F449282

General Info

Members Datasets Scaffolds Average Seq Length
464 191 928 194

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10114113|Ga0105241_101141132
Length 214
Sequence VQLKLRGSNLISAFGPQKGTKIFKESIEMSFIKKSSPVLIAALALVFSFSALALGKTKNSKFPNINIKNFGQMDERFYRGSRPDDGDYTALAALGVHTVIDLTDNSRAYEQPAVERAGLRYINIPMVDKSYPSMDQINQFLKVVDDPATGKFFVHCAGGRHRTGVVGAVYRFTHDHWNLDQVLAEMDQYEFGSGYGHGKQMDFVKNYWQNLSHR

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
145 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
146 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
153 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
159 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
164 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
165 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
166 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
167 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
168 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
169 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
170 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
171 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
172 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
173 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
174 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
175 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
176 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
177 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
178 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
179 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
180 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
181 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 1.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.65
Rhizosphere 99.14
Stem 0
Stem Tuber 0
Unclassified 23.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10114113 3300009174 Unclassified 2167
2 SwRhRL3b_contig_3473131 2162886006 Unclassified 1322
3 JGI24737J22298_10072129 3300001990 Unclassified 1031
4 JGI24751J29686_10000047 3300002459 Bacteria 72878
5 Ga0058860_11767844 3300004801 Unclassified 629
6 Ga0065714_10064429 3300005288 Bacteria 141954
7 Ga0065714_10229492 3300005288 Bacteria 820
8 Ga0065704_10003262 3300005289 Bacteria 7101
9 Ga0065704_10124007 3300005289 Bacteria 1724
10 Ga0065704_10283316 3300005289 Bacteria 916
11 Ga0065712_10067729 3300005290 Bacteria 142513
12 Ga0065712_10072214 3300005290 Bacteria 4854
13 Ga0065712_10081424 3300005290 Bacteria 3003
14 Ga0065712_10262443 3300005290 Bacteria 934
15 Ga0065712_10434154 3300005290 Bacteria 700
16 Ga0065715_10006605 3300005293 Bacteria 3106
17 Ga0065715_10089911 3300005293 Bacteria 8153
18 Ga0065715_10096459 3300005293 Unclassified 3874
19 Ga0065715_10151241 3300005293 Unclassified 1726
20 Ga0065715_10160312 3300005293 Bacteria 1636
21 Ga0065715_10197063 3300005293 Bacteria 1381
22 Ga0065715_10297153 3300005293 Bacteria 1050
23 Ga0065715_10537311 3300005293 Unclassified 751
24 Ga0065707_10008626 3300005295 Bacteria 2809
25 Ga0065707_10012609 3300005295 Bacteria 1957
26 Ga0065707_10097952 3300005295 Bacteria 3126
27 Ga0065707_10111476 3300005295 Bacteria 2393
28 Ga0070690_100001345 3300005330 Bacteria 12774
29 Ga0070670_100000220 3300005331 Bacteria 52670
30 Ga0070670_100018675 3300005331 Bacteria 5942
31 Ga0070670_100081093 3300005331 Plasmid 2788
32 Ga0070670_100658386 3300005331 Bacteria 940
33 Ga0070670_100741075 3300005331 Bacteria 885
34 Ga0070670_101002050 3300005331 Bacteria 760
35 Ga0068869_100014703 3300005334 Bacteria 5235
36 Ga0068869_100047287 3300005334 Bacteria 3107
37 Ga0068869_100402907 3300005334 Bacteria 1126
38 Ga0070680_100076989 3300005336 Bacteria 2747
39 Ga0070682_100013448 3300005337 Unclassified 4709
40 Ga0070682_100232161 3300005337 Unclassified 1319
41 Ga0068868_100200175 3300005338 Bacteria 1665
42 Ga0068868_101331540 3300005338 Unclassified 668
43 Ga0070660_100239683 3300005339 Bacteria 1477
44 Ga0070689_100002208 3300005340 Bacteria 12619
45 Ga0070689_100332183 3300005340 Bacteria 1272
46 Ga0070691_10238774 3300005341 Bacteria 970
47 Ga0070661_100498240 3300005344 Unclassified 975
48 Ga0070692_10004812 3300005345 Bacteria 5676
49 Ga0070692_10036536 3300005345 Unclassified 2493
50 Ga0070692_10049916 3300005345 Bacteria 2171
51 Ga0070692_10068348 3300005345 Bacteria 1887
52 Ga0070692_10172833 3300005345 Unclassified 1247
53 Ga0070692_10286900 3300005345 Bacteria 1000
54 Ga0070692_10356270 3300005345 Unclassified 911
55 Ga0070669_100027613 3300005353 Bacteria 4085
56 Ga0070669_100414475 3300005353 Unclassified 1104
57 Ga0070673_100088110 3300005364 Bacteria 2531
58 Ga0070673_100311439 3300005364 Bacteria 1389
59 Ga0070673_100452778 3300005364 Bacteria 1155
60 Ga0070703_10014338 3300005406 Unclassified 2257
61 Ga0070709_10612562 3300005434 Unclassified 839
62 Ga0070701_10012624 3300005438 Bacteria 3816
63 Ga0070701_10075836 3300005438 Bacteria 1809
64 Ga0070701_10094577 3300005438 Bacteria 1644
65 Ga0070705_100006418 3300005440 Bacteria 5767
