F449265

General Info

Members Datasets Scaffolds Average Seq Length
464 207 928 73

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_101039951|Ga0068864_1010399512
Length 81
Sequence MAIENEPKSGSFEVGMQCPSCNEPWLRPTNLPGRYRCVNCLHRYELLSACPECGSHATIARMSFTSDLKCTSCSAWMLTEI

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
125 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
126 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
127 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
128 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
129 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
130 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
131 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
132 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
133 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
145 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
146 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
202 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 1.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.86
Nodule 0
Rhizoplane 7.33
Rhizosphere 89.66
Stem 0
Stem Tuber 0
Unclassified 3.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_101039951 3300005618 Bacteria 813
2 Ga0070676_10523431 3300005328 Bacteria 845
3 Ga0070683_100249974 3300005329 Bacteria 1686
4 Ga0070683_100313629 3300005329 Bacteria 1492
5 Ga0070683_100697738 3300005329 Bacteria 972
6 Ga0070683_100711599 3300005329 Bacteria 962
7 Ga0070683_101570912 3300005329 Bacteria 632
8 Ga0070670_101008036 3300005331 Bacteria 757
9 Ga0068869_101839773 3300005334 Bacteria 542
10 Ga0070682_100129375 3300005337 Bacteria 1707
11 Ga0068868_100207992 3300005338 Bacteria 1634
12 Ga0068868_100422757 3300005338 Bacteria 1154
13 Ga0068868_101569180 3300005338 Bacteria 618
14 Ga0068868_101857091 3300005338 Bacteria 570
15 Ga0068868_102094389 3300005338 Bacteria 538
16 Ga0070660_101538775 3300005339 Bacteria 566
17 Ga0070687_100478594 3300005343 Bacteria 834
18 Ga0070692_10134737 3300005345 Bacteria 1392
19 Ga0070692_10141136 3300005345 Bacteria 1364
20 Ga0070668_100275496 3300005347 Bacteria 1404
21 Ga0070669_100689386 3300005353 Bacteria 862
22 Ga0070669_100871356 3300005353 Bacteria 768
23 Ga0070671_100645739 3300005355 Bacteria 916
24 Ga0070671_100916419 3300005355 Bacteria 766
25 Ga0070674_100314853 3300005356 Bacteria 1253
26 Ga0070674_100374348 3300005356 Bacteria 1157
27 Ga0070688_100580130 3300005365 Bacteria 856
28 Ga0070688_100844833 3300005365 Bacteria 719
29 Ga0070659_100072607 3300005366 Bacteria 2738
30 Ga0070659_100686108 3300005366 Bacteria 885
31 Ga0070701_10063448 3300005438 Bacteria 1955
32 Ga0070701_11005861 3300005438 Bacteria 582
33 Ga0070700_100678560 3300005441 Bacteria 816
34 Ga0070700_101390699 3300005441 Unclassified 593
35 Ga0070663_100826885 3300005455 Bacteria 796
36 Ga0070663_101507668 3300005455 Bacteria 598
37 Ga0070663_101606555 3300005455 Bacteria 580
38 Ga0070662_100064602 3300005457 Bacteria 2681
39 Ga0070662_100646692 3300005457 Bacteria 892
40 Ga0070681_11055993 3300005458 Bacteria 733
41 Ga0068867_101389271 3300005459 Bacteria 651
42 Ga0068867_101874073 3300005459 Bacteria 565
43 Ga0070685_10845388 3300005466 Bacteria 678
44 Ga0070679_100959664 3300005530 Bacteria 799
45 Ga0070679_102004582 3300005530 Bacteria 528
46 Ga0070684_100297787 3300005535 Bacteria 1480
47 Ga0070684_100604481 3300005535 Archaea 1020
48 Ga0070684_100719002 3300005535 Bacteria 931
49 Ga0070684_100928238 3300005535 Bacteria 816
50 Ga0070684_101051550 3300005535 Bacteria 764
51 Ga0070684_101408344 3300005535 Bacteria 656
52 Ga0070686_100724729 3300005544 Unclassified 795
53 Ga0070686_101035161 3300005544 Bacteria 675
54 Ga0070696_101079462 3300005546 Bacteria 674
55 Ga0070693_101088146 3300005547 Bacteria 609
56 Ga0070665_101436507 3300005548 Bacteria 699
57 Ga0070665_101988017 3300005548 Bacteria 587
58 Ga0070664_100049254 3300005564 Bacteria 3562
59 Ga0070664_100198696 3300005564 Bacteria 1789
60 Ga0070664_100606475 3300005564 Bacteria 1015
61 Ga0070664_100905674 3300005564 Bacteria 827
62 Ga0070664_100913191 3300005564 Bacteria 823
63 Ga0068857_100312588 3300005577 Bacteria 1450
64 Ga0068857_100744928 3300005577 Bacteria 933
65 Ga0068854_101563660 3300005578 Bacteria 600
66 Ga0068856_101847419 3300005614 Bacteria 615
67 Ga0068856_102235264 3300005614 Bacteria 556
68 Ga0068852_101874959 3300005616 Bacteria 622
69 Ga0068852_102134936 3300005616 Bacteria 582
