F449185

General Info

Members Datasets Scaffolds Average Seq Length
463 288 460 164

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0223310|Ga0496114_0223310_951_1511
Length 186
Sequence LSAIIIVPANVLCFAFAASFYQIRSSPQDVFQEIKCTVNGQPRTLQAHSMERLLDVLREQLNLTGTKEGCGEGECGACSVLIDGQLVNSCLVPVAQIAGCSIKTIEGIAISETQLHAVQQAFIECGGAQCGICTPGMVIAAVSLLEQNPQPDEASIREGLAGNLCRCTGYMKIFESVVRACEGVSK

Samples

Sample ID Description Type Environment
1 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
2 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
3 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
4 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
99 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
150 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
151 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
152 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
164 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
165 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
187 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
188 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
195 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
196 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
197 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
205 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
208 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
224 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
234 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
235 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
236 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
256 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
257 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
258 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
263 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
264 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
265 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
266 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
267 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
270 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
272 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
283 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
284 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
285 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
288 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 0.43
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.16
Nodule 0
Rhizoplane 3.67
Rhizosphere 91.79
Stem 0
Stem Tuber 0
Unclassified 2.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1000205 3300000532 Bacteria 5511
2 JGI25406J46586_10074123 3300003203 Bacteria 1060
3 JGI25165J46597_1005592 3300003214 Bacteria 2389
4 Ga0058863_11863732 3300004799 Bacteria 6488
5 Ga0058861_11841167 3300004800 Bacteria 3209
6 Ga0065714_10005661 3300005288 Bacteria 5468
7 Ga0065712_10004575 3300005290 Bacteria 3534
8 Ga0065715_10170445 3300005293 Bacteria 1551
9 Ga0065715_10341685 3300005293 Bacteria 966
10 Ga0065715_10383803 3300005293 Bacteria 903
11 Ga0065715_10455210 3300005293 Bacteria 822
12 Ga0065715_10524730 3300005293 Bacteria 760
13 Ga0065715_10891461 3300005293 Bacteria 578
14 Ga0065707_10003154 3300005295 Bacteria 5293
15 Ga0065707_10005955 3300005295 Bacteria 5182
16 Ga0070676_10205138 3300005328 Bacteria 1294
17 Ga0070676_10437815 3300005328 Bacteria 917
18 Ga0068869_101152476 3300005334 Bacteria 680
19 Ga0070666_10051723 3300005335 Unclassified 2767
20 Ga0068868_100187245 3300005338 Bacteria 1720
21 Ga0068868_100348181 3300005338 Bacteria 1268
22 Ga0070687_100013906 3300005343 Bacteria 3601
23 Ga0070692_10076066 3300005345 Bacteria 1799
24 Ga0070671_100035589 3300005355 Bacteria 4125
25 Ga0070674_100179929 3300005356 Bacteria 1619
26 Ga0070673_100287934 3300005364 Bacteria 1443
27 Ga0070659_100367747 3300005366 Bacteria 1209
28 Ga0070713_100107442 3300005436 Bacteria 2428
29 Ga0070710_10498580 3300005437 Bacteria 833
30 Ga0070710_10853164 3300005437 Bacteria 654
31 Ga0070701_10105960 3300005438 Bacteria 1564
32 Ga0070701_10198888 3300005438 Bacteria 1183
33 Ga0070711_100232798 3300005439 Bacteria 1437
34 Ga0070711_100499916 3300005439 Bacteria 1002
35 Ga0070705_100125371 3300005440 Bacteria 1666
36 Ga0070700_100000316 3300005441 Bacteria 25114
37 Ga0070694_100018893 3300005444 Bacteria 4379
38 Ga0070694_100049074 3300005444 Unclassified 2841
39 Ga0070694_100068319 3300005444 Unclassified 2442
40 Ga0070708_100001339 3300005445 Bacteria 18832
41 Ga0070708_101003119 3300005445 Bacteria 783
42 Ga0070678_100696518 3300005456 Bacteria 915
43 Ga0070681_10006845 3300005458 Bacteria 11094
44 Ga0070681_10307337 3300005458 Bacteria 1495
45 Ga0068867_100074466 3300005459 Bacteria 2545
46 Ga0070706_100052317 3300005467 Bacteria 3769
47 Ga0070706_100311691 3300005467 Bacteria 1468
48 Ga0070707_100030561 3300005468 Bacteria 5129
49 Ga0070698_100003853 3300005471 Bacteria 16501
50 Ga0070698_101476575 3300005471 Bacteria 631
51 Ga0070699_100005101 3300005518 Bacteria 11551
52 Ga0070699_100006063 3300005518 Bacteria 10568
53 Ga0070699_100128730 3300005518 Bacteria 2231
54 Ga0070699_100237719 3300005518 Bacteria 1625
55 Ga0070679_100220943 3300005530 Bacteria 1855
56 Ga0070679_100552957 3300005530 Bacteria 1095
57 Ga0070679_101265870 3300005530 Bacteria 683
58 Ga0070697_100002727 3300005536 Bacteria 13610
59 Ga0070697_101211691 3300005536 Bacteria 673
60 Ga0068853_101238427 3300005539 Bacteria 721
61 Ga0070686_100083350 3300005544 Bacteria 2122
62 Ga0070695_100016998 3300005545 Bacteria 4411
63 Ga0070695_100322348 3300005545 Bacteria 1149
64 Ga0070695_100559373 3300005545 Bacteria 893
65 Ga0070695_100885059 3300005545 Bacteria 720
66 Ga0070695_101239236 3300005545 Bacteria 615
67 Ga0070696_100030031 3300005546 Bacteria 3718
68 Ga0070693_100021574 3300005547 Bacteria 3412
69 Ga0070693_100037766 3300005547 Unclassified 2695
70 Ga0070693_100379697 3300005547 Unclassified 974
71 Ga0070693_100715267 3300005547 Bacteria 734
72 Ga0070665_100006263 3300005548 Bacteria 12164
73 Ga0070704_100054940 3300005549 Bacteria 2821
74 Ga0070704_100219913 3300005549 Bacteria 1544
75 Ga0068855_100000302 3300005563 Bacteria 61501
76 Ga0070664_100189795 3300005564 Bacteria 1830
77 Ga0070664_101007249 3300005564 Bacteria 783
78 Ga0068857_100839020 3300005577 Bacteria 879
79 Ga0068857_101035045 3300005577 Bacteria 791
80 Ga0068857_101051253 3300005577 Bacteria 785
81 Ga0068857_101667825 3300005577 Unclassified 623
82 Ga0068854_100124041 3300005578 Bacteria 1965
83 Ga0068854_100564931 3300005578 Bacteria 967
84 Ga0068856_100048208 3300005614 Bacteria 4197
85 Ga0068856_100079877 3300005614 Bacteria 3244
86 Ga0068856_100764584 3300005614 Bacteria 986
87 Ga0070702_100357994 3300005615 Bacteria 1030
88 Ga0068852_100053265 3300005616 Bacteria 3482