66 Ga0070705_100024809 3300005440 Unclassified 3242
67 Ga0070705_100360603 3300005440 Unclassified 1063
68 Ga0070700_100000022 3300005441 Bacteria 130126
69 Ga0070700_100000477 3300005441 Bacteria 20100
70 Ga0070700_100002968 3300005441 Bacteria 8706
71 Ga0070700_100037998 3300005441 Unclassified 2932
72 Ga0070700_100076282 3300005441 Unclassified 2152
73 Ga0070700_100087201 3300005441 Bacteria 2028
74 Ga0070700_100106989 3300005441 Bacteria 1853
75 Ga0070694_100037562 3300005444 Bacteria 3212
76 Ga0070694_100064335 3300005444 Unclassified 2510
77 Ga0070694_100071855 3300005444 Bacteria 2386
78 Ga0070694_100092395 3300005444 Bacteria 2126
79 Ga0070708_100130438 3300005445 Unclassified 2326
80 Ga0070708_100885048 3300005445 Bacteria 839
81 Ga0070708_101333418 3300005445 Unclassified 670
82 Ga0070663_100855550 3300005455 Bacteria 783
83 Ga0070662_100204056 3300005457 Bacteria 1570
84 Ga0070662_100905183 3300005457 Bacteria 753
85 Ga0068867_100113740 3300005459 Bacteria 2083
86 Ga0068867_100443625 3300005459 Bacteria 1104
87 Ga0068867_100712849 3300005459 Unclassified 887
88 Ga0068867_100791760 3300005459 Unclassified 845
89 Ga0070685_10049964 3300005466 Bacteria 2414
90 Ga0070706_100000015 3300005467 Bacteria 188425
91 Ga0070706_100035011 3300005467 Bacteria 4637
92 Ga0070698_101167297 3300005471 Unclassified 719
93 Ga0070699_100002528 3300005518 Bacteria 16425
94 Ga0070699_100170746 3300005518 Bacteria 1927
95 Ga0068853_100137949 3300005539 Unclassified 2188
96 Ga0070695_100014615 3300005545 Unclassified 4734
97 Ga0070695_100029662 3300005545 Bacteria 3400
98 Ga0070695_100132614 3300005545 Unclassified 1718
99 Ga0070695_100376479 3300005545 Bacteria 1070
100 Ga0070695_100844307 3300005545 Unclassified 736
101 Ga0070696_100347412 3300005546 Unclassified 1148
102 Ga0070693_100003771 3300005547 Bacteria 7096
103 Ga0070693_100046784 3300005547 Unclassified 2459
104 Ga0070693_100070867 3300005547 Bacteria 2052
105 Ga0070693_100213695 3300005547 Unclassified 1260
106 Ga0070704_100212714 3300005549 Bacteria 1568
107 Ga0070704_100257163 3300005549 Unclassified 1437
108 Ga0070704_100583398 3300005549 Unclassified 981
109 Ga0070704_100693975 3300005549 Unclassified 902
110 Ga0070664_100254183 3300005564 Bacteria 1580
111 Ga0068857_100132836 3300005577 Bacteria 2246
112 Ga0068857_100163611 3300005577 Bacteria 2020
113 Ga0068857_100178378 3300005577 Bacteria 1933
114 Ga0068857_100239561 3300005577 Bacteria 1660
115 Ga0068857_100475296 3300005577 Bacteria 1171
116 Ga0068857_100553152 3300005577 Unclassified 1084
117 Ga0068854_100790629 3300005578 Unclassified 826
118 Ga0068854_100791971 3300005578 Bacteria 826
119 Ga0068852_101284137 3300005616 Bacteria 754
120 Ga0068859_100000683 3300005617 Bacteria 34065
121 Ga0068859_100042420 3300005617 Bacteria 4570
122 Ga0068859_100043256 3300005617 Bacteria 4527
123 Ga0068859_100045226 3300005617 Bacteria 4423
124 Ga0068859_100061585 3300005617 Bacteria 3781
125 Ga0068859_100077104 3300005617 Bacteria 3374
126 Ga0068859_100088538 3300005617 Bacteria 3145
127 Ga0068859_100144403 3300005617 Bacteria 2454
128 Ga0068859_100167094 3300005617 Unclassified 2280
129 Ga0068859_100284778 3300005617 Bacteria 1745
130 Ga0068859_100419519 3300005617 Bacteria 1434
131 Ga0068859_100445908 3300005617 Unclassified 1390
132 Ga0068859_100543977 3300005617 Bacteria 1256
133 Ga0068859_100675418 3300005617 Bacteria 1124
134 Ga0068859_100689312 3300005617 Bacteria 1113
135 Ga0068864_100011700 3300005618 Bacteria 7246
136 Ga0068864_100169379 3300005618 Bacteria 1990
137 Ga0068864_100408186 3300005618 Bacteria 1292
138 Ga0068864_100761358 3300005618 Bacteria 949
139 Ga0068864_100831323 3300005618 Bacteria 909
140 Ga0068866_10259196 3300005718 Bacteria 1068
141 Ga0068861_100024019 3300005719 Bacteria 4403
142 Ga0068861_100026259 3300005719 Bacteria 4233
143 Ga0068861_100538681 3300005719 Unclassified 1062
144 Ga0068851_10002227 3300005834 Bacteria 8536
145 Ga0068870_10060543 3300005840 Bacteria 2033
146 Ga0068870_10140826 3300005840 Bacteria 1411
147 Ga0068870_10537379 3300005840 Unclassified 785
148 Ga0068863_100053934 3300005841 Bacteria 3810
149 Ga0068863_100626499 3300005841 Bacteria 1066
150 Ga0068858_100047757 3300005842 Bacteria 3968
151 Ga0068858_100155474 3300005842 Bacteria 2152
152 Ga0068858_100322177 3300005842 Bacteria 1477
153 Ga0068858_100408653 3300005842 Bacteria 1305
154 Ga0068858_101389606 3300005842 Bacteria 691
155 Ga0068860_100002252 3300005843 Bacteria 20291
156 Ga0068860_100068084 3300005843 Bacteria 3382
157 Ga0068860_100181170 3300005843 Bacteria 2036
158 Ga0068860_100224821 3300005843 Bacteria 1823
159 Ga0068860_100284743 3300005843 Bacteria 1616
160 Ga0068860_100481021 3300005843 Unclassified 1238
161 Ga0068862_100016838 3300005844 Bacteria 6084
162 Ga0068862_100256342 3300005844 Bacteria 1595
163 Ga0068862_100367117 3300005844 Unclassified 1339
164 Ga0068862_100766536 3300005844 Bacteria 940
165 Ga0068862_101078159 3300005844 Bacteria 797
166 Ga0070716_100358370 3300006173 Unclassified 1035
167 Ga0070716_100640898 3300006173 Bacteria 804