70 Ga0068852_102611084 3300005616 Bacteria 525
71 Ga0068864_100421356 3300005618 Bacteria 1272
72 Ga0068864_100728117 3300005618 Bacteria 971
73 Ga0068866_10123534 3300005718 Bacteria 1462
74 Ga0068861_100449878 3300005719 Bacteria 1154
75 Ga0068861_101266774 3300005719 Bacteria 716
76 Ga0068861_101503792 3300005719 Bacteria 661
77 Ga0068870_10404696 3300005840 Bacteria 889
78 Ga0068870_10765297 3300005840 Bacteria 672
79 Ga0068870_10845030 3300005840 Bacteria 643
80 Ga0068870_10888701 3300005840 Bacteria 629
81 Ga0068858_100162811 3300005842 Bacteria 2101
82 Ga0068858_100962689 3300005842 Bacteria 836
83 Ga0068858_101136592 3300005842 Bacteria 767
84 Ga0068860_100126688 3300005843 Bacteria 2447
85 Ga0068860_102842103 3300005843 Bacteria 502
86 Ga0068862_101702537 3300005844 Bacteria 639
87 Ga0068862_101740972 3300005844 Bacteria 632
88 Ga0081455_10248589 3300005937 Bacteria 1302
89 Ga0081455_10293457 3300005937 Bacteria 1170
90 Ga0081538_10005756 3300005981 Bacteria 11065
91 Ga0081538_10009281 3300005981 Bacteria 8232
92 Ga0081538_10016924 3300005981 Bacteria 5561
93 Ga0081538_10031201 3300005981 Bacteria 3600
94 Ga0081538_10053257 3300005981 Bacteria 2407
95 Ga0081538_10188087 3300005981 Bacteria 872
96 Ga0081539_10177728 3300005985 Bacteria 1001
97 Ga0075365_10403420 3300006038 Bacteria 965
98 Ga0075365_11035707 3300006038 Unclassified 578
99 Ga0097621_102371691 3300006237 Bacteria 508
100 Ga0068871_101058923 3300006358 Unclassified 757
101 Ga0075428_100634411 3300006844 Bacteria 1140
102 Ga0075428_102493500 3300006844 Bacteria 530
103 Ga0068865_100470491 3300006881 Bacteria 1043
104 Ga0068865_101137268 3300006881 Unclassified 689
105 Ga0111539_10326771 3300009094 Bacteria 1785
106 Ga0111539_12167601 3300009094 Bacteria 645
107 Ga0105245_10136010 3300009098 Bacteria 2310
108 Ga0105245_10458105 3300009098 Bacteria 1285
109 Ga0105245_12481461 3300009098 Bacteria 572
110 Ga0105245_12532502 3300009098 Bacteria 566
111 Ga0114129_11411434 3300009147 Bacteria 859
112 Ga0114129_12408512 3300009147 Bacteria 630
113 Ga0105243_10085597 3300009148 Bacteria 2584
114 Ga0105243_10166632 3300009148 Bacteria 1905
115 Ga0105243_10934468 3300009148 Bacteria 865
116 Ga0105243_11570782 3300009148 Bacteria 684
117 Ga0105242_11518799 3300009176 Bacteria 701
118 Ga0105242_12610000 3300009176 Bacteria 554
119 Ga0105248_11003543 3300009177 Bacteria 943
120 Ga0105238_10512795 3300009551 Bacteria 1201
121 Ga0105238_11263577 3300009551 Unclassified 764
122 Ga0105249_10408267 3300009553 Bacteria 1390
123 Ga0105249_11759962 3300009553 Bacteria 692
124 Ga0105249_12396791 3300009553 Bacteria 600
125 Ga0105239_10806189 3300010375 Bacteria 1076
126 Ga0105239_12083821 3300010375 Bacteria 659
127 Ga0105239_13530678 3300010375 Bacteria 508
128 Ga0105246_10616437 3300011119 Bacteria 940
129 Ga0105246_10661122 3300011119 Unclassified 911
130 Ga0105246_10766626 3300011119 Bacteria 852
131 Ga0105246_11395394 3300011119 Bacteria 653
132 Ga0157337_1038628 3300012483 Bacteria 518
133 Ga0157371_11448882 3300013102 Bacteria 534
134 Ga0157369_10623474 3300013105 Bacteria 1113
135 Ga0157374_10707945 3300013296 Bacteria 1020
136 Ga0157372_11913045 3300013307 Bacteria 682
137 Ga0157372_13128935 3300013307 Bacteria 528
138 Ga0157375_12106822 3300013308 Bacteria 671
139 Ga0163163_10225222 3300014325 Unclassified 1924
140 Ga0163163_10551833 3300014325 Bacteria 1215
141 Ga0157380_12178662 3300014326 Bacteria 618
142 Ga0157380_13121075 3300014326 Bacteria 529
143 Ga0157377_10558305 3300014745 Bacteria 810
144 Ga0157377_10679695 3300014745 Bacteria 745
145 Ga0157377_11548539 3300014745 Bacteria 529
146 Ga0157376_12017813 3300014969 Bacteria 615
147 Ga0197907_10615503 3300020069 Bacteria 513
148 Ga0206354_10627550 3300020081 Bacteria 753
149 Ga0206353_11177501 3300020082 Bacteria 715
150 Ga0207426_1044868 3300025302 Bacteria 1348
151 Ga0207642_10431069 3300025899 Bacteria 795
152 Ga0207642_10918824 3300025899 Bacteria 561
153 Ga0207688_10090809 3300025901 Bacteria 1754
154 Ga0207688_10161131 3300025901 Bacteria 1330
155 Ga0207645_10499677 3300025907 Bacteria 823
156 Ga0207643_10191759 3300025908 Bacteria 1241
157 Ga0207643_10637792 3300025908 Bacteria 687
158 Ga0207643_10990436 3300025908 Bacteria 544
159 Ga0207643_11015607 3300025908 Bacteria 536
160 Ga0207693_11069482 3300025915 Bacteria 614
161 Ga0207657_10235457 3300025919 Bacteria 1463
162 Ga0207657_10400778 3300025919 Bacteria 1079
