300025942 Ga0207689_10012010 Ga0207689_100120102 315
306 3300025942 Ga0207689_10051348 Ga0207689_100513483 315
307 3300025942 Ga0207689_10172239 Ga0207689_101722392 315
308 3300025960 Ga0207651_10137371 Ga0207651_101373712 315
309 3300025961 Ga0207712_10001226 Ga0207712_100012269 315
310 3300025961 Ga0207712_10006083 Ga0207712_100060836 315
311 3300025972 Ga0207668_10336009 Ga0207668_103360092 315
312 3300025972 Ga0207668_10429814 Ga0207668_104298142 315
313 3300025986 Ga0207658_10364004 Ga0207658_103640042 315
314 3300026023 Ga0207677_10016754 Ga0207677_100167542 315
315 3300026023 Ga0207677_10357342 Ga0207677_103573421 315
316 3300026035 Ga0207703_10033475 Ga0207703_100334753 315
317 3300026041 Ga0207639_10230928 Ga0207639_102309282 315
318 3300026041 Ga0207639_10247274 Ga0207639_102472742 315
319 3300026075 Ga0207708_10248516 Ga0207708_102485162 315
320 3300026088 Ga0207641_10011229 Ga0207641_100112294 315
321 3300026088 Ga0207641_10027154 Ga0207641_100271543 315
322 3300026089 Ga0207648_10000372 Ga0207648_1000037213 315
323 3300026089 Ga0207648_10002066 Ga0207648_100020664 315
324 3300026089 Ga0207648_10015759 Ga0207648_100157594 315
325 3300026089 Ga0207648_10092895 Ga0207648_100928951 315
326 3300026089 Ga0207648_10359075 Ga0207648_103590751 315
327 3300026095 Ga0207676_10046670 Ga0207676_100466702 315
328 3300026116 Ga0207674_10128989 Ga0207674_101289892 315
329 3300026118 Ga0207675_100000051 Ga0207675_10000005133 315
330 3300026118 Ga0207675_100073698 Ga0207675_1000736982 315
331 3300026118 Ga0207675_100121039 Ga0207675_1001210393 315
332 3300026118 Ga0207675_100129619 Ga0207675_1001296192 315
333 3300026118 Ga0207675_100131880 Ga0207675_1001318802 315
334 3300026118 Ga0207675_100201491 Ga0207675_1002014912 315
335 3300026121 Ga0207683_10001617 Ga0207683_100016174 315
336 3300026142 Ga0207698_10284809 Ga0207698_102848092 315
337 3300027907 Ga0207428_10273842 Ga0207428_102738422 315
338 3300028379 Ga0268266_10182107 Ga0268266_101821072 315
339 3300028379 Ga0268266_10337496 Ga0268266_103374962 315
340 3300028380 Ga0268265_10007190 Ga0268265_100071907 315
341 3300028380 Ga0268265_10080013 Ga0268265_100800133 315
342 3300028381 Ga0268264_10039936 Ga0268264_100399363 315
343 3300028381 Ga0268264_10059527 Ga0268264_100595272 315
344 3300028381 Ga0268264_10349896 Ga0268264_103498962 315
345 3300029957 Ga0265324_10012776 Ga0265324_100127763 315
346 3300031251 Ga0265327_10020718 Ga0265327_100207184 315
347 3300037418 Ga0395900_0341127 Ga0395900_0341127_178_1167 315
348 3300046460 Ga0495638_0087723 Ga0495638_0087723_415_1413 315
349 3300046471 Ga0495650_0032493 Ga0495650_0032493_864_1853 315
350 3300047320 Ga0495672_0012491 Ga0495672_0012491_3943_4953 315
351 3300047320 Ga0495672_0045884 Ga0495672_0045884_1522_2511 315
352 3300047472 Ga0495686_0018229 Ga0495686_0018229_2153_3145 315
353 3300050507 nmdc:mga05p37_489696_c1 nmdc:mga05p37_489696_c1_313_1296 315
354 3300050508 nmdc:mga09592_80226_c1 nmdc:mga09592_80226_c1_173_1168 315
355 3300050509 nmdc:mga0qj67_20468_c1 nmdc:mga0qj67_20468_c1_1370_2365 315
356 3300050509 nmdc:mga0qj67_27147_c1 nmdc:mga0qj67_27147_c1_280_1263 315
357 3300050510 nmdc:mga06r32_181755_c1 nmdc:mga06r32_181755_c1_465_1448 315
358 3300050511 nmdc:mga08y16_421660_c1 nmdc:mga08y16_421660_c1_299_1300 315
359 3300053139 Ga0500568_0000532 Ga0500568_0000532_17417_18406 315
360 3300053727 Ga0500611_000038 Ga0500611_000038_23882_24880 315
361 3300003323 rootH1_10017103 rootH1_1001710324 316
362 3300005331 Ga0070670_100314580 Ga0070670_1003145802 316
363 3300005334 Ga0068869_100254069 Ga0068869_1002540691 316
364 3300005459 Ga0068867_100268707 Ga0068867_1002687072 316
365 3300005563 Ga0068855_100007582 Ga0068855_1000075824 316
366 3300005577 Ga0068857_100017630 Ga0068857_1000176302 316
367 3300006195 Ga0075366_10041904 Ga0075366_100419042 316
368 3300006358 Ga0068871_100286494 Ga0068871_1002864942 316
369 3300006844 Ga0075428_100550785 Ga0075428_1005507851 316
370 3300009147 Ga0114129_10650798 Ga0114129_106507981 316
371 3300010375 Ga0105239_10047696 Ga0105239_100476962 316
372 3300025925 Ga0207650_10154792 Ga0207650_101547922 316
373 3300025949 Ga0207667_10008843 Ga0207667_100088438 316
374 3300026116 Ga0207674_10018901 Ga0207674_100189013 316
375 3300027876 Ga0209974_10076721 Ga0209974_100767212 316
376 3300031251 Ga0265327_10041792 Ga0265327_100417922 316
377 3300031507 Ga0307509_10202134 Ga0307509_102021342 316
378 3300044656 Ga0466969_0000033 Ga0466969_0000033_75773_76765 316
379 3300044658 Ga0466972_0000091 Ga0466972_0000091_59453_60445 316
380 3300044684 Ga0466966_0000170 Ga0466966_0000170_9533_10525 316
381 3300044842 Ga0466957_0003977 Ga0466957_0003977_1783_2775 316
382 3300045049 Ga0466959_0000089 Ga0466959_0000089_9533_10525 316
383 3300050493 nmdc:mga0k408_43315_c1 nmdc:mga0k408_43315_c1_210_1202 316