168 Ga0097621_100435506 3300006237 Bacteria 1179
169 Ga0068871_100001154 3300006358 Bacteria 17729
170 Ga0068871_101172603 3300006358 Bacteria 720
171 Ga0075428_100022262 3300006844 Bacteria 7017
172 Ga0075428_100525008 3300006844 Unclassified 1266
173 Ga0075428_100958234 3300006844 Unclassified 906
174 Ga0075431_100641834 3300006847 Unclassified 1043
175 Ga0075433_10612330 3300006852 Unclassified 956
176 Ga0075434_100272609 3300006871 Bacteria 1711
177 Ga0068865_100997562 3300006881 Bacteria 733
178 Ga0097620_100000683 3300006931 Bacteria 34065
179 Ga0097620_100042419 3300006931 Bacteria 4570
180 Ga0097620_100043257 3300006931 Bacteria 4527
181 Ga0097620_100045226 3300006931 Bacteria 4423
182 Ga0097620_100061588 3300006931 Bacteria 3781
183 Ga0097620_100077105 3300006931 Bacteria 3374
184 Ga0097620_100088540 3300006931 Bacteria 3145
185 Ga0097620_100144411 3300006931 Bacteria 2454
186 Ga0097620_100167080 3300006931 Unclassified 2280
187 Ga0097620_100284776 3300006931 Bacteria 1745
188 Ga0097620_100419508 3300006931 Bacteria 1434
189 Ga0097620_100445937 3300006931 Unclassified 1390
190 Ga0097620_100543951 3300006931 Bacteria 1256
191 Ga0097620_100675562 3300006931 Bacteria 1124
192 Ga0097620_100689227 3300006931 Bacteria 1113
193 Ga0105251_10107384 3300009011 Unclassified 1273
194 Ga0105240_10033648 3300009093 Bacteria 6618
195 Ga0111539_10001477 3300009094 Bacteria 31407
196 Ga0111539_10013939 3300009094 Bacteria 10049
197 Ga0111539_10033414 3300009094 Bacteria 6244
198 Ga0111539_10100073 3300009094 Bacteria 3404
199 Ga0111539_10109855 3300009094 Bacteria 3236
200 Ga0105245_10744675 3300009098 Bacteria 1015
201 Ga0105245_11748770 3300009098 Bacteria 674
202 Ga0105247_10014787 3300009101 Bacteria 4678
203 Ga0105247_10221274 3300009101 Bacteria 1281
204 Ga0105247_10551454 3300009101 Bacteria 848
205 Ga0105247_10706472 3300009101 Unclassified 759
206 Ga0105247_10804022 3300009101 Bacteria 718
207 Ga0114129_10041725 3300009147 Bacteria 6462
208 Ga0114129_10505842 3300009147 Bacteria 1577
209 Ga0114129_11005747 3300009147 Unclassified 1050
210 Ga0114129_11330682 3300009147 Unclassified 889
211 Ga0105243_10004126 3300009148 Bacteria 11551
212 Ga0105243_10452300 3300009148 Bacteria 1205
213 Ga0105243_10527492 3300009148 Bacteria 1124
214 Ga0105243_10540847 3300009148 Unclassified 1111
215 Ga0105243_10720728 3300009148 Unclassified 975
216 Ga0105243_11665815 3300009148 Unclassified 666
217 Ga0105241_10048287 3300009174 Bacteria 3239
218 Ga0105241_10195440 3300009174 Bacteria 1686
219 Ga0105241_10243083 3300009174 Bacteria 1522
220 Ga0105241_10344125 3300009174 Bacteria 1293
221 Ga0105241_10449924 3300009174 Bacteria 1139
222 Ga0105241_10538134 3300009174 Bacteria 1047
223 Ga0105241_10875130 3300009174 Unclassified 832
224 Ga0105242_10098826 3300009176 Bacteria 2469
225 Ga0105242_10351935 3300009176 Bacteria 1361
226 Ga0105248_10019048 3300009177 Bacteria 7588
227 Ga0105248_10069593 3300009177 Bacteria 3951
228 Ga0105248_10125635 3300009177 Bacteria 2894
229 Ga0105248_10248637 3300009177 Bacteria 2002
230 Ga0105248_10306432 3300009177 Bacteria 1789
231 Ga0105248_11214985 3300009177 Bacteria 852
232 Ga0105237_10002811 3300009545 Bacteria 21143
233 Ga0105237_10332632 3300009545 Bacteria 1523
234 Ga0105238_10004901 3300009551 Bacteria 13241
235 Ga0105238_10133664 3300009551 Bacteria 2459
236 Ga0105238_10301687 3300009551 Bacteria 1585
237 Ga0105249_10004612 3300009553 Bacteria 11899
238 Ga0105249_10431873 3300009553 Bacteria 1353
239 Ga0105249_10716298 3300009553 Bacteria 1061
240 Ga0105239_10374029 3300010375 Bacteria 1610
241 Ga0105239_11206459 3300010375 Bacteria 872
242 Ga0105239_12176620 3300010375 Bacteria 645
243 Ga0105246_10049719 3300011119 Unclassified 2872
244 Ga0105246_10071064 3300011119 Bacteria 2450
245 Ga0105246_10666001 3300011119 Bacteria 908
246 Ga0157373_10005773 3300013100 Bacteria 9266
247 Ga0157373_10019599 3300013100 Bacteria 4920
248 Ga0157371_10137206 3300013102 Bacteria 1742
249 Ga0157374_10352189 3300013296 Bacteria 1463
250 Ga0157378_10344049 3300013297 Bacteria 1455
251 Ga0157378_10395350 3300013297 Unclassified 1361
252 Ga0157378_10443739 3300013297 Unclassified 1287
253 Ga0157378_10795324 3300013297 Bacteria 971
254 Ga0163162_10153758 3300013306 Unclassified 2419
255 Ga0163162_10244335 3300013306 Bacteria 1926
256 Ga0163162_10361690 3300013306 Bacteria 1584
257 Ga0163162_10393299 3300013306 Bacteria 1519
258 Ga0163162_10690923 3300013306 Unclassified 1142
259 Ga0157372_10015507 3300013307 Bacteria 8170
260 Ga0157372_10155526 3300013307 Bacteria 2641
261 Ga0157375_10271643 3300013308 Bacteria 1858
262 Ga0157375_10306240 3300013308 Bacteria 1753
263 Ga0163163_10000319 3300014325 Bacteria 46719
264 Ga0163163_10075581 3300014325 Bacteria 3362
265 Ga0163163_10093791 3300014325 Bacteria 3018
266 Ga0163163_10306253 3300014325 Unclassified 1641
267 Ga0163163_10430299 3300014325 Bacteria 1379
268 Ga0163163_10800578 3300014325 Bacteria 1006
269 Ga0157380_10004816 3300014326 Bacteria 9404
270 Ga0157380_10009638 3300014326 Bacteria 6926
271 Ga0157380_10016814 3300014326 Bacteria 5402