163 Ga0207657_10905637 3300025919 Bacteria 679
164 Ga0207657_11034746 3300025919 Bacteria 629
165 Ga0207649_10429614 3300025920 Bacteria 993
166 Ga0207649_10577194 3300025920 Bacteria 863
167 Ga0207687_10295787 3300025927 Bacteria 1302
168 Ga0207687_10299817 3300025927 Bacteria 1294
169 Ga0207644_11010565 3300025931 Bacteria 698
170 Ga0207690_10161943 3300025932 Bacteria 1669
171 Ga0207690_10236847 3300025932 Bacteria 1404
172 Ga0207690_10628460 3300025932 Bacteria 878
173 Ga0207690_11470949 3300025932 Bacteria 570
174 Ga0207690_11693498 3300025932 Bacteria 528
175 Ga0207706_10038133 3300025933 Bacteria 4263
176 Ga0207706_10370873 3300025933 Bacteria 1243
177 Ga0207709_10074155 3300025935 Bacteria 2170
178 Ga0207709_10154658 3300025935 Bacteria 1592
179 Ga0207670_11805539 3300025936 Bacteria 520
180 Ga0207669_10121009 3300025937 Bacteria 1777
181 Ga0207669_10155744 3300025937 Bacteria 1607
182 Ga0207669_10835664 3300025937 Bacteria 766
183 Ga0207669_10855963 3300025937 Bacteria 757
184 Ga0207704_10052224 3300025938 Bacteria 2477
185 Ga0207704_10160979 3300025938 Bacteria 1597
186 Ga0207704_10572886 3300025938 Bacteria 920
187 Ga0207691_10271575 3300025940 Bacteria 1460
188 Ga0207691_10671217 3300025940 Bacteria 875
189 Ga0207711_11694320 3300025941 Bacteria 575
190 Ga0207689_10906446 3300025942 Bacteria 744
191 Ga0207689_10953952 3300025942 Bacteria 724
192 Ga0207689_11527260 3300025942 Bacteria 557
193 Ga0207661_10073714 3300025944 Bacteria 2797
194 Ga0207661_10214392 3300025944 Bacteria 1698
195 Ga0207679_10047014 3300025945 Bacteria 3132
196 Ga0207679_10102952 3300025945 Bacteria 2237
197 Ga0207679_10173620 3300025945 Bacteria 1777
198 Ga0207679_10450717 3300025945 Bacteria 1141
199 Ga0207679_10811829 3300025945 Bacteria 853
200 Ga0207679_11216162 3300025945 Bacteria 691
201 Ga0207712_10598909 3300025961 Bacteria 953
202 Ga0207668_10222479 3300025972 Bacteria 1517
203 Ga0207640_11702226 3300025981 Bacteria 569
204 Ga0207677_10449720 3300026023 Bacteria 1104
205 Ga0207677_10481897 3300026023 Bacteria 1069
206 Ga0207677_10765306 3300026023 Bacteria 862
207 Ga0207677_11245853 3300026023 Bacteria 682
208 Ga0207639_10229651 3300026041 Bacteria 1608
209 Ga0207639_11110425 3300026041 Unclassified 742
210 Ga0207678_10125571 3300026067 Bacteria 2189
211 Ga0207678_11776715 3300026067 Bacteria 540
212 Ga0207708_10280770 3300026075 Bacteria 1349
213 Ga0207708_11607245 3300026075 Bacteria 571
214 Ga0207641_11361522 3300026088 Bacteria 711
215 Ga0207676_10964492 3300026095 Bacteria 839
216 Ga0207674_10267556 3300026116 Bacteria 1657
217 Ga0207674_10320221 3300026116 Bacteria 1500
218 Ga0207674_10562552 3300026116 Bacteria 1101
219 Ga0207674_12254861 3300026116 Bacteria 507
220 Ga0207675_100355205 3300026118 Bacteria 1437
221 Ga0207675_100434004 3300026118 Bacteria 1299
222 Ga0207675_100551081 3300026118 Bacteria 1152
223 Ga0207675_101521627 3300026118 Bacteria 690
224 Ga0207675_101659680 3300026118 Bacteria 659
225 Ga0207683_10528254 3300026121 Bacteria 1090
226 Ga0207683_10591291 3300026121 Bacteria 1027
227 Ga0207683_11096343 3300026121 Bacteria 739
228 Ga0207683_11649051 3300026121 Bacteria 591
229 Ga0207698_10504787 3300026142 Bacteria 1178
230 Ga0207698_10583197 3300026142 Bacteria 1100
231 Ga0207698_10927448 3300026142 Bacteria 879
232 Ga0207698_11865278 3300026142 Bacteria 616
233 Ga0268266_11341717 3300028379 Bacteria 691
234 Ga0268266_11783719 3300028379 Bacteria 590
235 Ga0268265_12196370 3300028380 Bacteria 559
236 Ga0268264_11599049 3300028381 Bacteria 662
237 Ga0268264_12316907 3300028381 Bacteria 544
238 Ga0307408_100032218 3300031548 Bacteria 3654
239 Ga0307405_10049851 3300031731 Bacteria 2590
240 Ga0307405_10939514 3300031731 Bacteria 734
241 Ga0307413_10037401 3300031824 Bacteria 2803
242 Ga0307413_10200573 3300031824 Bacteria 1441
243 Ga0307413_10293386 3300031824 Bacteria 1230
244 Ga0307413_11589127 3300031824 Bacteria 580
245 Ga0307413_11876155 3300031824 Bacteria 538
246 Ga0307410_10025226 3300031852 Bacteria 3726
247 Ga0307410_10317398 3300031852 Bacteria 1235
248 Ga0307410_11166735 3300031852 Bacteria 670
249 Ga0307410_11249246 3300031852 Bacteria 648
250 Ga0307410_11499900 3300031852 Bacteria 594
251 Ga0307406_10012393 3300031901 Bacteria 4864
252 Ga0307406_10059785 3300031901 Bacteria 2455
253 Ga0307406_10591972 3300031901 Bacteria 913
254 Ga0307406_10645975 3300031901 Bacteria 878
255 Ga0307407_10197003 3300031903 Bacteria 1347