384 3300050507 nmdc:mga05p37_9961_c1 nmdc:mga05p37_9961_c1_8391_9383 316
385 3300053092 Ga0500583_0000002 Ga0500583_0000002_166680_167672 316
386 3300053092 Ga0500583_0000356 Ga0500583_0000356_5231_6223 316
387 3300053147 Ga0500589_007446 Ga0500589_007446_976_1968 316
388 3300003187 JGI25151J46595_10002367 JGI25151J46595_1000236711 317
389 3300003187 JGI25151J46595_10010816 JGI25151J46595_100108164 317
390 3300003187 JGI25151J46595_10050538 JGI25151J46595_100505382 317
391 3300005293 Ga0065715_10292667 Ga0065715_102926671 317
392 3300005333 Ga0070677_10058933 Ga0070677_100589332 317
393 3300009011 Ga0105251_10009303 Ga0105251_100093033 317
394 3300009011 Ga0105251_10061904 Ga0105251_100619042 317
395 3300009036 Ga0105244_10000740 Ga0105244_1000074013 317
396 3300009092 Ga0105250_10004788 Ga0105250_100047882 317
397 3300009092 Ga0105250_10004885 Ga0105250_100048853 317
398 3300014326 Ga0157380_10483634 Ga0157380_104836342 317
399 3300025284 Ga0209130_1000192 Ga0209130_100019261 317
400 3300025284 Ga0209130_1001290 Ga0209130_10012906 317
401 3300025284 Ga0209130_1002569 Ga0209130_10025692 317
402 3300025294 Ga0209025_1000915 Ga0209025_100091530 317
403 3300025294 Ga0209025_1001333 Ga0209025_100133311 317
404 3300025294 Ga0209025_1001933 Ga0209025_100193316 317
405 3300025294 Ga0209025_1003383 Ga0209025_10033839 317
406 3300025294 Ga0209025_1006511 Ga0209025_100651110 317
407 3300025294 Ga0209025_1008222 Ga0209025_10082222 317
408 3300025294 Ga0209025_1008660 Ga0209025_10086606 317
409 3300025294 Ga0209025_1013771 Ga0209025_10137714 317
410 3300025294 Ga0209025_1038108 Ga0209025_10381083 317
411 3300025711 Ga0207696_1009280 Ga0207696_10092802 317
412 3300025728 Ga0207655_1003331 Ga0207655_10033313 317
413 3300025937 Ga0207669_10225658 Ga0207669_102256582 317
414 3300025940 Ga0207691_10023350 Ga0207691_100233502 317
415 3300025960 Ga0207651_10237253 Ga0207651_102372532 317
416 3300030083 Ga0237817_10067 Ga0237817_1006721 317
417 3300035170 Ga0373943_0042816 Ga0373943_0042816_844_1797 317
418 3300038705 Ga0237819_00368 Ga0237819_00368_4869_5858 317
419 3300038705 Ga0237819_07815 Ga0237819_07815_153_1142 317
420 3300045976 Ga0466967_0000284 Ga0466967_0000284_18979_19968 317
421 3300053142 Ga0500577_0002134 Ga0500577_0002134_1162_2124 317
422 3300005331 Ga0070670_100016285 Ga0070670_1000162855 318
423 3300005343 Ga0070687_100094320 Ga0070687_1000943201 318
424 3300005354 Ga0070675_100145629 Ga0070675_1001456292 318
425 3300005466 Ga0070685_10023144 Ga0070685_100231444 318
426 3300005617 Ga0068859_100519560 Ga0068859_1005195602 318
427 3300005618 Ga0068864_100042196 Ga0068864_1000421963 318
428 3300005618 Ga0068864_100510614 Ga0068864_1005106142 318
429 3300005842 Ga0068858_100185784 Ga0068858_1001857842 318
430 3300006931 Ga0097620_100519559 Ga0097620_1005195592 318
431 3300009553 Ga0105249_10052693 Ga0105249_100526934 318
432 3300013100 Ga0157373_10032564 Ga0157373_100325642 318
433 3300014325 Ga0163163_10111839 Ga0163163_101118393 318
434 3300025926 Ga0207659_10151559 Ga0207659_101515592 318
435 3300026035 Ga0207703_10138458 Ga0207703_101384582 318
436 3300026088 Ga0207641_10090357 Ga0207641_100903572 318
437 3300026095 Ga0207676_10051016 Ga0207676_100510161 318
438 3300031903 Ga0307407_10233867 Ga0307407_102338672 318
439 3300005295 Ga0065707_10107729 Ga0065707_101077292 319
440 3300005539 Ga0068853_100009713 Ga0068853_1000097134 319
441 3300005577 Ga0068857_100182275 Ga0068857_1001822752 319
442 3300009093 Ga0105240_10123321 Ga0105240_101233212 319
443 3300014969 Ga0157376_10571117 Ga0157376_105711172 319
444 3300026041 Ga0207639_10168179 Ga0207639_101681792 319
445 3300026116 Ga0207674_10021791 Ga0207674_100217915 319
446 3300031548 Ga0307408_100011004 Ga0307408_1000110043 319
447 3300031731 Ga0307405_10009755 Ga0307405_100097556 319
448 3300031852 Ga0307410_10070501 Ga0307410_100705012 319
449 3300031901 Ga0307406_10005517 Ga0307406_100055173 319
450 3300031911 Ga0307412_10008114 Ga0307412_100081146 319
451 3300032005 Ga0307411_10002692 Ga0307411_100026926 319
452 3300042125 Ga0450923_006545 Ga0450923_006545_799_1812 319
453 3300005340 Ga0070689_100029334 Ga0070689_1000293344 320
454 3300005617 Ga0068859_100013961 Ga0068859_1000139613 320
455 3300005843 Ga0068860_100053482 Ga0068860_1000534822 320
456 3300005844 Ga0068862_100203701 Ga0068862_1002037012 320
457 3300006931 Ga0097620_100013961 Ga0097620_1000139613 320
458 3300009553 Ga0105249_10014866 Ga0105249_100148661 320
459 3300028380 Ga0268265_10118239 Ga0268265_101182392 320
460 3300031995 Ga0307409_100063064 Ga0307409_1000630643 320
461 3300046543 Ga0495645_0264309 Ga0495645_0264309_23_985 320
462 3300053085 Ga0495619_0079934 Ga0495619_0079934_1133_2095 320
463 3300017792 Ga0163161_10052098 Ga0163161_100520983 322
464 3300000549 LJQas_1000595 LJQas_10005951 328