89 Ga0068859_100000232 3300005617 Bacteria 54896
90 Ga0068859_100291979 3300005617 Bacteria 1724
91 Ga0068859_100910814 3300005617 Bacteria 964
92 Ga0068864_100046294 3300005618 Bacteria 3732
93 Ga0068864_100285158 3300005618 Bacteria 1542
94 Ga0068870_10273848 3300005840 Unclassified 1055
95 Ga0068863_100025362 3300005841 Bacteria 5652
96 Ga0068863_100219410 3300005841 Bacteria 1832
97 Ga0068858_100158850 3300005842 Bacteria 2128
98 Ga0068858_101323805 3300005842 Bacteria 709
99 Ga0068858_101462979 3300005842 Unclassified 673
100 Ga0068860_100459422 3300005843 Bacteria 1267
101 Ga0081539_10000073 3300005985 Bacteria 231470
102 Ga0081539_10001769 3300005985 Bacteria 34433
103 Ga0070716_100015178 3300006173 Bacteria 3953
104 Ga0075366_10000091 3300006195 Bacteria 36066
105 Ga0097621_100809897 3300006237 Unclassified 868
106 Ga0097621_101112490 3300006237 Bacteria 742
107 Ga0068871_100161251 3300006358 Bacteria 1918
108 Ga0068871_101023913 3300006358 Unclassified 770
109 Ga0075428_100013870 3300006844 Bacteria 8972
110 Ga0075430_100079454 3300006846 Bacteria 2749
111 Ga0075431_100001930 3300006847 Bacteria 19744
112 Ga0075433_10039116 3300006852 Bacteria 4099
113 Ga0075433_10126407 3300006852 Unclassified 2270
114 Ga0075433_10502221 3300006852 Bacteria 1067
115 Ga0075434_100048740 3300006871 Bacteria 4203
116 Ga0075434_100234399 3300006871 Bacteria 1855
117 Ga0075434_100377618 3300006871 Bacteria 1438
118 Ga0075429_100116014 3300006880 Bacteria 2341
119 Ga0075429_100552876 3300006880 Bacteria 1009
120 Ga0075429_100581996 3300006880 Bacteria 981
121 Ga0075429_100720255 3300006880 Bacteria 874
122 Ga0097620_100000232 3300006931 Bacteria 54896
123 Ga0097620_100029205 3300006931 Bacteria 5533
124 Ga0097620_100291988 3300006931 Bacteria 1724
125 Ga0097620_100910813 3300006931 Bacteria 964
126 Ga0099794_10027367 3300007265 Bacteria 2643
127 Ga0105240_10108640 3300009093 Bacteria 3360
128 Ga0105240_10200078 3300009093 Bacteria 2342
129 Ga0105240_10539545 3300009093 Bacteria 1292
130 Ga0111539_10069447 3300009094 Bacteria 4160
131 Ga0111539_10300653 3300009094 Bacteria 1868
132 Ga0111539_10674542 3300009094 Bacteria 1203
133 Ga0105247_10119475 3300009101 Bacteria 1706
134 Ga0114129_11264438 3300009147 Bacteria 916
135 Ga0105243_10664127 3300009148 Bacteria 1012
136 Ga0105241_10395811 3300009174 Bacteria 1210
137 Ga0105241_11443371 3300009174 Bacteria 660
138 Ga0105241_11471270 3300009174 Bacteria 654
139 Ga0105242_10000702 3300009176 Bacteria 26171
140 Ga0105248_10010422 3300009177 Bacteria 10234
141 Ga0105248_10012948 3300009177 Bacteria 9194
142 Ga0105237_10052550 3300009545 Bacteria 4089
143 Ga0105237_10402492 3300009545 Bacteria 1373
144 Ga0105237_11433080 3300009545 Unclassified 697
145 Ga0105249_13287216 3300009553 Bacteria 520
146 Ga0105239_10051076 3300010375 Bacteria 4533
147 Ga0105246_10238188 3300011119 Bacteria 1437
148 Ga0105246_10443944 3300011119 Bacteria 1089
149 Ga0157373_10064248 3300013100 Bacteria 2598
150 Ga0157369_11412237 3300013105 Bacteria 709
151 Ga0157374_10007330 3300013296 Bacteria 9405
152 Ga0157374_10272071 3300013296 Unclassified 1670
153 Ga0157378_10006966 3300013297 Bacteria 9860
154 Ga0157378_10030872 3300013297 Bacteria 4732
155 Ga0157378_10083798 3300013297 Bacteria 2886
156 Ga0157378_10583973 3300013297 Bacteria 1127
157 Ga0163162_10009265 3300013306 Bacteria 9575
158 Ga0163162_10012037 3300013306 Bacteria 8436
159 Ga0163162_10075476 3300013306 Bacteria 3432
160 Ga0163162_10825597 3300013306 Bacteria 1043
161 Ga0157375_10510377 3300013308 Unclassified 1366
162 Ga0157375_12534601 3300013308 Unclassified 612
163 Ga0163163_10035443 3300014325 Bacteria 4840
164 Ga0163163_11015063 3300014325 Bacteria 893
165 Ga0157380_10010347 3300014326 Bacteria 6709
166 Ga0157380_10025489 3300014326 Bacteria 4484
167 Ga0157380_10070478 3300014326 Bacteria 2825
168 Ga0157380_10104853 3300014326 Bacteria 2362
169 Ga0157380_10728758 3300014326 Bacteria 1000
170 Ga0157377_10045892 3300014745 Bacteria 2442
171 Ga0157376_10026521 3300014969 Bacteria 4581
172 Ga0157376_11287995 3300014969 Bacteria 761
173 Ga0163161_10008665 3300017792 Bacteria 7032
174 Ga0163161_10035467 3300017792 Bacteria 3570
175 Ga0163161_10275937 3300017792 Bacteria 1317
176 Ga0213872_10008366 3300021361 Bacteria 5010
177 Ga0213872_10014507 3300021361 Bacteria 3676
178 Ga0213872_10039054 3300021361 Bacteria 2166
179 Ga0213876_10072605 3300021384 Bacteria 1817
180 Ga0213871_10006972 3300021441 Bacteria 2419
181 Ga0213871_10075765 3300021441 Bacteria 957
182 Ga0209437_100021 3300025233 Bacteria 646400
183 Ga0209233_1000035 3300025261 Bacteria 568478
184 Ga0209455_1001461 3300025272 Bacteria 10634
185 Ga0207697_10050408 3300025315 Bacteria 1719
186 Ga0207692_10331154 3300025898 Bacteria 934
187 Ga0207642_10026910 3300025899 Bacteria 2348
188 Ga0207680_10562859 3300025903 Unclassified 814
189 Ga0207643_10002705 3300025908 Bacteria 9585
190 Ga0207684_11172474 3300025910 Bacteria 637
191 Ga0207707_10009333 3300025912 Bacteria 8507
192 Ga0207707_10234694 3300025912 Bacteria 1596
193 Ga0207695_10038967 3300025913 Bacteria 5111
194 Ga0207695_10233133 3300025913 Bacteria 1744
195 Ga0207695_10367648 3300025913 Bacteria 1324
196 Ga0207671_10393367 3300025914 Bacteria 1102
197 Ga0207652_10804588 3300025921 Bacteria 834
198 Ga0207652_11094051 3300025921 Bacteria 697
199 Ga0207694_10606393 3300025924 Bacteria 921
200 Ga0207650_10060184 3300025925 Bacteria 2834
201 Ga0207700_10115202 3300025928 Bacteria 2170
202 Ga0207644_10017826 3300025931 Bacteria 4801
203 Ga0207706_10329594 3300025933 Bacteria 1328
204 Ga0207706_11252019 3300025933 Bacteria 615
205 Ga0207686_10000802 3300025934 Bacteria 19287
206 Ga0207669_10062151 3300025937 Bacteria 2299
207 Ga0207669_10386762 3300025937 Bacteria 1092
208 Ga0207665_10005680 3300025939 Bacteria 8308
209 Ga0207665_10440530 3300025939 Unclassified 998
210 Ga0207711_10024373 3300025941 Bacteria 5068
211 Ga0207711_10036680 3300025941 Bacteria 4161
212 Ga0207679_10554113 3300025945 Bacteria 1032
213 Ga0207667_10000033 3300025949 Bacteria 314353
214 Ga0207667_10001090 3300025949 Bacteria 34407
215 Ga0207651_10475324 3300025960 Bacteria 1076
216 Ga0207640_10552693 3300025981 Bacteria 967
217 Ga0207658_10025063 3300025986 Bacteria 4175
218 Ga0207677_10402501 3300026023 Bacteria 1161
219 Ga0207703_10099696 3300026035 Bacteria 2459
220 Ga0207703_10134495 3300026035 Bacteria 2139
221 Ga0207703_11242230 3300026035 Bacteria 716
222 Ga0207708_10000061 3300026075 Bacteria 92741
223 Ga0207702_10043172 3300026078 Bacteria 3785
224 Ga0207702_10483306 3300026078 Bacteria 1205
225 Ga0207702_11710973 3300026078 Bacteria 622
226 Ga0207641_10031834 3300026088 Bacteria 4376
227 Ga0207676_10044325 3300026095 Bacteria 3431
228 Ga0207676_10102037 3300026095 Bacteria 2380
229 Ga0207676_10889600 3300026095 Unclassified 873
