F449166

General Info

Members Datasets Scaffolds Average Seq Length
463 172 926 126

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0003807|Ga0495580_0003807_5229_5678
Length 149
Sequence LRSGALRPSRSWAPAGRVAPNNQEVAMFKPLGLDHIVLRVRDQEKSRRFYEDVLGCTLAKFNERISLIHLRFGEALIDLLPATEAGPVGPDHFCLSIHCDDLKAVAEELRRKAVSVEGDVVQRFGAWGDGPSIYLRDPDGHMIELKPRL

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
109 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
110 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
111 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
112 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
113 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
114 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
118 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
119 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
120 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
123 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
127 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
130 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
147 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.43
Rhizosphere 99.57
Stem 0
Stem Tuber 0
Unclassified 17.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0003807 3300046472 Bacteria 12780
2 Ga0065704_10782883 3300005289 Unclassified 525
3 Ga0065707_10129538 3300005295 Bacteria 1946
4 Ga0065707_10172836 3300005295 Bacteria 1468
5 Ga0065707_10179611 3300005295 Bacteria 1427
6 Ga0070676_10100946 3300005328 Bacteria 1782
7 Ga0070690_100108658 3300005330 Bacteria 1848
8 Ga0070690_100380780 3300005330 Bacteria 1031
9 Ga0070690_100825297 3300005330 Bacteria 721
10 Ga0068869_100492732 3300005334 Bacteria 1022
11 Ga0070680_100026106 3300005336 Bacteria 4672
12 Ga0070680_101246646 3300005336 Bacteria 643
13 Ga0070689_100358371 3300005340 Bacteria 1225
14 Ga0070691_10011361 3300005341 Bacteria 4066
15 Ga0070691_10272514 3300005341 Bacteria 915
16 Ga0070687_100116292 3300005343 Bacteria 1522
17 Ga0070687_100273540 3300005343 Bacteria 1060
18 Ga0070692_10053675 3300005345 Unclassified 2102
19 Ga0070668_100032425 3300005347 Bacteria 3976
20 Ga0070667_101008864 3300005367 Unclassified 777
21 Ga0070703_10034830 3300005406 Bacteria 1539
22 Ga0070701_10056499 3300005438 Bacteria 2054
23 Ga0070701_10112449 3300005438 Unclassified 1523
24 Ga0070705_100004256 3300005440 Bacteria 6987
25 Ga0070705_100548062 3300005440 Bacteria 886
26 Ga0070700_100168516 3300005441 Bacteria 1515
27 Ga0070700_100805311 3300005441 Unclassified 757
28 Ga0070694_100069117 3300005444 Bacteria 2429
29 Ga0070694_100116335 3300005444 Bacteria 1912
30 Ga0070694_101226935 3300005444 Bacteria 629
31 Ga0070708_100048551 3300005445 Bacteria 3752
32 Ga0070708_100601713 3300005445 Bacteria 1036
33 Ga0068867_100252315 3300005459 Unclassified 1435
34 Ga0068867_100716165 3300005459 Bacteria 885
35 Ga0070706_100578947 3300005467 Unclassified 1044
36 Ga0070706_101345952 3300005467 Bacteria 654
37 Ga0070706_101771907 3300005467 Bacteria 562
38 Ga0070707_100955582 3300005468 Bacteria 822
39 Ga0070698_100102198 3300005471 Bacteria 2838
40 Ga0070699_100004758 3300005518 Bacteria 12000
41 Ga0070699_100062672 3300005518 Bacteria 3223
42 Ga0070699_100108594 3300005518 Bacteria 2435