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02626

CT_A_B

Carboxyltransferase domain, subdomain A and B

25

300

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dud-assembly1.cif.gz_A crystal structure of e. coli ybgjk 0.9485 3 311
5dud-assembly2.cif.gz_C crystal structure of e. coli ybgjk 0.9413 3 311
5dud-assembly1.cif.gz_A crystal structure of e. coli ybgjk 0.9363 3 311
5dud-assembly2.cif.gz_C crystal structure of e. coli ybgjk 0.9228 3 311
3opf-assembly2.cif.gz_B crystal structure of ttha0988 in space group p212121 0.9122 2 289
ID Description Score Start End Superfamily
5dudA02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9415 176 310 2.40.100.10
3mmlG02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9243 179 290 2.40.100.10
5dudA02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9151 176 310 2.40.100.10
af_Q2G094_189_326_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.889 177 315 2.40.100.10
af_Q2FXW9_143_281_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8838 177 318 2.40.100.10
ID Description Score Start End GO Terms
AF-A0A7V9NNV8-F1-model_v4 KipI antagonist 0.9816 1 138 GO:0005524
GO:0016787
AF-A0A7V9JVT5-F1-model_v4 Biotin-dependent carboxyltransferase family protein 0.9769 1 316 GO:0005524
GO:0016740
GO:0016787
AF-A0A7W1D9Q5-F1-model_v4 Biotin-dependent carboxyltransferase family protein 0.9755 1 316 GO:0005524
GO:0016740
GO:0016787
AF-A0A2A5M713-F1-model_v4 Allophanate hydrolase 0.9754 34 123 GO:0005524
GO:0016787
AF-A0A382YFD3-F1-model_v4 Carboxyltransferase domain-containing protein 0.9753 10 149 GO:0005524
GO:0016787

Feature Viewer

pLDDT pTM Quality
90.27 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map