256 Ga0307407_10230512 3300031903 Bacteria 1257
257 Ga0307407_10263107 3300031903 Bacteria 1187
258 Ga0307407_10355550 3300031903 Bacteria 1039
259 Ga0307407_11655024 3300031903 Bacteria 509
260 Ga0307412_11112844 3300031911 Bacteria 703
261 Ga0307409_100096145 3300031995 Bacteria 2443
262 Ga0307409_100135221 3300031995 Bacteria 2114
263 Ga0307409_100150117 3300031995 Bacteria 2022
264 Ga0307409_100159045 3300031995 Bacteria 1973
265 Ga0307409_100283426 3300031995 Bacteria 1533
266 Ga0307409_101359670 3300031995 Bacteria 736
267 Ga0307409_101684681 3300031995 Bacteria 663
268 Ga0307416_100054245 3300032002 Bacteria 3221
269 Ga0307416_100294711 3300032002 Bacteria 1608
270 Ga0307416_101108153 3300032002 Bacteria 896
271 Ga0307416_101571452 3300032002 Bacteria 763
272 Ga0307416_101605122 3300032002 Bacteria 756
273 Ga0307414_10483789 3300032004 Bacteria 1092
274 Ga0307414_11477513 3300032004 Bacteria 632
275 Ga0307414_11658097 3300032004 Bacteria 596
276 Ga0307411_10035110 3300032005 Bacteria 3127
277 Ga0307411_10329348 3300032005 Bacteria 1237
278 Ga0307411_10886136 3300032005 Bacteria 792
279 Ga0307411_11982627 3300032005 Bacteria 543
280 Ga0307415_100020863 3300032126 Bacteria 4011
281 Ga0307415_100039193 3300032126 Bacteria 3129
282 Ga0307415_100200596 3300032126 Bacteria 1583
283 Ga0307415_100228657 3300032126 Bacteria 1496
284 Ga0395899_0081150 3300037312 Bacteria 2360
285 Ga0395899_0925105 3300037312 Bacteria 530
286 Ga0395898_0090539 3300037466 Bacteria 2944
287 Ga0395901_0069989 3300038443 Bacteria 3655
288 Ga0451787_228913 3300041441 Bacteria 545
289 Ga0451789_1339561 3300041443 Bacteria 503
290 Ga0451793_0302063 3300041452 Bacteria 1353
291 Ga0451793_1671909 3300041452 Unclassified 541
292 Ga0451797_0265117 3300041453 Bacteria 617
293 Ga0451837_1348392 3300041494 Bacteria 910
294 Ga0451841_0816545 3300041498 Bacteria 612
295 Ga0451845_0763581 3300041501 Bacteria 643
296 Ga0451847_0727500 3300041503 Bacteria 672
297 Ga0451849_0081417 3300041505 Bacteria 684
298 Ga0451849_0831749 3300041505 Bacteria 502
299 Ga0451843_1326791 3300041509 Bacteria 860
300 Ga0451853_3915895 3300041512 Bacteria 823
301 Ga0466972_0063292 3300044658 Bacteria 1772
302 Ga0466965_0083714 3300044683 Bacteria 1615
303 Ga0466965_0519352 3300044683 Bacteria 670
304 Ga0466961_0193842 3300044693 Bacteria 1259
305 Ga0466963_0121904 3300044694 Bacteria 1795
306 Ga0466963_0206622 3300044694 Bacteria 1374
307 Ga0466963_0359341 3300044694 Bacteria 1026
308 Ga0466964_0030095 3300044706 Bacteria 2147
309 Ga0466964_0076360 3300044706 Bacteria 1428
310 Ga0466964_0342418 3300044706 Bacteria 766
311 Ga0466964_0401929 3300044706 Bacteria 716
312 Ga0466964_0701233 3300044706 Bacteria 564
313 Ga0466957_1393585 3300044842 Bacteria 510
314 Ga0466960_0223948 3300044901 Bacteria 1036
315 Ga0466960_0433895 3300044901 Bacteria 761
316 Ga0466960_0657078 3300044901 Bacteria 626
317 Ga0466960_0769831 3300044901 Bacteria 581
318 Ga0466960_0853046 3300044901 Bacteria 554
319 Ga0466960_1013554 3300044901 Bacteria 510
320 Ga0466958_0487387 3300045836 Bacteria 800
321 Ga0466958_0885744 3300045836 Bacteria 582
322 Ga0466967_0016472 3300045976 Bacteria 5831
323 Ga0466967_0020483 3300045976 Bacteria 5347
324 Ga0466967_0040679 3300045976 Bacteria 4003
325 Ga0466967_0049300 3300045976 Bacteria 3681
326 Ga0466967_0055587 3300045976 Bacteria 3487
327 Ga0466967_0086453 3300045976 Bacteria 2841
328 Ga0466967_0086915 3300045976 Bacteria 2834
329 Ga0466967_0298098 3300045976 Bacteria 1550
330 Ga0466967_0306777 3300045976 Bacteria 1528
331 Ga0466967_0412676 3300045976 Bacteria 1315
332 Ga0466967_0448090 3300045976 Bacteria 1261
333 Ga0466967_0784463 3300045976 Bacteria 946
334 Ga0466967_1137056 3300045976 Bacteria 778
335 Ga0466967_2528294 3300045976 Bacteria 508
336 Ga0495641_0104306 3300046461 Unclassified 1265
337 Ga0495606_0237625 3300046507 Bacteria 1018
338 Ga0495663_0169314 3300046525 Unclassified 753
339 Ga0495657_0047535 3300046675 Bacteria 2900
340 Ga0495670_0810026 3300046691 Bacteria 511
341 Ga0495685_233023 3300047447 Bacteria 586
342 Ga0495686_0016261 3300047472 Bacteria 5050
343 Ga0496100_0851764 3300048903 Unclassified 715
344 Ga0496100_1226884 3300048903 Bacteria 592
345 Ga0496102_1021426 3300048905 Bacteria 747
346 Ga0496104_0463452 3300048907 Bacteria 1179
347 Ga0496105_0844648 3300048908 Bacteria 693
348 Ga0496105_1051258 3300048908 Unclassified 607
349 Ga0496106_0521913 3300048909 Bacteria 954
350 Ga0496106_1498010 3300048909 Bacteria 519