43 Ga0070699_100335057 3300005518 Bacteria 1361
44 Ga0070699_100524137 3300005518 Bacteria 1077
45 Ga0070699_100652324 3300005518 Bacteria 961
46 Ga0070697_100006314 3300005536 Bacteria 9174
47 Ga0070697_100137695 3300005536 Bacteria 2051
48 Ga0070697_100204065 3300005536 Bacteria 1681
49 Ga0070672_100358518 3300005543 Unclassified 1244
50 Ga0070686_100311365 3300005544 Unclassified 1171
51 Ga0070695_100325371 3300005545 Bacteria 1144
52 Ga0070695_100359112 3300005545 Bacteria 1093
53 Ga0070696_100774583 3300005546 Bacteria 788
54 Ga0070693_100494829 3300005547 Bacteria 866
55 Ga0070704_100185779 3300005549 Unclassified 1666
56 Ga0070704_100369151 3300005549 Unclassified 1216
57 Ga0070704_101079049 3300005549 Bacteria 729
58 Ga0068857_100027448 3300005577 Bacteria 5022
59 Ga0068857_100357370 3300005577 Bacteria 1354
60 Ga0068857_100578597 3300005577 Bacteria 1060
61 Ga0070702_100745440 3300005615 Bacteria 751
62 Ga0068859_100020049 3300005617 Bacteria 6714
63 Ga0068859_100166148 3300005617 Unclassified 2287
64 Ga0068859_100202774 3300005617 Bacteria 2068
65 Ga0068864_100735870 3300005618 Bacteria 966
66 Ga0068866_10159754 3300005718 Unclassified 1313
67 Ga0068866_10278762 3300005718 Bacteria 1035
68 Ga0068866_10871894 3300005718 Unclassified 631
69 Ga0068861_100494970 3300005719 Bacteria 1104
70 Ga0068861_100654762 3300005719 Bacteria 971
71 Ga0068870_10048720 3300005840 Unclassified 2232
72 Ga0068863_100600789 3300005841 Bacteria 1089
73 Ga0068863_100636810 3300005841 Unclassified 1057
74 Ga0068860_100178646 3300005843 Bacteria 2052
75 Ga0068860_100231403 3300005843 Bacteria 1796
76 Ga0068860_100261054 3300005843 Bacteria 1688
77 Ga0068860_101554660 3300005843 Unclassified 683
78 Ga0068862_100021656 3300005844 Bacteria 5374
79 Ga0068862_100329923 3300005844 Bacteria 1410
80 Ga0068862_100878416 3300005844 Bacteria 880
81 Ga0068862_101550895 3300005844 Bacteria 668
82 Ga0081455_10406630 3300005937 Bacteria 943
83 Ga0081538_10011198 3300005981 Bacteria 7285
84 Ga0081540_1043500 3300005983 Bacteria 2303
85 Ga0075432_10387270 3300006058 Bacteria 601
86 Ga0075428_100007874 3300006844 Bacteria 11813
87 Ga0075428_100072008 3300006844 Bacteria 3777
88 Ga0075428_100295995 3300006844 Unclassified 1740
89 Ga0075428_100594131 3300006844 Bacteria 1182
90 Ga0075428_100785138 3300006844 Bacteria 1013
91 Ga0075428_101297354 3300006844 Bacteria 766
92 Ga0075430_100001198 3300006846 Bacteria 20799
93 Ga0075430_100030104 3300006846 Bacteria 4609
94 Ga0075430_100030178 3300006846 Bacteria 4603
95 Ga0075430_100033303 3300006846 Bacteria 4373
96 Ga0075430_100058406 3300006846 Unclassified 3243
97 Ga0075430_100157649 3300006846 Unclassified 1889
98 Ga0075430_100234245 3300006846 Bacteria 1522
99 Ga0075430_100343904 3300006846 Bacteria 1232
100 Ga0075430_100397671 3300006846 Bacteria 1137
101 Ga0075430_100458301 3300006846 Bacteria 1052
102 Ga0075431_100000348 3300006847 Bacteria 36509
103 Ga0075431_100001551 3300006847 Bacteria 21309
104 Ga0075431_100002031 3300006847 Bacteria 19329
105 Ga0075431_100007916 3300006847 Bacteria 10592
106 Ga0075431_100009120 3300006847 Bacteria 9948
107 Ga0075431_100011496 3300006847 Bacteria 8924
108 Ga0075431_100034330 3300006847 Bacteria 5226
109 Ga0075431_100078630 3300006847 Bacteria 3404
110 Ga0075431_100363352 3300006847 Bacteria 1454