272 Ga0157380_10181494 3300014326 Bacteria 1850
273 Ga0157380_11671774 3300014326 Unclassified 694
274 Ga0157377_10088230 3300014745 Bacteria 1826
275 Ga0157377_10196539 3300014745 Bacteria 1278
276 Ga0157377_10574049 3300014745 Unclassified 800
277 Ga0157379_10138106 3300014968 Unclassified 2197
278 Ga0182006_1162995 3300015261 Bacteria 750
279 Ga0163161_10117859 3300017792 Unclassified 1992
280 Ga0163161_10323811 3300017792 Bacteria 1219
281 Ga0207656_10001181 3300025321 Bacteria 8603
282 Ga0207653_10016137 3300025885 Unclassified 2345
283 Ga0207642_10444328 3300025899 Bacteria 784
284 Ga0207710_10000568 3300025900 Bacteria 22111
285 Ga0207688_10229954 3300025901 Bacteria 1119
286 Ga0207647_10004397 3300025904 Bacteria 10449
287 Ga0207647_10024705 3300025904 Bacteria 3960
288 Ga0207647_10080013 3300025904 Bacteria 1960
289 Ga0207647_10241924 3300025904 Bacteria 1036
290 Ga0207645_10292258 3300025907 Bacteria 1084
291 Ga0207643_10002734 3300025908 Bacteria 9546
292 Ga0207643_10005869 3300025908 Bacteria 6560
293 Ga0207643_10045440 3300025908 Bacteria 2480
294 Ga0207684_10000083 3300025910 Bacteria 176092
295 Ga0207654_10144341 3300025911 Bacteria 1521
296 Ga0207707_10312731 3300025912 Unclassified 1357
297 Ga0207671_10009471 3300025914 Bacteria 8137
298 Ga0207671_10076616 3300025914 Bacteria 2503
299 Ga0207671_10300046 3300025914 Bacteria 1269
300 Ga0207671_10375950 3300025914 Bacteria 1128
301 Ga0207660_10032159 3300025917 Bacteria 3619
302 Ga0207662_10001501 3300025918 Bacteria 11339
303 Ga0207662_10157896 3300025918 Bacteria 1447
304 Ga0207657_10200733 3300025919 Bacteria 1604
305 Ga0207681_10048945 3300025923 Bacteria 2855
306 Ga0207681_10067219 3300025923 Bacteria 2484
307 Ga0207650_10000007 3300025925 Bacteria 530810
308 Ga0207650_10125545 3300025925 Unclassified 2003
309 Ga0207659_10386650 3300025926 Bacteria 1168
310 Ga0207706_10051815 3300025933 Bacteria 3624
311 Ga0207706_10488134 3300025933 Unclassified 1064
312 Ga0207706_10616639 3300025933 Bacteria 931
313 Ga0207686_10044189 3300025934 Bacteria 2735
314 Ga0207686_10137133 3300025934 Bacteria 1686
315 Ga0207686_10367707 3300025934 Bacteria 1087
316 Ga0207709_10002729 3300025935 Bacteria 10893
317 Ga0207709_10465013 3300025935 Unclassified 980
318 Ga0207670_10002834 3300025936 Bacteria 9147
319 Ga0207665_10248119 3300025939 Bacteria 1314
320 Ga0207691_10090981 3300025940 Unclassified 2734
321 Ga0207691_10183891 3300025940 Bacteria 1825
322 Ga0207711_10013827 3300025941 Bacteria 6701
323 Ga0207711_10071007 3300025941 Bacteria 3020
324 Ga0207711_10199135 3300025941 Bacteria 1827
325 Ga0207711_10587227 3300025941 Bacteria 1039
326 Ga0207689_10047941 3300025942 Bacteria 3524
327 Ga0207689_10206913 3300025942 Bacteria 1621
328 Ga0207689_10227966 3300025942 Bacteria 1540
329 Ga0207689_10375564 3300025942 Bacteria 1183
330 Ga0207651_10098769 3300025960 Bacteria 2160
331 Ga0207651_10273283 3300025960 Unclassified 1393
332 Ga0207651_10563480 3300025960 Bacteria 992
333 Ga0207712_10005815 3300025961 Bacteria 7774
334 Ga0207712_10018235 3300025961 Bacteria 4569
335 Ga0207640_10463095 3300025981 Bacteria 1048
336 Ga0207677_10011669 3300026023 Bacteria 5017
337 Ga0207677_10211271 3300026023 Unclassified 1550
338 Ga0207703_10017255 3300026035 Bacteria 5633
339 Ga0207703_10049467 3300026035 Bacteria 3399
340 Ga0207703_10221668 3300026035 Bacteria 1691
341 Ga0207703_10565290 3300026035 Bacteria 1073
342 Ga0207639_10074286 3300026041 Bacteria 2669
343 Ga0207708_10000040 3300026075 Bacteria 130242
344 Ga0207708_10001283 3300026075 Bacteria 18865
345 Ga0207708_10012084 3300026075 Bacteria 6436
346 Ga0207708_10013954 3300026075 Bacteria 6002
347 Ga0207708_10119353 3300026075 Bacteria 2054
348 Ga0207708_10155170 3300026075 Bacteria 1805
349 Ga0207708_10178933 3300026075 Bacteria 1683
350 Ga0207641_10067708 3300026088 Bacteria 3060
351 Ga0207641_10128677 3300026088 Bacteria 2271
352 Ga0207641_10360664 3300026088 Bacteria 1387
353 Ga0207641_10734876 3300026088 Bacteria 974
354 Ga0207641_10742552 3300026088 Unclassified 968
355 Ga0207648_10026004 3300026089 Bacteria 5205
356 Ga0207648_10134414 3300026089 Bacteria 2178
357 Ga0207648_10687246 3300026089 Bacteria 948
358 Ga0207648_10815562 3300026089 Bacteria 869
359 Ga0207648_11047966 3300026089 Unclassified 764
360 Ga0207676_10006945 3300026095 Bacteria 8022
361 Ga0207676_10108868 3300026095 Bacteria 2314
362 Ga0207676_10386913 3300026095 Bacteria 1303
363 Ga0207676_10654879 3300026095 Bacteria 1014
364 Ga0207674_10046277 3300026116 Unclassified 4468
365 Ga0207674_10158829 3300026116 Unclassified 2216
366 Ga0207674_10211623 3300026116 Bacteria 1888
367 Ga0207674_10295729 3300026116 Bacteria 1568
368 Ga0207674_10401274 3300026116 Bacteria 1325
369 Ga0207674_10525555 3300026116 Bacteria 1143
370 Ga0207674_10552380 3300026116 Bacteria 1112
371 Ga0207674_10586237 3300026116 Bacteria 1077
372 Ga0207675_100039507 3300026118 Bacteria 4403
373 Ga0207675_100041514 3300026118 Bacteria 4296
374 Ga0207675_100176209 3300026118 Bacteria 2046
375 Ga0207675_100228209 3300026118 Bacteria 1796