351 Ga0496108_0543163 3300048911 Unclassified 1014
352 Ga0496109_0043951 3300048912 Bacteria 4051
353 Ga0496109_0971926 3300048912 Bacteria 787
354 Ga0496109_1207490 3300048912 Bacteria 693
355 Ga0496109_1248681 3300048912 Bacteria 679
356 Ga0496109_1318182 3300048912 Bacteria 658
357 Ga0496110_0114962 3300048913 Bacteria 2422
358 Ga0496110_0206325 3300048913 Bacteria 1786
359 Ga0496110_0599235 3300048913 Bacteria 1000
360 Ga0496110_0623396 3300048913 Bacteria 977
361 Ga0496111_0098414 3300048914 Bacteria 2148
362 Ga0496111_0216715 3300048914 Bacteria 1422
363 Ga0496111_0898742 3300048914 Bacteria 638
364 Ga0496111_0962602 3300048914 Unclassified 613
365 Ga0496111_1097469 3300048914 Bacteria 567
366 Ga0496112_0048509 3300048915 Bacteria 4163
367 Ga0496112_0063356 3300048915 Bacteria 3647
368 Ga0496112_0843077 3300048915 Bacteria 840
369 Ga0496113_0071085 3300048916 Bacteria 2647
370 Ga0496113_0651518 3300048916 Bacteria 842
371 Ga0496113_1265003 3300048916 Bacteria 575
372 Ga0496121_0661995 3300048924 Bacteria 634
373 Ga0496126_0243639 3300048929 Bacteria 1501
374 Ga0501317_095778 3300049533 Bacteria 530
375 Ga0501031_0203951 3300049568 Bacteria 1290
376 Ga0501031_0224700 3300049568 Bacteria 1222
377 Ga0501031_0243788 3300049568 Bacteria 1168
378 Ga0501032_0939102 3300049569 Bacteria 544
379 Ga0501033_0512408 3300049570 Bacteria 829
380 Ga0501034_1144602 3300049571 Bacteria 658
381 Ga0501036_0016218 3300049572 Bacteria 6222
382 Ga0501036_0016401 3300049572 Bacteria 6188
383 Ga0501036_0064127 3300049572 Bacteria 3110
384 Ga0501036_0601808 3300049572 Bacteria 912
385 Ga0501037_0416169 3300049573 Bacteria 920
386 Ga0501038_0160924 3300049574 Bacteria 1824
387 Ga0501038_0276132 3300049574 Bacteria 1324
388 Ga0501038_0870230 3300049574 Bacteria 666
389 Ga0501039_0003230 3300049575 Bacteria 12191
390 Ga0501039_0064768 3300049575 Bacteria 2834
391 Ga0501039_0074555 3300049575 Bacteria 2637
392 Ga0501039_0075768 3300049575 Bacteria 2615
393 Ga0501039_0946634 3300049575 Bacteria 670
394 Ga0501040_0034152 3300049576 Bacteria 3446
395 Ga0501040_0373609 3300049576 Bacteria 1022
396 Ga0501040_1121782 3300049576 Bacteria 570
397 Ga0501041_0044839 3300049577 Bacteria 2687
398 Ga0501042_0013186 3300049578 Bacteria 5626
399 Ga0501042_0296189 3300049578 Bacteria 1169
400 Ga0501042_0335103 3300049578 Bacteria 1093
401 Ga0501042_1367628 3300049578 Bacteria 516
402 Ga0501043_0541622 3300049579 Bacteria 866
403 Ga0501046_0157638 3300049580 Bacteria 1709
404 Ga0501048_0035576 3300049582 Bacteria 3585
405 Ga0501048_0083888 3300049582 Bacteria 2247
406 Ga0501048_0277111 3300049582 Bacteria 1192
407 Ga0501068_0079495 3300049584 Bacteria 2011
408 Ga0501068_0184448 3300049584 Bacteria 1320
409 Ga0501068_0586430 3300049584 Bacteria 726
410 Ga0501069_0314753 3300049585 Bacteria 919
411 Ga0501070_0587349 3300049586 Bacteria 889
412 Ga0501070_1040279 3300049586 Bacteria 634
413 Ga0501070_1049987 3300049586 Bacteria 630
414 Ga0501071_0024178 3300049587 Bacteria 4247
415 Ga0501071_0951981 3300049587 Bacteria 663
416 Ga0501072_0006978 3300049588 Bacteria 8573
417 Ga0501072_0010843 3300049588 Bacteria 6947
418 Ga0501072_0326440 3300049588 Bacteria 1219
419 Ga0501072_1083171 3300049588 Bacteria 624
420 Ga0501073_0666415 3300049589 Bacteria 718
421 Ga0501075_0224628 3300049591 Bacteria 1432
422 Ga0501075_0673459 3300049591 Bacteria 788
423 Ga0501075_0752398 3300049591 Bacteria 742
424 Ga0501075_1112270 3300049591 Bacteria 600
425 Ga0501076_0029655 3300049592 Bacteria 4256
426 Ga0501076_0449253 3300049592 Bacteria 1061
427 Ga0501076_1239539 3300049592 Bacteria 614
428 Ga0501076_1667517 3300049592 Bacteria 523
429 Ga0501077_0278838 3300049593 Bacteria 1064
430 Ga0501077_0353003 3300049593 Bacteria 938
431 Ga0501079_0022389 3300049741 Bacteria 4846
432 Ga0501079_1089413 3300049741 Bacteria 629
433 Ga0501080_0053199 3300049742 Bacteria 3769
434 Ga0501080_0240818 3300049742 Bacteria 1651
435 Ga0501081_0164160 3300049743 Bacteria 1601
436 Ga0501081_0338589 3300049743 Bacteria 1107
437 Ga0501035_0114888 3300049822 Bacteria 2357
438 Ga0501045_0026916 3300049824 Bacteria 4140
439 Ga0501045_0037054 3300049824 Bacteria 3544
440 Ga0501045_0078337 3300049824 Bacteria 2436
441 Ga0501045_1000062 3300049824 Bacteria 613
442 nmdc:mga09592_878841_c1 3300050508 Bacteria 754
443 nmdc:mga0qj67_724056_c1 3300050509 Bacteria 790
444 nmdc:mga06r32_341284_c1 3300050510 Bacteria 1482