230 Ga0207674_10403111 3300026116 Bacteria 1322
231 Ga0207674_11121953 3300026116 Bacteria 756
232 Ga0207674_11702253 3300026116 Unclassified 599
233 Ga0207675_100630060 3300026118 Bacteria 1077
234 Ga0207698_10081762 3300026142 Bacteria 2609
235 Ga0207428_11118273 3300027907 Unclassified 550
236 Ga0268266_10000440 3300028379 Bacteria 62176
237 Ga0268266_10372357 3300028379 Bacteria 1345
238 Ga0268265_10698652 3300028380 Bacteria 980
239 Ga0268265_10822790 3300028380 Bacteria 907
240 Ga0268265_11318992 3300028380 Bacteria 722
241 Ga0268264_10992860 3300028381 Bacteria 846
242 Ga0307515_10000790 3300028794 Bacteria 72891
243 Ga0307515_10001565 3300028794 Bacteria 51101
244 Ga0265328_10032385 3300031239 Bacteria 1940
245 Ga0265331_10009788 3300031250 Bacteria 5349
246 Ga0265316_10003739 3300031344 Bacteria 15289
247 Ga0265316_10748094 3300031344 Bacteria 687
248 Ga0307513_10003044 3300031456 Bacteria 22870
249 Ga0307509_10108016 3300031507 Bacteria 2797
250 Ga0307408_100190767 3300031548 Bacteria 1651
251 Ga0307408_100203114 3300031548 Bacteria 1605
252 Ga0265314_10052212 3300031711 Bacteria 2843
253 Ga0307414_10175405 3300032004 Bacteria 1718
254 Ga0307415_100718220 3300032126 Bacteria 904
255 Ga0307507_10000143 3300033179 Bacteria 124248
256 Ga0373941_0025166 3300035115 Bacteria 1717
257 Ga0373956_0370411 3300035119 Bacteria 683
258 Ga0373961_0273150 3300035241 Bacteria 618
259 Ga0373935_0340983 3300035692 Bacteria 1067
260 Ga0373927_0963245 3300035695 Bacteria 563
261 Ga0373933_0250326 3300035724 Bacteria 1141
262 Ga0373937_0805582 3300036401 Bacteria 887
263 Ga0316582_0083244 3300036647 Unclassified 2093
264 Ga0395900_0299163 3300037418 Bacteria 1596
265 Ga0395898_0278392 3300037466 Bacteria 1596
266 Ga0436365_0314158 3300039437 Bacteria 1818
267 Ga0436365_1663893 3300039437 Bacteria 3571
268 Ga0436365_1761339 3300039437 Bacteria 1204
269 Ga0436360_0244791 3300039438 Bacteria 4163
270 Ga0436360_0544773 3300039438 Bacteria 6759
271 Ga0436360_1325334 3300039438 Bacteria 1734
272 Ga0436361_0166848 3300039447 Bacteria 6611
273 Ga0436361_0395455 3300039447 Bacteria 1164
274 Ga0436361_0485637 3300039447 Bacteria 12799
275 Ga0436361_0574976 3300039447 Bacteria 2175
276 Ga0436361_0606984 3300039447 Bacteria 5848
277 Ga0436362_1018355 3300039453 Bacteria 726
278 Ga0439448_0101904 3300042005 Bacteria 976
279 Ga0439458_0008067 3300042157 Bacteria 2342
280 Ga0451577_0739510 3300042876 Bacteria 890
281 Ga0451577_1432560 3300042876 Bacteria 612
282 Ga0453683_0012908 3300044673 Bacteria 5464
283 Ga0453684_0024673 3300044712 Bacteria 8771
284 Ga0453684_0118749 3300044712 Unclassified 3198
285 Ga0453684_0184887 3300044712 Bacteria 2443
286 Ga0453684_0487902 3300044712 Bacteria 1366
287 Ga0466968_0098360 3300044735 Bacteria 1304
288 Ga0466957_0110750 3300044842 Bacteria 1741
289 Ga0451576_0000115 3300045051 Bacteria 208342
290 Ga0451576_0025050 3300045051 Bacteria 6434
291 Ga0466967_1501997 3300045976 Bacteria 671
292 Ga0495592_0078770 3300046454 Bacteria 2386
293 Ga0495592_0484647 3300046454 Bacteria 770
294 Ga0495603_0002230 3300046455 Bacteria 11390
295 Ga0495603_0128787 3300046455 Bacteria 1474
296 Ga0495629_0007912 3300046459 Bacteria 7821
297 Ga0495651_0006278 3300046462 Bacteria 9092
298 Ga0495651_0145561 3300046462 Bacteria 1714
299 Ga0495651_0157313 3300046462 Bacteria 1632
300 Ga0495653_0038396 3300046463 Bacteria 3759
301 Ga0495650_0000037 3300046471 Bacteria 390090
302 Ga0495580_0140599 3300046472 Bacteria 1673
303 Ga0495580_0210668 3300046472 Bacteria 1337
304 Ga0495582_0001434 3300046473 Bacteria 13440
305 Ga0495582_0072955 3300046473 Unclassified 1900
306 Ga0495639_0006870 3300046475 Bacteria 4890
307 Ga0495662_0065399 3300046476 Bacteria 1757
308 Ga0495662_0425316 3300046476 Bacteria 652
309 Ga0495664_0362461 3300046477 Bacteria 872
310 Ga0495664_0681381 3300046477 Unclassified 608
311 Ga0495585_0000648 3300046492 Bacteria 31937
312 Ga0495585_0021629 3300046492 Bacteria 3693
313 Ga0495585_0124669 3300046492 Bacteria 1360
314 Ga0495594_0000839 3300046499 Bacteria 15860
315 Ga0495594_0001127 3300046499 Bacteria 13943
316 Ga0495594_0004163 3300046499 Bacteria 7431
317 Ga0495596_0054970 3300046500 Unclassified 1556
318 Ga0495607_0216652 3300046501 Bacteria 939
319 Ga0495583_0065991 3300046506 Bacteria 1602
320 Ga0495606_0041414 3300046507 Bacteria 3089
321 Ga0495608_0007147 3300046511 Bacteria 7899
322 Ga0495618_0146636 3300046514 Bacteria 1508
323 Ga0495618_0335042 3300046514 Bacteria 935
324 Ga0495628_0005772 3300046516 Bacteria 10846
325 Ga0495628_0015773 3300046516 Bacteria 6306
326 Ga0495628_0068745 3300046516 Bacteria 2763
327 Ga0495630_0009529 3300046517 Bacteria 6984
328 Ga0495630_0030541 3300046517 Bacteria 4009
329 Ga0495644_0000393 3300046523 Bacteria 19612
330 Ga0495648_0009801 3300046524 Bacteria 7369
331 Ga0495648_0097078 3300046524 Bacteria 1635
332 Ga0495648_0110521 3300046524 Bacteria 1497
333 Ga0495666_0001694 3300046526 Bacteria 10891
334 Ga0495642_0143508 3300046528 Bacteria 1031
335 Ga0495652_0017097 3300046529 Bacteria 6476
336 Ga0495654_0009974 3300046530 Bacteria 5188
337 Ga0495665_0000838 3300046531 Bacteria 16077
338 Ga0495665_0079519 3300046531 Bacteria 1725
339 Ga0495640_0114442 3300046533 Bacteria 1758
340 Ga0495586_0051505 3300046535 Bacteria 2228
341 Ga0495587_0180264 3300046536 Bacteria 1198
342 Ga0495609_0013463 3300046538 Bacteria 3860
343 Ga0495621_0103751 3300046539 Bacteria 1084
344 Ga0495645_0051186 3300046543 Bacteria 3005
345 Ga0495622_0028618 3300046557 Bacteria 2602
346 Ga0495622_0111537 3300046557 Bacteria 1252
347 Ga0495633_0000275 3300046558 Bacteria 60032
348 Ga0495633_0033688 3300046558 Bacteria 2469
349 Ga0495667_0006547 3300046559 Bacteria 7905
350 Ga0495667_0024707 3300046559 Bacteria 4047
351 Ga0495668_0000017 3300046616 Bacteria 434025
352 Ga0495634_0002918 3300046642 Bacteria 13996
353 Ga0495611_0086193 3300046648 Bacteria 1449
354 Ga0495625_0000435 3300046660 Bacteria 62758
355 Ga0495625_0003324 3300046660 Bacteria 16203
356 Ga0495625_0128029 3300046660 Bacteria 1722
357 Ga0495635_0009459 3300046663 Bacteria 6812
358 Ga0495657_0036912 3300046675 Bacteria 3372
359 Ga0495599_0061880 3300046678 Bacteria 2338
360 Ga0495599_0243953 3300046678 Bacteria 1095
361 Ga0495623_0190352 3300046679 Bacteria 1186
362 Ga0495646_0010103 3300046680 Bacteria 6002
363 Ga0495658_0253797 3300046683 Bacteria 1106
364 Ga0495669_0017288 3300046684 Bacteria 3094
365 Ga0495669_0163874 3300046684 Bacteria 1056
366 Ga0495613_0025091 3300046689 Unclassified 4442
367 Ga0495624_0026452 3300046690 Bacteria 3802
368 Ga0495624_0806879 3300046690 Unclassified 555
369 Ga0495670_0287892 3300046691 Unclassified 879
370 Ga0495670_0507676 3300046691 Bacteria 655
371 Ga0495649_0091149 3300046694 Bacteria 1625
372 Ga0495600_0007082 3300046809 Bacteria 6853