376 Ga0207675_100623637 3300026118 Bacteria 1083
377 Ga0207683_10501747 3300026121 Unclassified 1121
378 Ga0207698_10290570 3300026142 Bacteria 1517
379 Ga0207428_10011092 3300027907 Bacteria 8004
380 Ga0207428_10055357 3300027907 Bacteria 3154
381 Ga0207428_10372311 3300027907 Bacteria 1049
382 Ga0268264_10012594 3300028381 Bacteria 6967
383 Ga0268264_10083627 3300028381 Bacteria 2735
384 Ga0268264_10101529 3300028381 Bacteria 2501
385 Ga0268264_10129886 3300028381 Bacteria 2231
386 Ga0268264_11291420 3300028381 Unclassified 740
387 Ga0307408_100095124 3300031548 Bacteria 2258
388 Ga0307408_100309604 3300031548 Bacteria 1326
389 Ga0307410_10045026 3300031852 Bacteria 2935
390 Ga0307410_10456751 3300031852 Bacteria 1043
391 Ga0307406_10003059 3300031901 Bacteria 9106
392 Ga0307407_10096626 3300031903 Bacteria 1824
393 Ga0307412_10057275 3300031911 Unclassified 2601
394 Ga0307416_100253852 3300032002 Bacteria 1714
395 Ga0307416_100336125 3300032002 Unclassified 1521
396 Ga0307416_100475742 3300032002 Bacteria 1308
397 Ga0307416_100646159 3300032002 Bacteria 1142
398 Ga0307414_10098849 3300032004 Bacteria 2191
399 Ga0307414_10143215 3300032004 Bacteria 1874
400 Ga0307414_11034123 3300032004 Unclassified 757
401 Ga0307411_10095667 3300032005 Bacteria 2086
402 Ga0307415_100043944 3300032126 Bacteria 2984
403 Ga0307415_100556463 3300032126 Bacteria 1013
404 Ga0373930_0042610 3300034816 Bacteria 972
405 Ga0373940_0113444 3300035088 Bacteria 834
406 Ga0373949_0053232 3300035090 Bacteria 1025
407 Ga0373941_0069432 3300035115 Unclassified 1166
408 Ga0373931_0162048 3300035691 Bacteria 1312
409 Ga0395900_0638371 3300037418 Unclassified 1002
410 Ga0395898_0119646 3300037466 Unclassified 2523
411 Ga0395898_0754898 3300037466 Bacteria 914
412 Ga0395901_0292745 3300038443 Unclassified 1689
413 Ga0242422_00892 3300038699 Bacteria 2023
414 Ga0242420_000211 3300038996 Bacteria 6224
415 Ga0451576_0509081 3300045051 Bacteria 1265
416 Ga0496106_0020389 3300048909 Bacteria 4919
417 Ga0496107_0148706 3300048910 Bacteria 1732
418 Ga0496112_0225568 3300048915 Bacteria 1829
419 Ga0501299_012872 3300049522 Bacteria 1435
420 Ga0501336_010196 3300049552 Unclassified 750
421 Ga0501038_0006008 3300049574 Bacteria 11233
422 Ga0501040_0307851 3300049576 Bacteria 1133
423 Ga0501076_0177335 3300049592 Bacteria 1737
424 Ga0501198_019458 3300049649 Unclassified 1070
425 Ga0501207_009084 3300049654 Bacteria 1447
426 Ga0501209_069498 3300049656 Unclassified 999
427 Ga0501214_002688 3300049659 Bacteria 1518
428 Ga0501217_099036 3300049661 Unclassified 826
429 Ga0501223_006965 3300049663 Unclassified 2322
430 Ga0501223_067310 3300049663 Unclassified 704
431 Ga0501227_027874 3300049665 Bacteria 1339
432 Ga0501233_001505 3300049668 Unclassified 3977
433 Ga0501233_007967 3300049668 Bacteria 2031
434 Ga0501233_046782 3300049668 Unclassified 1036
435 Ga0501235_009728 3300049669 Bacteria 2103
436 Ga0501235_039272 3300049669 Bacteria 1080
437 Ga0501236_005108 3300049670 Bacteria 1580
438 Ga0501240_008038 3300049673 Bacteria 1342
439 Ga0501243_022228 3300049675 Bacteria 1050
440 Ga0501257_014567 3300049686 Bacteria 1811
441 Ga0501221_073411 3300049704 Unclassified 811
442 Ga0501221_138133 3300049704 Bacteria 636
443 Ga0501225_0020515 3300049705 Bacteria 1826
444 Ga0501229_010711 3300049706 Bacteria 1160
445 Ga0501234_005426 3300049707 Bacteria 1996
446 Ga0501245_007476 3300049708 Bacteria 1545
447 Ga0501283_013419 3300049779 Bacteria 1241
448 nmdc:mga05p37_185839_c1 3300050507 Bacteria 2527
449 nmdc:mga05p37_246736_c1 3300050507 Unclassified 2143
450 nmdc:mga05p37_32409_c1 3300050507 Bacteria 6389
451 nmdc:mga05p37_478786_c1 3300050507 Unclassified 1434
452 nmdc:mga06r32_628651_c1 3300050510 Unclassified 1043
453 nmdc:mga08y16_30839_c1 3300050511 Bacteria 5638
454 nmdc:mga08y16_50718_c1 3300050511 Bacteria 4343
455 nmdc:mga08y16_5480_c1 3300050511 Bacteria 13264
456 nmdc:mga08y16_5486_c1 3300050511 Bacteria 13259
457 nmdc:mga08y16_908891_c1 3300050511 Unclassified 866
458 nmdc:mga08x19_11312_c1 3300050514 Bacteria 5370
459 nmdc:mga0a205_326014_c1 3300050515 Unclassified 1406
460 Ga0587131_008611 3300059609 Bacteria 700
461 Ga0587128_064143 3300059630 Unclassified 701
462 Ga0587114_050328 3300059655 Unclassified 703
463 Ga0587111_0080887 3300060346 Bacteria 776
464 Ga0530510_0051054 3300061734 Bacteria 2988
465 Ga0105241_10114113
466 SwRhRL3b_contig_3473131
467 JGI24737J22298_10072129
468 JGI24751J29686_10000047
469 Ga0058860_11767844
470 Ga0065714_10064429
471 Ga0065714_10229492
472 Ga0065704_10003262
473 Ga0065704_10124007
474 Ga0065704_10283316
475 Ga0065712_10067729
476 Ga0065712_10072214
477 Ga0065712_10081424
478 Ga0065712_10262443
479 Ga0065712_10434154
480 Ga0065715_10006605
481 Ga0065715_10089911
482 Ga0065715_10096459
483 Ga0065715_10151241
484 Ga0065715_10160312
485 Ga0065715_10197063
486 Ga0065715_10297153
487 Ga0065715_10537311
488 Ga0065707_10008626
489 Ga0065707_10012609
490 Ga0065707_10097952
491 Ga0065707_10111476
492 Ga0070690_100001345
493 Ga0070670_100000220
494 Ga0070670_100018675