445 nmdc:mga06r32_841432_c1 3300050510 Bacteria 876
446 nmdc:mga08y16_2141694_c1 3300050511 Bacteria 506
447 nmdc:mga08y16_791810_c1 3300050511 Bacteria 941
448 Ga0500616_0189159 3300053153 Bacteria 920
449 Ga0501084_0019957 3300054114 Bacteria 5586
450 Ga0501084_0378291 3300054114 Bacteria 1197
451 Ga0501084_1199152 3300054114 Bacteria 637
452 Ga0501084_1527915 3300054114 Bacteria 558
453 Ga0590071_082796 3300059421 Bacteria 799
454 Ga0590074_128517 3300059423 Bacteria 508
455 Ga0590075_141200 3300059424 Bacteria 634
456 Ga0587082_182607 3300059504 Bacteria 515
457 Ga0587099_064307 3300059622 Bacteria 512
458 Ga0587071_204473 3300060344 Bacteria 518
459 Ga0501082_0198478 3300060353 Bacteria 1745
460 Ga0501082_0205886 3300060353 Bacteria 1712
461 Ga0501082_0861424 3300060353 Bacteria 793
462 Ga0466962_0019930 3300061719 Bacteria 3223
463 Ga0466962_0321119 3300061719 Bacteria 768
464 Ga0530510_0039484 3300061734 Bacteria 3407
465 Ga0068864_101039951
466 Ga0070676_10523431
467 Ga0070683_100249974
468 Ga0070683_100313629
469 Ga0070683_100697738
470 Ga0070683_100711599
471 Ga0070683_101570912
472 Ga0070670_101008036
473 Ga0068869_101839773
474 Ga0070682_100129375
475 Ga0068868_100207992
476 Ga0068868_100422757
477 Ga0068868_101569180
478 Ga0068868_101857091
479 Ga0068868_102094389
480 Ga0070660_101538775
481 Ga0070687_100478594
482 Ga0070692_10134737
483 Ga0070692_10141136
484 Ga0070668_100275496
485 Ga0070669_100689386
486 Ga0070669_100871356
487 Ga0070671_100645739
488 Ga0070671_100916419
489 Ga0070674_100314853
490 Ga0070674_100374348
491 Ga0070688_100580130
492 Ga0070688_100844833
493 Ga0070659_100072607
494 Ga0070659_100686108
495 Ga0070701_10063448
496 Ga0070701_11005861
497 Ga0070700_100678560
498 Ga0070700_101390699
499 Ga0070663_100826885
500 Ga0070663_101507668
501 Ga0070663_101606555
502 Ga0070662_100064602
503 Ga0070662_100646692
504 Ga0070681_11055993
505 Ga0068867_101389271
506 Ga0068867_101874073
507 Ga0070685_10845388
508 Ga0070679_100959664
509 Ga0070679_102004582
510 Ga0070684_100297787
511 Ga0070684_100604481
512 Ga0070684_100719002
513 Ga0070684_100928238
514 Ga0070684_101051550
515 Ga0070684_101408344
516 Ga0070686_100724729
517 Ga0070686_101035161
518 Ga0070696_101079462
519 Ga0070693_101088146
520 Ga0070665_101436507
521 Ga0070665_101988017
522 Ga0070664_100049254
523 Ga0070664_100198696
524 Ga0070664_100606475
525 Ga0070664_100905674
526 Ga0070664_100913191
527 Ga0068857_100312588
528 Ga0068857_100744928
529 Ga0068854_101563660
530 Ga0068856_101847419
531 Ga0068856_102235264
532 Ga0068852_101874959
533 Ga0068852_102134936
534 Ga0068852_102611084
535 Ga0068864_100421356
536 Ga0068864_100728117
537 Ga0068866_10123534
538 Ga0068861_100449878
539 Ga0068861_101266774
540 Ga0068861_101503792
541 Ga0068870_10404696
542 Ga0068870_10765297
543 Ga0068870_10845030
544 Ga0068870_10888701
545 Ga0068858_100162811
546 Ga0068858_100962689
547 Ga0068858_101136592
548 Ga0068860_100126688
549 Ga0068860_102842103
550 Ga0068862_101702537
551 Ga0068862_101740972
552 Ga0081455_10248589
553 Ga0081455_10293457
554 Ga0081538_10005756
555 Ga0081538_10009281
556 Ga0081538_10016924
557 Ga0081538_10031201
558 Ga0081538_10053257
559 Ga0081538_10188087
560 Ga0081539_10177728
561 Ga0075365_10403420
562 Ga0075365_11035707
563 Ga0097621_102371691
564 Ga0068871_101058923
565 Ga0075428_100634411
566 Ga0075428_102493500
567 Ga0068865_100470491
568 Ga0068865_101137268
569 Ga0111539_10326771
570 Ga0111539_12167601
571 Ga0105245_10136010
572 Ga0105245_10458105
573 Ga0105245_12481461
574 Ga0105245_12532502
575 Ga0114129_11411434
576 Ga0114129_12408512
577 Ga0105243_10085597
578 Ga0105243_10166632
579 Ga0105243_10934468
580 Ga0105243_11570782
581 Ga0105242_11518799
582 Ga0105242_12610000
583 Ga0105248_11003543
584 Ga0105238_10512795
585 Ga0105238_11263577
586 Ga0105249_10408267
587 Ga0105249_11759962
588 Ga0105249_12396791
589 Ga0105239_10806189
590 Ga0105239_12083821
591 Ga0105239_13530678
592 Ga0105246_10616437
593 Ga0105246_10661122
594 Ga0105246_10766626
595 Ga0105246_11395394
596 Ga0157337_1038628
597 Ga0157371_11448882
598 Ga0157369_10623474
599 Ga0157374_10707945
600 Ga0157372_11913045
601 Ga0157372_13128935
602 Ga0157375_12106822
603 Ga0163163_10225222
604 Ga0163163_10551833
605 Ga0157380_12178662
606 Ga0157380_13121075
607 Ga0157377_10558305
608 Ga0157377_10679695
609 Ga0157377_11548539
610 Ga0157376_12017813
611 Ga0197907_10615503
612 Ga0206354_10627550
613 Ga0206353_11177501
614 Ga0207426_1044868