373 Ga0495581_0046963 3300047315 Bacteria 2495
374 Ga0495604_0072340 3300047317 Bacteria 2606
375 Ga0495604_0075023 3300047317 Bacteria 2547
376 Ga0495636_0020358 3300047318 Bacteria 2674
377 Ga0495674_0010635 3300047319 Bacteria 8705
378 Ga0495674_0080449 3300047319 Bacteria 2796
379 Ga0495672_0007501 3300047320 Bacteria 8197
380 Ga0495672_0023708 3300047320 Bacteria 3966
381 Ga0495676_0011108 3300047321 Bacteria 8136
382 Ga0495680_0021995 3300047322 Bacteria 5328
383 Ga0495683_0054818 3300047323 Unclassified 1986
384 Ga0495687_000631 3300047443 Bacteria 40299
385 Ga0495675_0001482 3300047444 Bacteria 14212
386 Ga0495675_0272401 3300047444 Bacteria 1011
387 Ga0495677_0051145 3300047445 Bacteria 1521
388 Ga0495684_0002721 3300047471 Bacteria 13986
389 Ga0495684_0035908 3300047471 Bacteria 3800
390 Ga0495684_0285231 3300047471 Bacteria 1190
391 Ga0495593_0099545 3300047673 Bacteria 1492
392 Ga0495602_0696326 3300048088 Unclassified 690
393 Ga0495602_0983114 3300048088 Unclassified 558
394 Ga0495614_0000866 3300048089 Bacteria 12817
395 Ga0496100_0050599 3300048903 Bacteria 2693
396 Ga0496101_0968380 3300048904 Bacteria 669
397 Ga0496102_0397588 3300048905 Bacteria 1296
398 Ga0496104_0097599 3300048907 Bacteria 2813
399 Ga0496104_0598078 3300048907 Bacteria 1013
400 Ga0496105_1068126 3300048908 Bacteria 601
401 Ga0496106_0350388 3300048909 Bacteria 1186
402 Ga0496107_0788614 3300048910 Bacteria 696
403 Ga0496108_0588020 3300048911 Bacteria 970
404 Ga0496109_0507186 3300048912 Bacteria 1139
405 Ga0496110_0496046 3300048913 Bacteria 1112
406 Ga0496112_0032541 3300048915 Bacteria 5065
407 Ga0496112_0212596 3300048915 Bacteria 1891
408 Ga0496112_0386573 3300048915 Bacteria 1340
409 Ga0496112_0447231 3300048915 Bacteria 1230
410 Ga0496113_0363628 3300048916 Bacteria 1161
411 Ga0496114_0223310 3300048917 Bacteria 1654
412 Ga0496125_0428811 3300048928 Bacteria 764
413 Ga0495682_0015552 3300049460 Bacteria 2883
414 Ga0501292_042830 3300049515 Bacteria 786
415 Ga0501298_012384 3300049521 Bacteria 1495
416 Ga0501068_0187784 3300049584 Bacteria 1308
417 Ga0501072_0591610 3300049588 Unclassified 875
418 Ga0501073_0139640 3300049589 Bacteria 1679
419 Ga0501077_0133441 3300049593 Bacteria 1575
420 Ga0501216_019722 3300049660 Bacteria 1172
421 Ga0501227_018192 3300049665 Bacteria 1593
422 Ga0501233_060033 3300049668 Bacteria 941
423 Ga0501243_023151 3300049675 Bacteria 1032
424 Ga0501252_009574 3300049682 Bacteria 1132
425 Ga0501234_001546 3300049707 Bacteria 3609
426 Ga0501081_0093721 3300049743 Bacteria 2115
427 Ga0501270_005798 3300049767 Bacteria 1453
428 Ga0501045_0274146 3300049824 Unclassified 1256
429 Ga0501204_003364 3300049850 Bacteria 1676
430 nmdc:mga0k408_490_c1 3300050493 Bacteria 21695
431 nmdc:mga05p37_1405447_c1 3300050507 Bacteria 702
432 nmdc:mga09592_155266_c1 3300050508 Bacteria 1975
433 nmdc:mga09592_54790_c1 3300050508 Bacteria 3369
434 nmdc:mga09592_868352_c1 3300050508 Bacteria 760
435 nmdc:mga0qj67_197673_c1 3300050509 Unclassified 1634
436 nmdc:mga0qj67_72099_c1 3300050509 Bacteria 2757
437 nmdc:mga06r32_1872_c1 3300050510 Bacteria 18756
438 nmdc:mga06r32_65926_c1 3300050510 Bacteria 3494
439 nmdc:mga08y16_62675_c1 3300050511 Bacteria 3883
440 nmdc:mga08y16_953187_c1 3300050511 Bacteria 841
441 nmdc:mga0n895_1264160_c1 3300050512 Bacteria 710
442 nmdc:mga0n895_227334_c1 3300050512 Bacteria 1894
443 nmdc:mga0n895_344597_c1 3300050512 Bacteria 1509
444 nmdc:mga0n895_53075_c1 3300050512 Bacteria 3981
445 nmdc:mga0n895_78830_c1 3300050512 Bacteria 3279
446 nmdc:mga0n895_91059_c1 3300050512 Bacteria 3052
447 nmdc:mga0rr50_1226_c1 3300050513 Bacteria 13954
448 nmdc:mga08x19_9_c1 3300050514 Bacteria 418852
449 nmdc:mga0a205_334433_c1 3300050515 Bacteria 1384
450 nmdc:mga0a205_42787_c1 3300050515 Bacteria 4365
451 nmdc:mga0a205_81126_c1 3300050515 Bacteria 3134
452 nmdc:mga0a205_927717_c1 3300050515 Unclassified 717
453 Ga0495595_0659560 3300053084 Bacteria 536
454 Ga0500651_0000007 3300053093 Bacteria 295019
455 Ga0500614_021027 3300053123 Bacteria 1511
456 Ga0500618_000015 3300053125 Bacteria 175864
457 Ga0501084_0595230 3300054114 Bacteria 934
458 Ga0501084_0647964 3300054114 Bacteria 892
459 Ga0500661_010756 3300055283 Bacteria 1664
460 Ga0590071_001392 3300059421 Bacteria 6405

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039438 Ga0436360_0244791 Ga0436360_0244791_3358_3780 131
2 3300005355 Ga0070671_100035589 Ga0070671_1000355896 133
3 3300005564 Ga0070664_101007249 Ga0070664_1010072491 133
4 3300013296 Ga0157374_10272071 Ga0157374_102720712 133
5 3300035695 Ga0373927_0963245 Ga0373927_0963245_31_432 133
6 3300046473 Ga0495582_0072955 Ga0495582_0072955_33_446 133
7 3300046477 Ga0495664_0681381 Ga0495664_0681381_36_449 133
8 3300047317 Ga0495604_0072340 Ga0495604_0072340_1072_1485 133
9 3300048088 Ga0495602_0983114 Ga0495602_0983114_95_508 133
10 3300048909 Ga0496106_0350388 Ga0496106_0350388_594_1007 133
11 3300048911 Ga0496108_0588020 Ga0496108_0588020_439_852 133
12 3300048915 Ga0496112_0212596 Ga0496112_0212596_52_465 133
13 3300048916 Ga0496113_0363628 Ga0496113_0363628_555_968 133
14 3300054114 Ga0501084_0595230 Ga0501084_0595230_15_422 133
15 3300006847 Ga0075431_100001930 Ga0075431_1000019302 137
16 3300046501 Ga0495607_0216652 Ga0495607_0216652_349_792 143
17 3300048903 Ga0496100_0050599 Ga0496100_0050599_422_871 145
18 3300048904 Ga0496101_0968380 Ga0496101_0968380_17_466 145
19 3300048910 Ga0496107_0788614 Ga0496107_0788614_221_670 145
20 3300048915 Ga0496112_0032541 Ga0496112_0032541_1648_2097 145
21 3300035119 Ga0373956_0370411 Ga0373956_0370411_78_545 146
22 3300046543 Ga0495645_0051186 Ga0495645_0051186_1526_1966 146
23 3300014969 Ga0157376_11287995 Ga0157376_112879952 148
24 3300026023 Ga0207677_10402501 Ga0207677_104025012 148
25 3300028380 Ga0268265_11318992 Ga0268265_113189922 148
26 3300017792 Ga0163161_10275937 Ga0163161_102759372 149
27 3300021361 Ga0213872_10014507 Ga0213872_100145072 150
28 3300021441 Ga0213871_10075765 Ga0213871_100757652 150
29 3300005293 Ga0065715_10383803 Ga0065715_103838032 151
30 3300005293 Ga0065715_10455210 Ga0065715_104552101 151
31 3300005293 Ga0065715_10891461 Ga0065715_108914611 151
32 3300005334 Ga0068869_101152476 Ga0068869_1011524761 151
33 3300005364 Ga0070673_100287934 Ga0070673_1002879342 151
34 3300005440 Ga0070705_100125371 Ga0070705_1001253712 151
35 3300005441 Ga0070700_100000316 Ga0070700_10000031611 151
36 3300005444 Ga0070694_100068319 Ga0070694_1000683193 151
37 3300005445 Ga0070708_100001339 Ga0070708_10000133912 151
38 3300005458 Ga0070681_10006845 Ga0070681_100068455 151
39 3300005467 Ga0070706_100311691 Ga0070706_1003116911 151
40 3300005471 Ga0070698_101476575 Ga0070698_1014765751 151
41 3300005518 Ga0070699_100006063 Ga0070699_1000060639 151
42 3300005530 Ga0070679_100552957 Ga0070679_1005529572 151