495 Ga0070670_100081093
496 Ga0070670_100658386
497 Ga0070670_100741075
498 Ga0070670_101002050
499 Ga0068869_100014703
500 Ga0068869_100047287
501 Ga0068869_100402907
502 Ga0070680_100076989
503 Ga0070682_100013448
504 Ga0070682_100232161
505 Ga0068868_100200175
506 Ga0068868_101331540
507 Ga0070660_100239683
508 Ga0070689_100002208
509 Ga0070689_100332183
510 Ga0070691_10238774
511 Ga0070661_100498240
512 Ga0070692_10004812
513 Ga0070692_10036536
514 Ga0070692_10049916
515 Ga0070692_10068348
516 Ga0070692_10172833
517 Ga0070692_10286900
518 Ga0070692_10356270
519 Ga0070669_100027613
520 Ga0070669_100414475
521 Ga0070673_100088110
522 Ga0070673_100311439
523 Ga0070673_100452778
524 Ga0070703_10014338
525 Ga0070709_10612562
526 Ga0070701_10012624
527 Ga0070701_10075836
528 Ga0070701_10094577
529 Ga0070705_100006418
530 Ga0070705_100024809
531 Ga0070705_100360603
532 Ga0070700_100000022
533 Ga0070700_100000477
534 Ga0070700_100002968
535 Ga0070700_100037998
536 Ga0070700_100076282
537 Ga0070700_100087201
538 Ga0070700_100106989
539 Ga0070694_100037562
540 Ga0070694_100064335
541 Ga0070694_100071855
542 Ga0070694_100092395
543 Ga0070708_100130438
544 Ga0070708_100885048
545 Ga0070708_101333418
546 Ga0070663_100855550
547 Ga0070662_100204056
548 Ga0070662_100905183
549 Ga0068867_100113740
550 Ga0068867_100443625
551 Ga0068867_100712849
552 Ga0068867_100791760
553 Ga0070685_10049964
554 Ga0070706_100000015
555 Ga0070706_100035011
556 Ga0070698_101167297
557 Ga0070699_100002528
558 Ga0070699_100170746
559 Ga0068853_100137949
560 Ga0070695_100014615
561 Ga0070695_100029662
562 Ga0070695_100132614
563 Ga0070695_100376479
564 Ga0070695_100844307
565 Ga0070696_100347412
566 Ga0070693_100003771
567 Ga0070693_100046784
568 Ga0070693_100070867
569 Ga0070693_100213695
570 Ga0070704_100212714
571 Ga0070704_100257163
572 Ga0070704_100583398
573 Ga0070704_100693975
574 Ga0070664_100254183
575 Ga0068857_100132836
576 Ga0068857_100163611
577 Ga0068857_100178378
578 Ga0068857_100239561
579 Ga0068857_100475296
580 Ga0068857_100553152
581 Ga0068854_100790629
582 Ga0068854_100791971
583 Ga0068852_101284137
584 Ga0068859_100000683
585 Ga0068859_100042420
586 Ga0068859_100043256
587 Ga0068859_100045226
588 Ga0068859_100061585
589 Ga0068859_100077104
590 Ga0068859_100088538
591 Ga0068859_100144403
592 Ga0068859_100167094
593 Ga0068859_100284778
594 Ga0068859_100419519
595 Ga0068859_100445908
596 Ga0068859_100543977
597 Ga0068859_100675418
598 Ga0068859_100689312
599 Ga0068864_100011700
600 Ga0068864_100169379
601 Ga0068864_100408186
602 Ga0068864_100761358
603 Ga0068864_100831323
604 Ga0068866_10259196
605 Ga0068861_100024019
606 Ga0068861_100026259
607 Ga0068861_100538681
608 Ga0068851_10002227
609 Ga0068870_10060543
610 Ga0068870_10140826
611 Ga0068870_10537379
612 Ga0068863_100053934
613 Ga0068863_100626499
614 Ga0068858_100047757
615 Ga0068858_100155474
616 Ga0068858_100322177
617 Ga0068858_100408653
618 Ga0068858_101389606
619 Ga0068860_100002252
620 Ga0068860_100068084
621 Ga0068860_100181170
622 Ga0068860_100224821
623 Ga0068860_100284743
624 Ga0068860_100481021
625 Ga0068862_100016838
626 Ga0068862_100256342
627 Ga0068862_100367117
628 Ga0068862_100766536
629 Ga0068862_101078159
630 Ga0070716_100358370
631 Ga0070716_100640898
632 Ga0097621_100435506
633 Ga0068871_100001154
634 Ga0068871_101172603
635 Ga0075428_100022262
636 Ga0075428_100525008
637 Ga0075428_100958234
638 Ga0075431_100641834
639 Ga0075433_10612330
640 Ga0075434_100272609
641 Ga0068865_100997562
642 Ga0097620_100000683
643 Ga0097620_100042419
644 Ga0097620_100043257
645 Ga0097620_100045226
646 Ga0097620_100061588
647 Ga0097620_100077105
648 Ga0097620_100088540
649 Ga0097620_100144411
650 Ga0097620_100167080
651 Ga0097620_100284776
652 Ga0097620_100419508
653 Ga0097620_100445937
654 Ga0097620_100543951
655 Ga0097620_100675562
656 Ga0097620_100689227
657 Ga0105251_10107384
658 Ga0105240_10033648
659 Ga0111539_10001477
660 Ga0111539_10013939
661 Ga0111539_10033414
662 Ga0111539_10100073
663 Ga0111539_10109855
664 Ga0105245_10744675
665 Ga0105245_11748770
666 Ga0105247_10014787
667 Ga0105247_10221274
668 Ga0105247_10551454
669 Ga0105247_10706472
670 Ga0105247_10804022
671 Ga0114129_10041725
672 Ga0114129_10505842
673 Ga0114129_11005747
674 Ga0114129_11330682
675 Ga0105243_10004126
676 Ga0105243_10452300
677 Ga0105243_10527492
678 Ga0105243_10540847
679 Ga0105243_10720728
680 Ga0105243_11665815
681 Ga0105241_10048287
682 Ga0105241_10195440
683 Ga0105241_10243083
684 Ga0105241_10344125
685 Ga0105241_10449924
686 Ga0105241_10538134
687 Ga0105241_10875130
688 Ga0105242_10098826
689 Ga0105242_10351935
690 Ga0105248_10019048
691 Ga0105248_10069593
692 Ga0105248_10125635
693 Ga0105248_10248637
694 Ga0105248_10306432
695 Ga0105248_11214985
696 Ga0105237_10002811
697 Ga0105237_10332632
698 Ga0105238_10004901
699 Ga0105238_10133664
700 Ga0105238_10301687
701 Ga0105249_10004612
702 Ga0105249_10431873
703 Ga0105249_10716298
704 Ga0105239_10374029
705 Ga0105239_11206459
706 Ga0105239_12176620
707 Ga0105246_10049719