111 Ga0075431_100595493 3300006847 Bacteria 1090
112 Ga0075431_100684368 3300006847 Bacteria 1004
113 Ga0075431_100697241 3300006847 Unclassified 993
114 Ga0075433_10001981 3300006852 Bacteria 15405
115 Ga0075433_10003837 3300006852 Bacteria 11636
116 Ga0075433_10113974 3300006852 Bacteria 2398
117 Ga0075433_10236593 3300006852 Bacteria 1622
118 Ga0075433_11090016 3300006852 Bacteria 695
119 Ga0075433_11519777 3300006852 Bacteria 578
120 Ga0075434_100000103 3300006871 Bacteria 47848
121 Ga0075434_100003343 3300006871 Bacteria 14356
122 Ga0075434_100038534 3300006871 Bacteria 4733
123 Ga0075434_100081259 3300006871 Bacteria 3238
124 Ga0075434_100139541 3300006871 Bacteria 2443
125 Ga0075434_100186610 3300006871 Bacteria 2094
126 Ga0075434_100229612 3300006871 Bacteria 1875
127 Ga0075434_100674404 3300006871 Bacteria 1052
128 Ga0075434_101086775 3300006871 Bacteria 813
129 Ga0075429_100000799 3300006880 Bacteria 24717
130 Ga0075429_100001290 3300006880 Bacteria 20429
131 Ga0075429_100010158 3300006880 Bacteria 8150
132 Ga0075429_100105910 3300006880 Bacteria 2457
133 Ga0075429_100109782 3300006880 Bacteria 2411
134 Ga0075429_100384083 3300006880 Bacteria 1230
135 Ga0075429_100670533 3300006880 Bacteria 908
136 Ga0068865_100103869 3300006881 Bacteria 2085
137 Ga0068865_101787617 3300006881 Unclassified 555
138 Ga0075436_100004968 3300006914 Bacteria 9138
139 Ga0075436_100053913 3300006914 Bacteria 2776
140 Ga0075436_100134652 3300006914 Bacteria 1734
141 Ga0075436_100936942 3300006914 Unclassified 648
142 Ga0097620_100020050 3300006931 Bacteria 6714
143 Ga0097620_100166151 3300006931 Unclassified 2287
144 Ga0097620_100202774 3300006931 Bacteria 2068
145 Ga0075435_100003274 3300007076 Bacteria 10977
146 Ga0075435_100003704 3300007076 Bacteria 10408
147 Ga0075435_100005460 3300007076 Bacteria 8882
148 Ga0075435_100029066 3300007076 Bacteria 4337
149 Ga0075435_100088400 3300007076 Bacteria 2554
150 Ga0075435_100096833 3300007076 Bacteria 2441
151 Ga0075435_100183887 3300007076 Bacteria 1767
152 Ga0075435_100632068 3300007076 Bacteria 929
153 Ga0075435_100879484 3300007076 Bacteria 781
154 Ga0099794_10054805 3300007265 Bacteria 1926
155 Ga0099794_10080519 3300007265 Bacteria 1606
156 Ga0111539_10002907 3300009094 Bacteria 22722
157 Ga0111539_10066031 3300009094 Bacteria 4273
158 Ga0111539_10066685 3300009094 Bacteria 4251
159 Ga0111539_10464298 3300009094 Bacteria 1474
160 Ga0111539_12261738 3300009094 Bacteria 631
161 Ga0105247_10128619 3300009101 Unclassified 1649
162 Ga0114129_10001501 3300009147 Bacteria 31566
163 Ga0114129_10006636 3300009147 Bacteria 16432
164 Ga0114129_10009777 3300009147 Bacteria 13677
165 Ga0114129_10030912 3300009147 Bacteria 7573
166 Ga0114129_10039255 3300009147 Bacteria 6675
167 Ga0114129_10045233 3300009147 Bacteria 6188
168 Ga0114129_10070988 3300009147 Bacteria 4856
169 Ga0114129_10144155 3300009147 Bacteria 3263
170 Ga0114129_10146316 3300009147 Bacteria 3237
171 Ga0114129_10163784 3300009147 Bacteria 3036
172 Ga0114129_10280557 3300009147 Bacteria 2226
173 Ga0114129_10487131 3300009147 Bacteria 1613
174 Ga0114129_10495465 3300009147 Unclassified 1596
175 Ga0114129_10824410 3300009147 Bacteria 1181
176 Ga0114129_10945331 3300009147 Bacteria 1089
177 Ga0114129_11046358 3300009147 Unclassified 1025