43 3300005539 Ga0068853_101238427 Ga0068853_1012384271 151
44 3300005545 Ga0070695_100016998 Ga0070695_1000169982 151
45 3300005545 Ga0070695_100885059 Ga0070695_1008850591 151
46 3300005546 Ga0070696_100030031 Ga0070696_1000300311 151
47 3300005547 Ga0070693_100379697 Ga0070693_1003796972 151
48 3300005547 Ga0070693_100715267 Ga0070693_1007152672 151
49 3300005549 Ga0070704_100219913 Ga0070704_1002199131 151
50 3300005577 Ga0068857_101051253 Ga0068857_1010512532 151
51 3300005617 Ga0068859_100000232 Ga0068859_10000023228 151
52 3300005617 Ga0068859_100910814 Ga0068859_1009108142 151
53 3300005841 Ga0068863_100219410 Ga0068863_1002194103 151
54 3300006237 Ga0097621_101112490 Ga0097621_1011124902 151
55 3300006852 Ga0075433_10039116 Ga0075433_100391164 151
56 3300006852 Ga0075433_10502221 Ga0075433_105022212 151
57 3300006871 Ga0075434_100048740 Ga0075434_1000487403 151
58 3300006931 Ga0097620_100000232 Ga0097620_10000023228 151
59 3300006931 Ga0097620_100910813 Ga0097620_1009108132 151
60 3300009093 Ga0105240_10539545 Ga0105240_105395452 151
61 3300009094 Ga0111539_10674542 Ga0111539_106745422 151
62 3300009101 Ga0105247_10119475 Ga0105247_101194752 151
63 3300009148 Ga0105243_10664127 Ga0105243_106641272 151
64 3300009174 Ga0105241_11443371 Ga0105241_114433712 151
65 3300009177 Ga0105248_10010422 Ga0105248_100104223 151
66 3300009545 Ga0105237_10402492 Ga0105237_104024922 151
67 3300013100 Ga0157373_10064248 Ga0157373_100642483 151
68 3300014325 Ga0163163_10035443 Ga0163163_100354435 151
69 3300025908 Ga0207643_10002705 Ga0207643_100027055 151
70 3300025910 Ga0207684_11172474 Ga0207684_111724741 151
71 3300025912 Ga0207707_10009333 Ga0207707_100093333 151
72 3300025913 Ga0207695_10367648 Ga0207695_103676482 151
73 3300025921 Ga0207652_10804588 Ga0207652_108045882 151
74 3300025941 Ga0207711_10036680 Ga0207711_100366802 151
75 3300025960 Ga0207651_10475324 Ga0207651_104753242 151
76 3300026078 Ga0207702_11710973 Ga0207702_117109731 151
77 3300026095 Ga0207676_10044325 Ga0207676_100443254 151
78 3300026116 Ga0207674_11121953 Ga0207674_111219531 151
79 3300028380 Ga0268265_10822790 Ga0268265_108227902 151
80 3300031548 Ga0307408_100203114 Ga0307408_1002031142 151
81 3300032004 Ga0307414_10175405 Ga0307414_101754052 151
82 3300035115 Ga0373941_0025166 Ga0373941_0025166_1077_1532 151
83 3300035241 Ga0373961_0273150 Ga0373961_0273150_99_554 151
84 3300036647 Ga0316582_0083244 Ga0316582_0083244_747_1217 151
85 3300037418 Ga0395900_0299163 Ga0395900_0299163_100_555 151
86 3300037466 Ga0395898_0278392 Ga0395898_0278392_252_707 151
87 3300042005 Ga0439448_0101904 Ga0439448_0101904_213_668 151
88 3300042157 Ga0439458_0008067 Ga0439458_0008067_1284_1739 151
89 3300042876 Ga0451577_1432560 Ga0451577_1432560_102_557 151
90 3300049515 Ga0501292_042830 Ga0501292_042830_157_612 151
91 3300049521 Ga0501298_012384 Ga0501298_012384_1006_1461 151
92 3300049660 Ga0501216_019722 Ga0501216_019722_34_489 151
93 3300049665 Ga0501227_018192 Ga0501227_018192_627_1082 151
94 3300049668 Ga0501233_060033 Ga0501233_060033_221_676 151
95 3300049675 Ga0501243_023151 Ga0501243_023151_42_497 151
96 3300049682 Ga0501252_009574 Ga0501252_009574_512_967 151
97 3300049707 Ga0501234_001546 Ga0501234_001546_783_1238 151
98 3300049767 Ga0501270_005798 Ga0501270_005798_42_497 151
99 3300049850 Ga0501204_003364 Ga0501204_003364_463_918 151
100 3300050512 nmdc:mga0n895_78830_c1 nmdc:mga0n895_78830_c1_1099_1554 151
101 3300050512 nmdc:mga0n895_91059_c1 nmdc:mga0n895_91059_c1_1759_2214 151
102 3300050515 nmdc:mga0a205_42787_c1 nmdc:mga0a205_42787_c1_1165_1620 151
103 3300050515 nmdc:mga0a205_81126_c1 nmdc:mga0a205_81126_c1_692_1147 151
104 3300005295 Ga0065707_10005955 Ga0065707_100059553 152
105 3300005436 Ga0070713_100107442 Ga0070713_1001074423 152
106 3300005437 Ga0070710_10498580 Ga0070710_104985802 152
107 3300005445 Ga0070708_101003119 Ga0070708_1010031191 152
108 3300005459 Ga0068867_100074466 Ga0068867_1000744662 152
109 3300005518 Ga0070699_100128730 Ga0070699_1001287302 152
110 3300005518 Ga0070699_100237719 Ga0070699_1002377192 152
111 3300005536 Ga0070697_101211691 Ga0070697_1012116911 152
112 3300005842 Ga0068858_101323805 Ga0068858_1013238052 152
113 3300006880 Ga0075429_100552876 Ga0075429_1005528762 152
114 3300006880 Ga0075429_100720255 Ga0075429_1007202552 152
115 3300011119 Ga0105246_10238188 Ga0105246_102381882 152
116 3300013297 Ga0157378_10006966 Ga0157378_100069662 152
117 3300014325 Ga0163163_11015063 Ga0163163_110150632 152
118 3300017792 Ga0163161_10008665 Ga0163161_100086654 152
119 3300021361 Ga0213872_10039054 Ga0213872_100390543 152
120 3300025898 Ga0207692_10331154 Ga0207692_103311542 152
121 3300025928 Ga0207700_10115202 Ga0207700_101152021 152
122 3300026035 Ga0207703_11242230 Ga0207703_112422302 152
123 3300039447 Ga0436361_0485637 Ga0436361_0485637_8976_9461 152
124 3300042876 Ga0451577_0739510 Ga0451577_0739510_329_808 152
125 3300044673 Ga0453683_0012908 Ga0453683_0012908_1246_1722 152
126 3300044712 Ga0453684_0024673 Ga0453684_0024673_4482_4961 152
127 3300044712 Ga0453684_0118749 Ga0453684_0118749_1599_2078 152
128 3300044712 Ga0453684_0184887 Ga0453684_0184887_1151_1636 152
129 3300044712 Ga0453684_0487902 Ga0453684_0487902_468_947 152
130 3300045051 Ga0451576_0000115 Ga0451576_0000115_118097_118573 152
131 3300045051 Ga0451576_0025050 Ga0451576_0025050_2265_2744 152
132 3300046492 Ga0495585_0124669 Ga0495585_0124669_803_1273 152
133 3300049588 Ga0501072_0591610 Ga0501072_0591610_329_808 152
134 3300050508 nmdc:mga09592_54790_c1 nmdc:mga09592_54790_c1_312_800 152
135 3300050508 nmdc:mga09592_868352_c1 nmdc:mga09592_868352_c1_98_592 152
136 3300050510 nmdc:mga06r32_1872_c1 nmdc:mga06r32_1872_c1_14788_15276 152
137 3300046471 Ga0495650_0000037 Ga0495650_0000037_372851_373369 153
138 3300046524 Ga0495648_0110521 Ga0495648_0110521_159_677 153
139 3300049743 Ga0501081_0093721 Ga0501081_0093721_116_577 153
140 3300049824 Ga0501045_0274146 Ga0501045_0274146_533_994 153
141 3300050509 nmdc:mga0qj67_197673_c1 nmdc:mga0qj67_197673_c1_536_997 153
142 3300053093 Ga0500651_0000007 Ga0500651_0000007_144317_144835 153
143 3300005293 Ga0065715_10170445 Ga0065715_101704451 154
144 3300005335 Ga0070666_10051723 Ga0070666_100517233 154
145 3300005338 Ga0068868_100187245 Ga0068868_1001872452 154
146 3300005439 Ga0070711_100232798 Ga0070711_1002327982 154
147 3300005439 Ga0070711_100499916 Ga0070711_1004999162 154
148 3300005545 Ga0070695_100322348 Ga0070695_1003223482 154
149 3300005548 Ga0070665_100006263 Ga0070665_1000062632 154
150 3300005614 Ga0068856_100764584 Ga0068856_1007645842 154
151 3300005618 Ga0068864_100046294 Ga0068864_1000462943 154
152 3300005841 Ga0068863_100025362 Ga0068863_1000253622 154
153 3300006237 Ga0097621_100809897 Ga0097621_1008098972 154
154 3300006358 Ga0068871_100161251 Ga0068871_1001612513 154