708 Ga0105246_10071064
709 Ga0105246_10666001
710 Ga0157373_10005773
711 Ga0157373_10019599
712 Ga0157371_10137206
713 Ga0157374_10352189
714 Ga0157378_10344049
715 Ga0157378_10395350
716 Ga0157378_10443739
717 Ga0157378_10795324
718 Ga0163162_10153758
719 Ga0163162_10244335
720 Ga0163162_10361690
721 Ga0163162_10393299
722 Ga0163162_10690923
723 Ga0157372_10015507
724 Ga0157372_10155526
725 Ga0157375_10271643
726 Ga0157375_10306240
727 Ga0163163_10000319
728 Ga0163163_10075581
729 Ga0163163_10093791
730 Ga0163163_10306253
731 Ga0163163_10430299
732 Ga0163163_10800578
733 Ga0157380_10004816
734 Ga0157380_10009638
735 Ga0157380_10016814
736 Ga0157380_10181494
737 Ga0157380_11671774
738 Ga0157377_10088230
739 Ga0157377_10196539
740 Ga0157377_10574049
741 Ga0157379_10138106
742 Ga0182006_1162995
743 Ga0163161_10117859
744 Ga0163161_10323811
745 Ga0207656_10001181
746 Ga0207653_10016137
747 Ga0207642_10444328
748 Ga0207710_10000568
749 Ga0207688_10229954
750 Ga0207647_10004397
751 Ga0207647_10024705
752 Ga0207647_10080013
753 Ga0207647_10241924
754 Ga0207645_10292258
755 Ga0207643_10002734
756 Ga0207643_10005869
757 Ga0207643_10045440
758 Ga0207684_10000083
759 Ga0207654_10144341
760 Ga0207707_10312731
761 Ga0207671_10009471
762 Ga0207671_10076616
763 Ga0207671_10300046
764 Ga0207671_10375950
765 Ga0207660_10032159
766 Ga0207662_10001501
767 Ga0207662_10157896
768 Ga0207657_10200733
769 Ga0207681_10048945
770 Ga0207681_10067219
771 Ga0207650_10000007
772 Ga0207650_10125545
773 Ga0207659_10386650
774 Ga0207706_10051815
775 Ga0207706_10488134
776 Ga0207706_10616639
777 Ga0207686_10044189
778 Ga0207686_10137133
779 Ga0207686_10367707
780 Ga0207709_10002729
781 Ga0207709_10465013
782 Ga0207670_10002834
783 Ga0207665_10248119
784 Ga0207691_10090981
785 Ga0207691_10183891
786 Ga0207711_10013827
787 Ga0207711_10071007
788 Ga0207711_10199135
789 Ga0207711_10587227
790 Ga0207689_10047941
791 Ga0207689_10206913
792 Ga0207689_10227966
793 Ga0207689_10375564
794 Ga0207651_10098769
795 Ga0207651_10273283
796 Ga0207651_10563480
797 Ga0207712_10005815
798 Ga0207712_10018235
799 Ga0207640_10463095
800 Ga0207677_10011669
801 Ga0207677_10211271
802 Ga0207703_10017255
803 Ga0207703_10049467
804 Ga0207703_10221668
805 Ga0207703_10565290
806 Ga0207639_10074286
807 Ga0207708_10000040
808 Ga0207708_10001283
809 Ga0207708_10012084
810 Ga0207708_10013954
811 Ga0207708_10119353
812 Ga0207708_10155170
813 Ga0207708_10178933
814 Ga0207641_10067708
815 Ga0207641_10128677
816 Ga0207641_10360664
817 Ga0207641_10734876
818 Ga0207641_10742552
819 Ga0207648_10026004
820 Ga0207648_10134414
821 Ga0207648_10687246
822 Ga0207648_10815562
823 Ga0207648_11047966
824 Ga0207676_10006945
825 Ga0207676_10108868
826 Ga0207676_10386913
827 Ga0207676_10654879
828 Ga0207674_10046277
829 Ga0207674_10158829
830 Ga0207674_10211623
831 Ga0207674_10295729
832 Ga0207674_10401274
833 Ga0207674_10525555
834 Ga0207674_10552380
835 Ga0207674_10586237
836 Ga0207675_100039507
837 Ga0207675_100041514
838 Ga0207675_100176209
839 Ga0207675_100228209
840 Ga0207675_100623637
841 Ga0207683_10501747
842 Ga0207698_10290570
843 Ga0207428_10011092
844 Ga0207428_10055357
845 Ga0207428_10372311
846 Ga0268264_10012594
847 Ga0268264_10083627
848 Ga0268264_10101529
849 Ga0268264_10129886
850 Ga0268264_11291420
851 Ga0307408_100095124
852 Ga0307408_100309604
853 Ga0307410_10045026
854 Ga0307410_10456751
855 Ga0307406_10003059
856 Ga0307407_10096626
857 Ga0307412_10057275
858 Ga0307416_100253852
859 Ga0307416_100336125
860 Ga0307416_100475742
861 Ga0307416_100646159
862 Ga0307414_10098849
863 Ga0307414_10143215
864 Ga0307414_11034123
865 Ga0307411_10095667
866 Ga0307415_100043944
867 Ga0307415_100556463
868 Ga0373930_0042610
869 Ga0373940_0113444
870 Ga0373949_0053232
871 Ga0373941_0069432
872 Ga0373931_0162048
873 Ga0395900_0638371
874 Ga0395898_0119646
875 Ga0395898_0754898
876 Ga0395901_0292745
877 Ga0242422_00892
878 Ga0242420_000211
879 Ga0451576_0509081
880 Ga0496106_0020389
881 Ga0496107_0148706
882 Ga0496112_0225568
883 Ga0501299_012872
884 Ga0501336_010196
885 Ga0501038_0006008
886 Ga0501040_0307851
887 Ga0501076_0177335
888 Ga0501198_019458
889 Ga0501207_009084
890 Ga0501209_069498
891 Ga0501214_002688
892 Ga0501217_099036
893 Ga0501223_006965
894 Ga0501223_067310
895 Ga0501227_027874
896 Ga0501233_001505
897 Ga0501233_007967
898 Ga0501233_046782
899 Ga0501235_009728
900 Ga0501235_039272
901 Ga0501236_005108
902 Ga0501240_008038
903 Ga0501243_022228
904 Ga0501257_014567
905 Ga0501221_073411
906 Ga0501221_138133
907 Ga0501225_0020515
908 Ga0501229_010711
909 Ga0501234_005426
910 Ga0501245_007476
911 Ga0501283_013419
912 nmdc:mga05p37_185839_c1
913 nmdc:mga05p37_246736_c1
914 nmdc:mga05p37_32409_c1
915 nmdc:mga05p37_478786_c1
916 nmdc:mga06r32_628651_c1
917 nmdc:mga08y16_30839_c1
918 nmdc:mga08y16_50718_c1
919 nmdc:mga08y16_5480_c1
920 nmdc:mga08y16_5486_c1
921 nmdc:mga08y16_908891_c1
922 nmdc:mga08x19_11312_c1
923 nmdc:mga0a205_326014_c1
924 Ga0587131_008611
925 Ga0587128_064143
926 Ga0587114_050328
927 Ga0587111_0080887
928 Ga0530510_0051054