178 Ga0114129_11691868 3300009147 Bacteria 772
179 Ga0105243_10046515 3300009148 Bacteria 3414
180 Ga0105243_10318351 3300009148 Bacteria 1416
181 Ga0105243_11187370 3300009148 Unclassified 775
182 Ga0105241_10066051 3300009174 Bacteria 2796
183 Ga0105241_10541771 3300009174 Unclassified 1044
184 Ga0105241_11460545 3300009174 Bacteria 657
185 Ga0105242_10016100 3300009176 Bacteria 5810
186 Ga0105242_10792775 3300009176 Bacteria 937
187 Ga0105242_11012304 3300009176 Unclassified 839
188 Ga0105242_12285184 3300009176 Bacteria 587
189 Ga0105248_10086490 3300009177 Unclassified 3527
190 Ga0105248_11443553 3300009177 Bacteria 779
191 Ga0105249_10006982 3300009553 Bacteria 9849
192 Ga0105249_10077735 3300009553 Bacteria 3078
193 Ga0105249_12745927 3300009553 Unclassified 564
194 Ga0157378_10341708 3300013297 Bacteria 1460
195 Ga0163162_10020436 3300013306 Bacteria 6507
196 Ga0163162_10090006 3300013306 Bacteria 3150
197 Ga0163162_10448077 3300013306 Bacteria 1423
198 Ga0163162_12271128 3300013306 Bacteria 623
199 Ga0157375_10475392 3300013308 Unclassified 1415
200 Ga0157377_11779085 3300014745 Unclassified 500
201 Ga0157379_10279512 3300014968 Bacteria 1519
202 Ga0207653_10197587 3300025885 Bacteria 757
203 Ga0207642_10191351 3300025899 Bacteria 1123
204 Ga0207645_10869995 3300025907 Bacteria 612
205 Ga0207643_10075597 3300025908 Unclassified 1944
206 Ga0207643_10298291 3300025908 Bacteria 1002
207 Ga0207684_10003137 3300025910 Bacteria 16281
208 Ga0207654_10291423 3300025911 Unclassified 1107
209 Ga0207660_10061440 3300025917 Bacteria 2704
210 Ga0207660_10343680 3300025917 Bacteria 1195
211 Ga0207660_11464950 3300025917 Bacteria 552
212 Ga0207662_10151727 3300025918 Bacteria 1474
213 Ga0207646_10538323 3300025922 Bacteria 1051
214 Ga0207681_10046832 3300025923 Bacteria 2909
215 Ga0207659_10715935 3300025926 Bacteria 857
216 Ga0207686_10059790 3300025934 Unclassified 2409
217 Ga0207709_10012945 3300025935 Bacteria 4600
218 Ga0207709_11405029 3300025935 Unclassified 578
219 Ga0207670_10079497 3300025936 Bacteria 2289
220 Ga0207669_10449927 3300025937 Bacteria 1020
221 Ga0207704_10021078 3300025938 Bacteria 3463
222 Ga0207704_11675576 3300025938 Unclassified 547
223 Ga0207711_10031989 3300025941 Bacteria 4445
224 Ga0207711_11715144 3300025941 Bacteria 571
225 Ga0207689_10188408 3300025942 Bacteria 1702
226 Ga0207712_10059681 3300025961 Bacteria 2701
227 Ga0207712_10245209 3300025961 Bacteria 1445
228 Ga0207712_10747003 3300025961 Bacteria 857
229 Ga0207668_10033823 3300025972 Bacteria 3389
230 Ga0207668_10160805 3300025972 Bacteria 1750
231 Ga0207703_10301856 3300026035 Bacteria 1461
232 Ga0207641_10427036 3300026088 Unclassified 1277
233 Ga0207641_10498776 3300026088 Unclassified 1182
234 Ga0207641_10796203 3300026088 Bacteria 935
235 Ga0207648_10012613 3300026089 Bacteria 7907
236 Ga0207648_10165838 3300026089 Unclassified 1952
237 Ga0207648_10458991 3300026089 Bacteria 1161
238 Ga0207676_10958525 3300026095 Unclassified 841
239 Ga0207674_10012454 3300026116 Bacteria 9504
240 Ga0207674_10033553 3300026116 Bacteria 5374
241 Ga0207674_10427160 3300026116 Unclassified 1280
242 Ga0207675_100038395 3300026118 Bacteria 4468
243 Ga0207675_100479502 3300026118 Bacteria 1236
244 Ga0209983_1076762 3300027665 Bacteria 747