155 3300006358 Ga0068871_101023913 Ga0068871_1010239132 154
156 3300006880 Ga0075429_100581996 Ga0075429_1005819962 154
157 3300006931 Ga0097620_100029205 Ga0097620_1000292054 154
158 3300009094 Ga0111539_10300653 Ga0111539_103006532 154
159 3300009147 Ga0114129_11264438 Ga0114129_112644381 154
160 3300009177 Ga0105248_10012948 Ga0105248_100129484 154
161 3300009545 Ga0105237_11433080 Ga0105237_114330801 154
162 3300013105 Ga0157369_11412237 Ga0157369_114122372 154
163 3300013296 Ga0157374_10007330 Ga0157374_100073304 154
164 3300013306 Ga0163162_10009265 Ga0163162_100092653 154
165 3300013306 Ga0163162_10825597 Ga0163162_108255972 154
166 3300013308 Ga0157375_10510377 Ga0157375_105103772 154
167 3300013308 Ga0157375_12534601 Ga0157375_125346012 154
168 3300014969 Ga0157376_10026521 Ga0157376_100265213 154
169 3300021361 Ga0213872_10008366 Ga0213872_100083664 154
170 3300021441 Ga0213871_10006972 Ga0213871_100069721 154
171 3300025903 Ga0207680_10562859 Ga0207680_105628592 154
172 3300025925 Ga0207650_10060184 Ga0207650_100601842 154
173 3300025931 Ga0207644_10017826 Ga0207644_100178262 154
174 3300025941 Ga0207711_10024373 Ga0207711_100243737 154
175 3300025986 Ga0207658_10025063 Ga0207658_100250635 154
176 3300026078 Ga0207702_10483306 Ga0207702_104833062 154
177 3300026088 Ga0207641_10031834 Ga0207641_100318343 154
178 3300026095 Ga0207676_10102037 Ga0207676_101020373 154
179 3300026118 Ga0207675_100630060 Ga0207675_1006300602 154
180 3300028379 Ga0268266_10000440 Ga0268266_1000044019 154
181 3300028379 Ga0268266_10372357 Ga0268266_103723572 154
182 3300028380 Ga0268265_10698652 Ga0268265_106986522 154
183 3300031344 Ga0265316_10748094 Ga0265316_107480942 154
184 3300035692 Ga0373935_0340983 Ga0373935_0340983_122_598 154
185 3300039437 Ga0436365_0314158 Ga0436365_0314158_78_572 154
186 3300039438 Ga0436360_0544773 Ga0436360_0544773_583_1080 154
187 3300039438 Ga0436360_1325334 Ga0436360_1325334_800_1300 154
188 3300039447 Ga0436361_0166848 Ga0436361_0166848_5740_6237 154
189 3300039447 Ga0436361_0395455 Ga0436361_0395455_251_745 154
190 3300039447 Ga0436361_0574976 Ga0436361_0574976_494_994 154
191 3300039447 Ga0436361_0606984 Ga0436361_0606984_573_1070 154
192 3300039453 Ga0436362_1018355 Ga0436362_1018355_64_561 154
193 3300045976 Ga0466967_1501997 Ga0466967_1501997_58_546 154
194 3300046454 Ga0495592_0078770 Ga0495592_0078770_908_1384 154
195 3300046455 Ga0495603_0002230 Ga0495603_0002230_5443_5919 154
196 3300046455 Ga0495603_0128787 Ga0495603_0128787_412_888 154
197 3300046459 Ga0495629_0007912 Ga0495629_0007912_1508_1984 154
198 3300046462 Ga0495651_0006278 Ga0495651_0006278_2845_3321 154
199 3300046463 Ga0495653_0038396 Ga0495653_0038396_1064_1540 154
200 3300046472 Ga0495580_0140599 Ga0495580_0140599_1087_1563 154
201 3300046472 Ga0495580_0210668 Ga0495580_0210668_348_824 154
202 3300046473 Ga0495582_0001434 Ga0495582_0001434_7849_8325 154
203 3300046475 Ga0495639_0006870 Ga0495639_0006870_2710_3186 154
204 3300046476 Ga0495662_0065399 Ga0495662_0065399_742_1218 154
205 3300046476 Ga0495662_0425316 Ga0495662_0425316_31_507 154
206 3300046492 Ga0495585_0021629 Ga0495585_0021629_3107_3583 154
207 3300046499 Ga0495594_0000839 Ga0495594_0000839_1450_1926 154
208 3300046499 Ga0495594_0001127 Ga0495594_0001127_11211_11687 154
209 3300046499 Ga0495594_0004163 Ga0495594_0004163_234_710 154
210 3300046500 Ga0495596_0054970 Ga0495596_0054970_179_655 154
211 3300046506 Ga0495583_0065991 Ga0495583_0065991_763_1239 154
212 3300046507 Ga0495606_0041414 Ga0495606_0041414_2538_3014 154
213 3300046514 Ga0495618_0146636 Ga0495618_0146636_722_1198 154
214 3300046516 Ga0495628_0015773 Ga0495628_0015773_201_677 154
215 3300046517 Ga0495630_0009529 Ga0495630_0009529_3704_4180 154
216 3300046523 Ga0495644_0000393 Ga0495644_0000393_3723_4199 154
217 3300046526 Ga0495666_0001694 Ga0495666_0001694_2432_2908 154
218 3300046529 Ga0495652_0017097 Ga0495652_0017097_5112_5588 154
219 3300046531 Ga0495665_0000838 Ga0495665_0000838_9782_10258 154
220 3300046531 Ga0495665_0079519 Ga0495665_0079519_229_705 154
221 3300046533 Ga0495640_0114442 Ga0495640_0114442_407_883 154
222 3300046535 Ga0495586_0051505 Ga0495586_0051505_1184_1660 154
223 3300046557 Ga0495622_0028618 Ga0495622_0028618_92_568 154
224 3300046557 Ga0495622_0111537 Ga0495622_0111537_658_1134 154
225 3300046558 Ga0495633_0033688 Ga0495633_0033688_1604_2080 154
226 3300046559 Ga0495667_0006547 Ga0495667_0006547_4120_4596 154
227 3300046642 Ga0495634_0002918 Ga0495634_0002918_8409_8885 154
228 3300046648 Ga0495611_0086193 Ga0495611_0086193_199_675 154
229 3300046660 Ga0495625_0128029 Ga0495625_0128029_15_491 154
230 3300046663 Ga0495635_0009459 Ga0495635_0009459_1731_2207 154
231 3300046678 Ga0495599_0061880 Ga0495599_0061880_424_900 154
232 3300046679 Ga0495623_0190352 Ga0495623_0190352_292_768 154
233 3300046680 Ga0495646_0010103 Ga0495646_0010103_1772_2248 154
234 3300046684 Ga0495669_0017288 Ga0495669_0017288_559_1035 154
235 3300046689 Ga0495613_0025091 Ga0495613_0025091_690_1166 154
236 3300046690 Ga0495624_0026452 Ga0495624_0026452_2870_3346 154
237 3300046690 Ga0495624_0806879 Ga0495624_0806879_12_488 154
238 3300046691 Ga0495670_0287892 Ga0495670_0287892_23_499 154
239 3300046694 Ga0495649_0091149 Ga0495649_0091149_677_1153 154
240 3300046809 Ga0495600_0007082 Ga0495600_0007082_3639_4115 154
241 3300047315 Ga0495581_0046963 Ga0495581_0046963_1016_1492 154
242 3300047317 Ga0495604_0075023 Ga0495604_0075023_422_898 154
243 3300047318 Ga0495636_0020358 Ga0495636_0020358_1283_1759 154
244 3300047319 Ga0495674_0010635 Ga0495674_0010635_4752_5228 154
245 3300047320 Ga0495672_0007501 Ga0495672_0007501_2035_2511 154
246 3300047320 Ga0495672_0023708 Ga0495672_0023708_2583_3059 154
247 3300047321 Ga0495676_0011108 Ga0495676_0011108_1598_2074 154
248 3300047322 Ga0495680_0021995 Ga0495680_0021995_1440_1916 154
249 3300047323 Ga0495683_0054818 Ga0495683_0054818_843_1319 154
250 3300047444 Ga0495675_0001482 Ga0495675_0001482_5251_5727 154
251 3300047445 Ga0495677_0051145 Ga0495677_0051145_222_698 154
252 3300047471 Ga0495684_0002721 Ga0495684_0002721_13080_13556 154
253 3300047673 Ga0495593_0099545 Ga0495593_0099545_332_808 154
254 3300048088 Ga0495602_0696326 Ga0495602_0696326_20_496 154
255 3300048089 Ga0495614_0000866 Ga0495614_0000866_3945_4421 154
256 3300050508 nmdc:mga09592_155266_c1 nmdc:mga09592_155266_c1_282_749 154
257 3300050511 nmdc:mga08y16_953187_c1 nmdc:mga08y16_953187_c1_27_500 154
258 3300059421 Ga0590071_001392 Ga0590071_001392_1944_2444 154
259 3300003203 JGI25406J46586_10074123 JGI25406J46586_100741232 155
260 3300005293 Ga0065715_10524730 Ga0065715_105247302 155
261 3300005295 Ga0065707_10003154 Ga0065707_100031543 155
262 3300005328 Ga0070676_10205138 Ga0070676_102051382 155
263 3300005328 Ga0070676_10437815 Ga0070676_104378152 155