615 Ga0207642_10431069
616 Ga0207642_10918824
617 Ga0207688_10090809
618 Ga0207688_10161131
619 Ga0207645_10499677
620 Ga0207643_10191759
621 Ga0207643_10637792
622 Ga0207643_10990436
623 Ga0207643_11015607
624 Ga0207693_11069482
625 Ga0207657_10235457
626 Ga0207657_10400778
627 Ga0207657_10905637
628 Ga0207657_11034746
629 Ga0207649_10429614
630 Ga0207649_10577194
631 Ga0207687_10295787
632 Ga0207687_10299817
633 Ga0207644_11010565
634 Ga0207690_10161943
635 Ga0207690_10236847
636 Ga0207690_10628460
637 Ga0207690_11470949
638 Ga0207690_11693498
639 Ga0207706_10038133
640 Ga0207706_10370873
641 Ga0207709_10074155
642 Ga0207709_10154658
643 Ga0207670_11805539
644 Ga0207669_10121009
645 Ga0207669_10155744
646 Ga0207669_10835664
647 Ga0207669_10855963
648 Ga0207704_10052224
649 Ga0207704_10160979
650 Ga0207704_10572886
651 Ga0207691_10271575
652 Ga0207691_10671217
653 Ga0207711_11694320
654 Ga0207689_10906446
655 Ga0207689_10953952
656 Ga0207689_11527260
657 Ga0207661_10073714
658 Ga0207661_10214392
659 Ga0207679_10047014
660 Ga0207679_10102952
661 Ga0207679_10173620
662 Ga0207679_10450717
663 Ga0207679_10811829
664 Ga0207679_11216162
665 Ga0207712_10598909
666 Ga0207668_10222479
667 Ga0207640_11702226
668 Ga0207677_10449720
669 Ga0207677_10481897
670 Ga0207677_10765306
671 Ga0207677_11245853
672 Ga0207639_10229651
673 Ga0207639_11110425
674 Ga0207678_10125571
675 Ga0207678_11776715
676 Ga0207708_10280770
677 Ga0207708_11607245
678 Ga0207641_11361522
679 Ga0207676_10964492
680 Ga0207674_10267556
681 Ga0207674_10320221
682 Ga0207674_10562552
683 Ga0207674_12254861
684 Ga0207675_100355205
685 Ga0207675_100434004
686 Ga0207675_100551081
687 Ga0207675_101521627
688 Ga0207675_101659680
689 Ga0207683_10528254
690 Ga0207683_10591291
691 Ga0207683_11096343
692 Ga0207683_11649051
693 Ga0207698_10504787
694 Ga0207698_10583197
695 Ga0207698_10927448
696 Ga0207698_11865278
697 Ga0268266_11341717
698 Ga0268266_11783719
699 Ga0268265_12196370
700 Ga0268264_11599049
701 Ga0268264_12316907
702 Ga0307408_100032218
703 Ga0307405_10049851
704 Ga0307405_10939514
705 Ga0307413_10037401
706 Ga0307413_10200573
707 Ga0307413_10293386
708 Ga0307413_11589127
709 Ga0307413_11876155
710 Ga0307410_10025226
711 Ga0307410_10317398
712 Ga0307410_11166735
713 Ga0307410_11249246
714 Ga0307410_11499900
715 Ga0307406_10012393
716 Ga0307406_10059785
717 Ga0307406_10591972
718 Ga0307406_10645975
719 Ga0307407_10197003
720 Ga0307407_10230512
721 Ga0307407_10263107
722 Ga0307407_10355550
723 Ga0307407_11655024
724 Ga0307412_11112844
725 Ga0307409_100096145
726 Ga0307409_100135221
727 Ga0307409_100150117
728 Ga0307409_100159045
729 Ga0307409_100283426
730 Ga0307409_101359670
731 Ga0307409_101684681
732 Ga0307416_100054245
733 Ga0307416_100294711
734 Ga0307416_101108153
735 Ga0307416_101571452
736 Ga0307416_101605122
737 Ga0307414_10483789
738 Ga0307414_11477513
739 Ga0307414_11658097
740 Ga0307411_10035110
741 Ga0307411_10329348
742 Ga0307411_10886136
743 Ga0307411_11982627
744 Ga0307415_100020863
745 Ga0307415_100039193
746 Ga0307415_100200596
747 Ga0307415_100228657
748 Ga0395899_0081150
749 Ga0395899_0925105
750 Ga0395898_0090539
751 Ga0395901_0069989
752 Ga0451787_228913
753 Ga0451789_1339561
754 Ga0451793_0302063
755 Ga0451793_1671909
756 Ga0451797_0265117
757 Ga0451837_1348392
758 Ga0451841_0816545
759 Ga0451845_0763581
760 Ga0451847_0727500
761 Ga0451849_0081417
762 Ga0451849_0831749
763 Ga0451843_1326791
764 Ga0451853_3915895
765 Ga0466972_0063292
766 Ga0466965_0083714
767 Ga0466965_0519352
768 Ga0466961_0193842
769 Ga0466963_0121904
770 Ga0466963_0206622
771 Ga0466963_0359341
772 Ga0466964_0030095
773 Ga0466964_0076360
774 Ga0466964_0342418
775 Ga0466964_0401929
776 Ga0466964_0701233
777 Ga0466957_1393585
778 Ga0466960_0223948
779 Ga0466960_0433895
780 Ga0466960_0657078
781 Ga0466960_0769831
782 Ga0466960_0853046
783 Ga0466960_1013554
784 Ga0466958_0487387
785 Ga0466958_0885744
786 Ga0466967_0016472
787 Ga0466967_0020483
788 Ga0466967_0040679
789 Ga0466967_0049300
790 Ga0466967_0055587
791 Ga0466967_0086453
792 Ga0466967_0086915
793 Ga0466967_0298098
794 Ga0466967_0306777
795 Ga0466967_0412676
796 Ga0466967_0448090
797 Ga0466967_0784463
798 Ga0466967_1137056
799 Ga0466967_2528294
800 Ga0495641_0104306
801 Ga0495606_0237625
802 Ga0495663_0169314
803 Ga0495657_0047535
804 Ga0495670_0810026
805 Ga0495685_233023
806 Ga0495686_0016261
807 Ga0496100_0851764
808 Ga0496100_1226884