245 Ga0209588_1172778 3300027671 Unclassified 679
246 Ga0209971_1058936 3300027682 Bacteria 929
247 Ga0207428_10000682 3300027907 Bacteria 39734
248 Ga0207428_10004521 3300027907 Bacteria 13191
249 Ga0207428_10460932 3300027907 Bacteria 926
250 Ga0268265_10009518 3300028380 Bacteria 6562
251 Ga0268265_10159552 3300028380 Bacteria 1914
252 Ga0268265_10162384 3300028380 Bacteria 1900
253 Ga0268265_10288081 3300028380 Bacteria 1473
254 Ga0268264_10029495 3300028381 Bacteria 4494
255 Ga0268264_11946644 3300028381 Bacteria 597
256 Ga0307408_100008686 3300031548 Bacteria 6709
257 Ga0307408_100163430 3300031548 Bacteria 1770
258 Ga0307408_100242622 3300031548 Bacteria 1482
259 Ga0307408_100285679 3300031548 Bacteria 1376
260 Ga0307408_100497637 3300031548 Unclassified 1066
261 Ga0307408_100565578 3300031548 Bacteria 1005
262 Ga0307408_101392002 3300031548 Bacteria 660
263 Ga0307405_10912230 3300031731 Bacteria 744
264 Ga0307405_11360733 3300031731 Unclassified 619
265 Ga0307410_10108601 3300031852 Unclassified 2004
266 Ga0307406_10114626 3300031901 Bacteria 1862
267 Ga0307406_10190121 3300031901 Bacteria 1502
268 Ga0307406_11044290 3300031901 Bacteria 703
269 Ga0307416_100047037 3300032002 Bacteria 3411
270 Ga0307416_100260610 3300032002 Unclassified 1694
271 Ga0307416_100280765 3300032002 Bacteria 1642
272 Ga0307416_100566935 3300032002 Bacteria 1211
273 Ga0307416_101833972 3300032002 Unclassified 710
274 Ga0307416_102769089 3300032002 Bacteria 586
275 Ga0307411_10439286 3300032005 Bacteria 1089
276 Ga0307411_10439880 3300032005 Bacteria 1088
277 Ga0373929_0012973 3300035085 Bacteria 1591
278 Ga0373940_0000496 3300035088 Bacteria 6132
279 Ga0373949_0068472 3300035090 Bacteria 926
280 Ga0373951_0113914 3300035091 Unclassified 730
281 Ga0373932_0002448 3300035112 Bacteria 4696
282 Ga0373932_0004724 3300035112 Bacteria 3214
283 Ga0373939_0027757 3300035114 Unclassified 1606
284 Ga0373962_0108396 3300035242 Unclassified 873
285 Ga0373962_0129677 3300035242 Bacteria 811
286 Ga0373931_0043773 3300035691 Bacteria 2359
287 Ga0373931_0150148 3300035691 Unclassified 1357
288 Ga0395898_1334105 3300037466 Bacteria 646
289 Ga0242420_094746 3300038996 Unclassified 630
290 Ga0439461_0189423 3300041410 Unclassified 548
291 Ga0439441_021802 3300042001 Bacteria 1186
292 Ga0439460_0162980 3300042461 Bacteria 748
293 Ga0451577_0157422 3300042876 Bacteria 2045
294 Ga0451577_0660490 3300042876 Bacteria 948
295 Ga0439440_0172084 3300042993 Bacteria 630
296 Ga0453683_0691645 3300044673 Bacteria 668
297 Ga0453684_1960588 3300044712 Unclassified 591
298 Ga0451576_0126906 3300045051 Bacteria 2658
299 Ga0451576_0380256 3300045051 Bacteria 1480
300 Ga0451576_0389057 3300045051 Bacteria 1462
301 Ga0451576_0727795 3300045051 Bacteria 1042
302 Ga0451576_2325081 3300045051 Bacteria 549
303 Ga0495584_0148065 3300046491 Bacteria 1193
304 Ga0495584_0511622 3300046491 Bacteria 612
305 Ga0495642_0183330 3300046528 Bacteria 911
306 Ga0495656_0031013 3300046615 Bacteria 2165
307 Ga0495659_0046040 3300046664 Bacteria 1574
308 Ga0495659_0118876 3300046664 Bacteria 1039
309 Ga0495669_0049874 3300046684 Bacteria 1876
310 Ga0495669_0120681 3300046684 Bacteria 1228
311 Ga0495669_0239703 3300046684 Bacteria 870
312 Ga0495670_0264182 3300046691 Bacteria 919
313 Ga0495636_0033680 3300047318 Bacteria 2106