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03162

Y_phosphatase2

Tyrosine phosphatase family

64

214

0.89

PF22785

Tc-R-P

Polymorphic toxin system, DSP-PTPase phosphatase

73

176

0.89

PF22784

PTP-SAK

Swiss Army Knife protein, DSP-PTPase phosphatase domain

73

187

0.87

PF14566

PTPlike_phytase

Inositol hexakisphosphate

75

173

0.85

PF22741

PTP-NADK

DSP-PTPase phosphatase fused to NAD+ Kinase

50

206

0.85

PF13350

Y_phosphatase3

Tyrosine phosphatase family

73

173

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7moe-assembly2.cif.gz_B crystal structure of arabidopsis thaliana plant and fungi atypical dual specificity phosphatase 1(atpfa-dsp1)cys150ser in complex with 5-diphosphoinositol 1,2,3,4,6-pentakisphosphate (5-insp7) 0.8688 56 196
5z5b-assembly3.cif.gz_C crystal structure of tk-ptp in the g95a mutant form 0.8669 61 203
7mog-assembly2.cif.gz_B crystal structure of arabidopsis thaliana plant and fungi atypical dual specificity phosphatase 1(atpfa-dsp1 ) cys150ser in complex with 5-pcf2 am-insp5, an analogue of 5-insp7 0.8626 56 196
7moj-assembly2.cif.gz_B crystal structure of arabidopsis thaliana plant and fungi atypical dual specificity phosphatase 1(atpfa-dsp1 ) cys150ser in complex with a metaphosphate intermediate 0.8555 56 196
7mod-assembly1.cif.gz_A crystal structure of arabidopsis thaliana plant and fungi atypical dual specificity phosphatase 1(atpfa-dsp1 ) cys150ser in complex with phosphate in conformation a (pi(a)) 0.8541 56 196
ID Description Score Start End Superfamily
af_P53949_3_154_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8559 56 196 3.90.190.10
af_Q9UUF3_81_240_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8447 58 195 3.90.190.10
af_Q4E1M5_3_163_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8385 56 196 3.90.190.10
af_Q7EYM9_283_443_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8372 61 177 3.90.190.10
5z5aA00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8361 60 197 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A1F2S3L6-F1-model_v4 Uncharacterized protein 0.9466 66 195 GO:0016791
AF-A0A1Q7HKM6-F1-model_v4 Uncharacterized protein 0.9416 54 195 GO:0016791
AF-A0A3S0DA08-F1-model_v4 Uncharacterized protein 0.938 56 210 GO:0016791
AF-A0A2V5P9B6-F1-model_v4 Tyrosine specific protein phosphatases domain-containing protein 0.9244 58 196 GO:0004553
GO:0016052
GO:0016791
GO:0030246
AF-A0A2V9HRP0-F1-model_v4 Tyrosine specific protein phosphatases domain-containing protein 0.9243 58 203 GO:0016791

Map