809 Ga0496102_1021426
810 Ga0496104_0463452
811 Ga0496105_0844648
812 Ga0496105_1051258
813 Ga0496106_0521913
814 Ga0496106_1498010
815 Ga0496108_0543163
816 Ga0496109_0043951
817 Ga0496109_0971926
818 Ga0496109_1207490
819 Ga0496109_1248681
820 Ga0496109_1318182
821 Ga0496110_0114962
822 Ga0496110_0206325
823 Ga0496110_0599235
824 Ga0496110_0623396
825 Ga0496111_0098414
826 Ga0496111_0216715
827 Ga0496111_0898742
828 Ga0496111_0962602
829 Ga0496111_1097469
830 Ga0496112_0048509
831 Ga0496112_0063356
832 Ga0496112_0843077
833 Ga0496113_0071085
834 Ga0496113_0651518
835 Ga0496113_1265003
836 Ga0496121_0661995
837 Ga0496126_0243639
838 Ga0501317_095778
839 Ga0501031_0203951
840 Ga0501031_0224700
841 Ga0501031_0243788
842 Ga0501032_0939102
843 Ga0501033_0512408
844 Ga0501034_1144602
845 Ga0501036_0016218
846 Ga0501036_0016401
847 Ga0501036_0064127
848 Ga0501036_0601808
849 Ga0501037_0416169
850 Ga0501038_0160924
851 Ga0501038_0276132
852 Ga0501038_0870230
853 Ga0501039_0003230
854 Ga0501039_0064768
855 Ga0501039_0074555
856 Ga0501039_0075768
857 Ga0501039_0946634
858 Ga0501040_0034152
859 Ga0501040_0373609
860 Ga0501040_1121782
861 Ga0501041_0044839
862 Ga0501042_0013186
863 Ga0501042_0296189
864 Ga0501042_0335103
865 Ga0501042_1367628
866 Ga0501043_0541622
867 Ga0501046_0157638
868 Ga0501048_0035576
869 Ga0501048_0083888
870 Ga0501048_0277111
871 Ga0501068_0079495
872 Ga0501068_0184448
873 Ga0501068_0586430
874 Ga0501069_0314753
875 Ga0501070_0587349
876 Ga0501070_1040279
877 Ga0501070_1049987
878 Ga0501071_0024178
879 Ga0501071_0951981
880 Ga0501072_0006978
881 Ga0501072_0010843
882 Ga0501072_0326440
883 Ga0501072_1083171
884 Ga0501073_0666415
885 Ga0501075_0224628
886 Ga0501075_0673459
887 Ga0501075_0752398
888 Ga0501075_1112270
889 Ga0501076_0029655
890 Ga0501076_0449253
891 Ga0501076_1239539
892 Ga0501076_1667517
893 Ga0501077_0278838
894 Ga0501077_0353003
895 Ga0501079_0022389
896 Ga0501079_1089413
897 Ga0501080_0053199
898 Ga0501080_0240818
899 Ga0501081_0164160
900 Ga0501081_0338589
901 Ga0501035_0114888
902 Ga0501045_0026916
903 Ga0501045_0037054
904 Ga0501045_0078337
905 Ga0501045_1000062
906 nmdc:mga09592_878841_c1
907 nmdc:mga0qj67_724056_c1
908 nmdc:mga06r32_341284_c1
909 nmdc:mga06r32_841432_c1
910 nmdc:mga08y16_2141694_c1
911 nmdc:mga08y16_791810_c1
912 Ga0500616_0189159
913 Ga0501084_0019957
914 Ga0501084_0378291
915 Ga0501084_1199152
916 Ga0501084_1527915
917 Ga0590071_082796
918 Ga0590074_128517
919 Ga0590075_141200
920 Ga0587082_182607
921 Ga0587099_064307
922 Ga0587071_204473
923 Ga0501082_0198478
924 Ga0501082_0205886
925 Ga0501082_0861424
926 Ga0466962_0019930
927 Ga0466962_0321119
928 Ga0530510_0039484

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07191

zinc-ribbons_6

zinc-ribbons

16

79

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v8p-assembly2.cif.gz_CY t.thermophila 60s ribosomal subunit in complex with initiation factor 6. 0.9354 9 39
8p5d-assembly1.cif.gz_LPP spraguea lophii ribosome in the closed conformation by cryo sub tomogram averaging 0.9185 9 39
5ndv-assembly1.cif.gz_q3 crystal structure of paromomycin bound to the yeast 80s ribosome 0.9074 9 39
8b5l-assembly1.cif.gz_p cryo-em structure of ribosome-sec61-trap (translocon associated protein) translocon complex 0.9052 9 37
8br8-assembly1.cif.gz_Lq giardia ribosome in post-t state (a1) 0.8975 11 39
ID Description Score Start End Superfamily
4a17Y00 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.9354 9 39 2.20.25.30
af_C6SXD2_1_92_2.20.25.30 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.8763 9 37 2.20.25.30
1vwxp00 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.8614 9 37 2.20.25.30
5iw4A01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase; 0.7899 12 39 3.90.79.20
4kjuC00 Mainly Alpha;Orthogonal Bundle;Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A;Inhibitor Of Apoptosis Protein (2mihbC-IAP-1); Chain A 0.7356 19 37 1.10.1170.10
ID Description Score Start End GO Terms
AF-A0A811UJ77-F1-model_v4 (Mediterranean fruit fly) hypothetical protein 0.9616 9 39 GO:0003735
GO:0005840
GO:0006412
GO:0016020
GO:1990904
AF-A0A7C4GSZ0-F1-model_v4 Uncharacterized protein 0.945 10 41
AF-A0A087KKQ3-F1-model_v4 Transposase zinc-ribbon domain-containing protein 0.9387 12 39
AF-A0A496Q7M5-F1-model_v4 ParB/Sulfiredoxin domain-containing protein 0.9099 12 39 GO:0003677
GO:0005694
GO:0007059
AF-A0A538AP44-F1-model_v4 Insertion element protein 0.9091 12 41

Map