264 3300005338 Ga0068868_100348181 Ga0068868_1003481811 155
265 3300005343 Ga0070687_100013906 Ga0070687_1000139063 155
266 3300005437 Ga0070710_10853164 Ga0070710_108531642 155
267 3300005438 Ga0070701_10105960 Ga0070701_101059603 155
268 3300005438 Ga0070701_10198888 Ga0070701_101988882 155
269 3300005444 Ga0070694_100049074 Ga0070694_1000490742 155
270 3300005467 Ga0070706_100052317 Ga0070706_1000523173 155
271 3300005468 Ga0070707_100030561 Ga0070707_1000305612 155
272 3300005471 Ga0070698_100003853 Ga0070698_10000385313 155
273 3300005518 Ga0070699_100005101 Ga0070699_1000051011 155
274 3300005530 Ga0070679_101265870 Ga0070679_1012658701 155
275 3300005536 Ga0070697_100002727 Ga0070697_1000027273 155
276 3300005544 Ga0070686_100083350 Ga0070686_1000833502 155
277 3300005545 Ga0070695_100559373 Ga0070695_1005593732 155
278 3300005545 Ga0070695_101239236 Ga0070695_1012392361 155
279 3300005547 Ga0070693_100021574 Ga0070693_1000215743 155
280 3300005547 Ga0070693_100037766 Ga0070693_1000377663 155
281 3300005549 Ga0070704_100054940 Ga0070704_1000549401 155
282 3300005564 Ga0070664_100189795 Ga0070664_1001897952 155
283 3300005577 Ga0068857_100839020 Ga0068857_1008390201 155
284 3300005577 Ga0068857_101667825 Ga0068857_1016678251 155
285 3300005578 Ga0068854_100124041 Ga0068854_1001240412 155
286 3300005578 Ga0068854_100564931 Ga0068854_1005649312 155
287 3300005615 Ga0070702_100357994 Ga0070702_1003579941 155
288 3300005617 Ga0068859_100291979 Ga0068859_1002919792 155
289 3300005618 Ga0068864_100285158 Ga0068864_1002851583 155
290 3300005840 Ga0068870_10273848 Ga0068870_102738482 155
291 3300005842 Ga0068858_101462979 Ga0068858_1014629791 155
292 3300005843 Ga0068860_100459422 Ga0068860_1004594221 155
293 3300005985 Ga0081539_10000073 Ga0081539_1000007336 155
294 3300005985 Ga0081539_10001769 Ga0081539_100017694 155
295 3300006173 Ga0070716_100015178 Ga0070716_1000151785 155
296 3300006844 Ga0075428_100013870 Ga0075428_1000138704 155
297 3300006846 Ga0075430_100079454 Ga0075430_1000794543 155
298 3300006852 Ga0075433_10126407 Ga0075433_101264072 155
299 3300006871 Ga0075434_100234399 Ga0075434_1002343992 155
300 3300006871 Ga0075434_100377618 Ga0075434_1003776182 155
301 3300006880 Ga0075429_100116014 Ga0075429_1001160142 155
302 3300006931 Ga0097620_100291988 Ga0097620_1002919882 155
303 3300007265 Ga0099794_10027367 Ga0099794_100273673 155
304 3300009094 Ga0111539_10069447 Ga0111539_100694472 155
305 3300009174 Ga0105241_11471270 Ga0105241_114712701 155
306 3300009176 Ga0105242_10000702 Ga0105242_1000070214 155
307 3300009553 Ga0105249_13287216 Ga0105249_132872161 155
308 3300011119 Ga0105246_10443944 Ga0105246_104439442 155
309 3300013297 Ga0157378_10030872 Ga0157378_100308722 155
310 3300013297 Ga0157378_10083798 Ga0157378_100837982 155
311 3300013297 Ga0157378_10583973 Ga0157378_105839733 155
312 3300013306 Ga0163162_10012037 Ga0163162_100120376 155
313 3300013306 Ga0163162_10075476 Ga0163162_100754762 155
314 3300014326 Ga0157380_10010347 Ga0157380_100103475 155
315 3300014326 Ga0157380_10025489 Ga0157380_100254892 155
316 3300014326 Ga0157380_10070478 Ga0157380_100704782 155
317 3300014326 Ga0157380_10104853 Ga0157380_101048533 155
318 3300014326 Ga0157380_10728758 Ga0157380_107287581 155
319 3300014745 Ga0157377_10045892 Ga0157377_100458922 155
320 3300017792 Ga0163161_10035467 Ga0163161_100354671 155
321 3300021384 Ga0213876_10072605 Ga0213876_100726052 155
322 3300025315 Ga0207697_10050408 Ga0207697_100504081 155
323 3300025899 Ga0207642_10026910 Ga0207642_100269102 155
324 3300025921 Ga0207652_11094051 Ga0207652_110940511 155
325 3300025933 Ga0207706_10329594 Ga0207706_103295942 155
326 3300025933 Ga0207706_11252019 Ga0207706_112520192 155
327 3300025934 Ga0207686_10000802 Ga0207686_100008027 155
328 3300025937 Ga0207669_10386762 Ga0207669_103867622 155
329 3300025939 Ga0207665_10005680 Ga0207665_100056809 155
330 3300025939 Ga0207665_10440530 Ga0207665_104405302 155
331 3300025945 Ga0207679_10554113 Ga0207679_105541132 155
332 3300025981 Ga0207640_10552693 Ga0207640_105526932 155
333 3300026035 Ga0207703_10099696 Ga0207703_100996961 155
334 3300026095 Ga0207676_10889600 Ga0207676_108896001 155
335 3300026116 Ga0207674_11702253 Ga0207674_117022531 155
336 3300027907 Ga0207428_11118273 Ga0207428_111182731 155
337 3300028381 Ga0268264_10992860 Ga0268264_109928602 155
338 3300031239 Ga0265328_10032385 Ga0265328_100323852 155
339 3300031250 Ga0265331_10009788 Ga0265331_100097883 155
340 3300031344 Ga0265316_10003739 Ga0265316_1000373910 155
341 3300031456 Ga0307513_10003044 Ga0307513_100030446 155
342 3300031548 Ga0307408_100190767 Ga0307408_1001907672 155
343 3300031711 Ga0265314_10052212 Ga0265314_100522123 155
344 3300032126 Ga0307415_100718220 Ga0307415_1007182202 155
345 3300035724 Ga0373933_0250326 Ga0373933_0250326_528_1031 155
346 3300036401 Ga0373937_0805582 Ga0373937_0805582_301_804 155
347 3300039437 Ga0436365_1663893 Ga0436365_1663893_2073_2588 155
348 3300039437 Ga0436365_1761339 Ga0436365_1761339_409_900 155
349 3300044842 Ga0466957_0110750 Ga0466957_0110750_873_1367 155
350 3300046462 Ga0495651_0145561 Ga0495651_0145561_839_1321 155
351 3300046477 Ga0495664_0362461 Ga0495664_0362461_76_552 155
352 3300046511 Ga0495608_0007147 Ga0495608_0007147_744_1247 155
353 3300046514 Ga0495618_0335042 Ga0495618_0335042_169_642 155
354 3300046516 Ga0495628_0005772 Ga0495628_0005772_7184_7687 155
355 3300046517 Ga0495630_0030541 Ga0495630_0030541_211_714 155
356 3300046536 Ga0495587_0180264 Ga0495587_0180264_115_618 155
357 3300046539 Ga0495621_0103751 Ga0495621_0103751_242_724 155
358 3300046559 Ga0495667_0024707 Ga0495667_0024707_1394_1897 155
359 3300046675 Ga0495657_0036912 Ga0495657_0036912_1529_2032 155
360 3300046678 Ga0495599_0243953 Ga0495599_0243953_240_743 155
361 3300046684 Ga0495669_0163874 Ga0495669_0163874_36_506 155
362 3300047319 Ga0495674_0080449 Ga0495674_0080449_662_1165 155
363 3300047444 Ga0495675_0272401 Ga0495675_0272401_331_834 155
364 3300047471 Ga0495684_0035908 Ga0495684_0035908_1922_2425 155
365 3300047471 Ga0495684_0285231 Ga0495684_0285231_444_917 155
366 3300048905 Ga0496102_0397588 Ga0496102_0397588_84_557 155
367 3300048907 Ga0496104_0097599 Ga0496104_0097599_671_1138 155
368 3300048907 Ga0496104_0598078 Ga0496104_0598078_120_587 155
369 3300048912 Ga0496109_0507186 Ga0496109_0507186_176_643 155
370 3300048913 Ga0496110_0496046 Ga0496110_0496046_19_486 155
371 3300048915 Ga0496112_0386573 Ga0496112_0386573_444_911 155
372 3300048915 Ga0496112_0447231 Ga0496112_0447231_546_1013 155
373 3300048917 Ga0496114_0223310 Ga0496114_0223310_951_1511 155
374 3300050507 nmdc:mga05p37_1405447_c1 nmdc:mga05p37_1405447_c1_131_598 155
375 3300050509 nmdc:mga0qj67_72099_c1 nmdc:mga0qj67_72099_c1_167_649 155
376 3300050510 nmdc:mga06r32_65926_c1 nmdc:mga06r32_65926_c1_2062_2544 155
377 3300050511 nmdc:mga08y16_62675_c1 nmdc:mga08y16_62675_c1_2625_3101 155
378 3300050512 nmdc:mga0n895_1264160_c1 nmdc:mga0n895_1264160_c1_120_587 155
379 3300050512 nmdc:mga0n895_227334_c1 nmdc:mga0n895_227334_c1_226_693 155
380 3300050512 nmdc:mga0n895_344597_c1 nmdc:mga0n895_344597_c1_635_1105 155
381 3300050512 nmdc:mga0n895_53075_c1 nmdc:mga0n895_53075_c1_895_1362 155
382 3300050513 nmdc:mga0rr50_1226_c1 nmdc:mga0rr50_1226_c1_6172_6642 155
383 3300050514 nmdc:mga08x19_9_c1 nmdc:mga08x19_9_c1_306994_307464 155
384 3300050515 nmdc:mga0a205_334433_c1 nmdc:mga0a205_334433_c1_298_765 155
385 3300050515 nmdc:mga0a205_927717_c1 nmdc:mga0a205_927717_c1_15_521 155
386 3300053084 Ga0495595_0659560 Ga0495595_0659560_21_494 155
387 3300005366 Ga0070659_100367747 Ga0070659_1003677472 156
388 3300048908 Ga0496105_1068126 Ga0496105_1068126_30_512 156
389 3300005290 Ga0065712_10004575 Ga0065712_100045752 157
390 3300005293 Ga0065715_10341685 Ga0065715_103416852 157
391 3300005356 Ga0070674_100179929 Ga0070674_1001799292 157
392 3300005456 Ga0070678_100696518 Ga0070678_1006965182 157
393 3300025937 Ga0207669_10062151 Ga0207669_100621513 157
394 3300049584 Ga0501068_0187784 Ga0501068_0187784_531_1010 157
395 3300049589 Ga0501073_0139640 Ga0501073_0139640_140_619 157
396 3300049593 Ga0501077_0133441 Ga0501077_0133441_298_777 157
397 3300054114 Ga0501084_0647964 Ga0501084_0647964_63_542 157
398 3300026075 Ga0207708_10000061 Ga0207708_1000006173 169
399 3300005458 Ga0070681_10307337 Ga0070681_103073372 171
400 3300005530 Ga0070679_100220943 Ga0070679_1002209431 171
401 3300046691 Ga0495670_0507676 Ga0495670_0507676_46_645 171
402 3300005345 Ga0070692_10076066 Ga0070692_100760662 172
403 3300005444 Ga0070694_100018893 Ga0070694_1000188932 172
404 3300047443 Ga0495687_000631 Ga0495687_000631_27722_28357 173
405 iso_pu_bacteria 2929177148 2929179068 173
406 iso_pu_bacteria 2945977869 2945981472 173
407 iso_pu_bacteria 2946013367 2946019125 173
408 3300003214 JGI25165J46597_1005592 JGI25165J46597_10055922 174
409 3300004799 Ga0058863_11863732 Ga0058863_118637321 174
410 3300004800 Ga0058861_11841167 Ga0058861_118411673 174
411 3300005288 Ga0065714_10005661 Ga0065714_100056614 174
412 3300005563 Ga0068855_100000302 Ga0068855_10000030225 174
413 3300005577 Ga0068857_101035045 Ga0068857_1010350451 174
414 3300005614 Ga0068856_100048208 Ga0068856_1000482083 174
415 3300005614 Ga0068856_100079877 Ga0068856_1000798772 174
416 3300005616 Ga0068852_100053265 Ga0068852_1000532653 174
417 3300005842 Ga0068858_100158850 Ga0068858_1001588502 174
418 3300006195 Ga0075366_10000091 Ga0075366_1000009138 174
419 3300009093 Ga0105240_10108640 Ga0105240_101086403 174
420 3300009093 Ga0105240_10200078 Ga0105240_102000783 174
421 3300009174 Ga0105241_10395811 Ga0105241_103958112 174
422 3300009545 Ga0105237_10052550 Ga0105237_100525505 174
423 3300010375 Ga0105239_10051076 Ga0105239_100510763 174
424 3300025233 Ga0209437_100021 Ga0209437_100021397 174
425 3300025261 Ga0209233_1000035 Ga0209233_1000035241 174
426 3300025272 Ga0209455_1001461 Ga0209455_10014615 174
427 3300025912 Ga0207707_10234694 Ga0207707_102346941 174
428 3300025913 Ga0207695_10038967 Ga0207695_100389673 174
429 3300025913 Ga0207695_10233133 Ga0207695_102331331 174
430 3300025914 Ga0207671_10393367 Ga0207671_103933671 174
431 3300025924 Ga0207694_10606393 Ga0207694_106063931 174
432 3300025949 Ga0207667_10000033 Ga0207667_10000033223 174
433 3300025949 Ga0207667_10001090 Ga0207667_1000109025 174
434 3300026035 Ga0207703_10134495 Ga0207703_101344952 174
435 3300026078 Ga0207702_10043172 Ga0207702_100431723 174
436 3300026116 Ga0207674_10403111 Ga0207674_104031112 174
437 3300026142 Ga0207698_10081762 Ga0207698_100817622 174
438 3300028794 Ga0307515_10000790 Ga0307515_1000079066 174
439 3300028794 Ga0307515_10001565 Ga0307515_1000156516 174
440 3300031507 Ga0307509_10108016 Ga0307509_101080162 174
441 3300033179 Ga0307507_10000143 Ga0307507_1000014362 174
442 3300044735 Ga0466968_0098360 Ga0466968_0098360_214_858 174
443 3300046454 Ga0495592_0484647 Ga0495592_0484647_79_723 174
444 3300046462 Ga0495651_0157313 Ga0495651_0157313_782_1426 174
445 3300046492 Ga0495585_0000648 Ga0495585_0000648_25826_26470 174
446 3300046516 Ga0495628_0068745 Ga0495628_0068745_717_1361 174
447 3300046524 Ga0495648_0009801 Ga0495648_0009801_2469_3113 174
448 3300046524 Ga0495648_0097078 Ga0495648_0097078_600_1244 174
449 3300046528 Ga0495642_0143508 Ga0495642_0143508_150_794 174
450 3300046530 Ga0495654_0009974 Ga0495654_0009974_839_1483 174
451 3300046538 Ga0495609_0013463 Ga0495609_0013463_3109_3753 174
452 3300046558 Ga0495633_0000275 Ga0495633_0000275_32062_32706 174
453 3300046616 Ga0495668_0000017 Ga0495668_0000017_237165_237809 174
454 3300046660 Ga0495625_0000435 Ga0495625_0000435_49705_50349 174
455 3300046660 Ga0495625_0003324 Ga0495625_0003324_3277_3921 174
456 3300046683 Ga0495658_0253797 Ga0495658_0253797_81_725 174
457 3300048928 Ga0496125_0428811 Ga0496125_0428811_35_658 174
458 3300049460 Ga0495682_0015552 Ga0495682_0015552_1284_1928 174
459 3300050493 nmdc:mga0k408_490_c1 nmdc:mga0k408_490_c1_19154_19798 174
460 3300053123 Ga0500614_021027 Ga0500614_021027_242_886 174
461 3300053125 Ga0500618_000015 Ga0500618_000015_42550_43227 174
462 3300055283 Ga0500661_010756 Ga0500661_010756_324_947 174
463 3300000532 CNAas_1000205 CNAas_10002052 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

104

178

0.96

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

36

103

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9641 23 176
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9618 27 176
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9594 27 176
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9589 27 176
5y6q-assembly1.cif.gz_A crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9548 26 176
ID Description Score Start End Superfamily
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9705 26 101 3.10.20.30
3hrdH02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9658 103 176 1.10.150.120
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9654 27 101 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9607 25 101 3.10.20.30
1alo001 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.959 27 98 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A147FML1-F1-model_v4 deleted 0.9808 25 176
AF-A0A0J6RRZ5-F1-model_v4 deleted 0.98 25 176
AF-A0A538BUE3-F1-model_v4 (2Fe-2S)-binding protein 0.9787 27 177 GO:0016491
GO:0046872
GO:0051537
AF-A0A534SI03-F1-model_v4 (2Fe-2S)-binding protein 0.9781 25 176 GO:0016491
GO:0046872
GO:0051537
AF-A0A3S2V5D0-F1-model_v4 (2Fe-2S)-binding protein 0.9781 28 176 GO:0016491
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
90.59 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map