314 Ga0496106_0241819 3300048909 Bacteria 1442
315 Ga0496107_0654735 3300048910 Unclassified 774
316 Ga0501031_0379941 3300049568 Bacteria 914
317 Ga0501033_0275428 3300049570 Bacteria 1189
318 Ga0501033_1141698 3300049570 Unclassified 517
319 Ga0501036_0172624 3300049572 Bacteria 1821
320 Ga0501038_0507925 3300049574 Bacteria 921
321 Ga0501038_1104425 3300049574 Unclassified 579
322 Ga0501039_0079147 3300049575 Bacteria 2557
323 Ga0501039_1228856 3300049575 Bacteria 579
324 Ga0501040_0007385 3300049576 Bacteria 7116
325 Ga0501040_0280052 3300049576 Bacteria 1191
326 Ga0501040_0687370 3300049576 Bacteria 740
327 Ga0501041_0026053 3300049577 Bacteria 3515
328 Ga0501041_0519140 3300049577 Unclassified 758
329 Ga0501042_0071004 3300049578 Bacteria 2491
330 Ga0501042_0249979 3300049578 Unclassified 1279
331 Ga0501042_0258774 3300049578 Bacteria 1256
332 Ga0501042_0333813 3300049578 Bacteria 1096
333 Ga0501043_0142979 3300049579 Bacteria 1873
334 Ga0501046_0126142 3300049580 Bacteria 1944
335 Ga0501046_0543457 3300049580 Bacteria 829
336 Ga0501046_1141630 3300049580 Unclassified 537
337 Ga0501048_0048609 3300049582 Bacteria 3025
338 Ga0501048_0284947 3300049582 Bacteria 1175
339 Ga0501048_0495543 3300049582 Bacteria 876
340 Ga0501067_0680864 3300049583 Unclassified 578
341 Ga0501068_0012151 3300049584 Bacteria 4870
342 Ga0501068_0687084 3300049584 Unclassified 669
343 Ga0501069_0031130 3300049585 Bacteria 2933
344 Ga0501070_0045417 3300049586 Bacteria 3654
345 Ga0501071_0054736 3300049587 Bacteria 2879
346 Ga0501072_0011236 3300049588 Bacteria 6837
347 Ga0501072_0016501 3300049588 Bacteria 5673
348 Ga0501072_0355859 3300049588 Unclassified 1162
349 Ga0501072_0990254 3300049588 Bacteria 655
350 Ga0501074_0197518 3300049590 Unclassified 1434
351 Ga0501074_0546747 3300049590 Bacteria 820
352 Ga0501074_0547478 3300049590 Bacteria 819
353 Ga0501075_0001478 3300049591 Bacteria 15290
354 Ga0501075_0068800 3300049591 Bacteria 2675
355 Ga0501075_0227773 3300049591 Bacteria 1421
356 Ga0501075_0615642 3300049591 Unclassified 828
357 Ga0501075_0763627 3300049591 Bacteria 736
358 Ga0501075_1092867 3300049591 Unclassified 606
359 Ga0501075_1096122 3300049591 Unclassified 605
360 Ga0501076_0018503 3300049592 Bacteria 5313
361 Ga0501076_0048507 3300049592 Bacteria 3356
362 Ga0501076_0669056 3300049592 Bacteria 857
363 Ga0501076_1777214 3300049592 Unclassified 505
364 Ga0501077_0004801 3300049593 Bacteria 8218
365 Ga0501077_0051950 3300049593 Bacteria 2603
366 Ga0501077_0971752 3300049593 Bacteria 546
367 Ga0501079_0001176 3300049741 Bacteria 18328
368 Ga0501079_0009227 3300049741 Bacteria 7472
369 Ga0501079_0311385 3300049741 Bacteria 1232
370 Ga0501079_0670462 3300049741 Bacteria 816
371 Ga0501080_0236125 3300049742 Bacteria 1670
372 Ga0501081_0001330 3300049743 Bacteria 15079
373 Ga0501081_0579757 3300049743 Bacteria 839
374 Ga0501035_0064524 3300049822 Bacteria 3255
375 Ga0501045_0197363 3300049824 Bacteria 1499
376 nmdc:mga05p37_1158924_c1 3300050507 Bacteria 803
377 nmdc:mga05p37_119556_c1 3300050507 Bacteria 3237
378 nmdc:mga05p37_121263_c1 3300050507 Bacteria 3212
379 nmdc:mga05p37_1269943_c1 3300050507 Unclassified 754
380 nmdc:mga05p37_1379_c1 3300050507 Bacteria 28244
381 nmdc:mga05p37_18562_c1 3300050507 Bacteria 8406
382 nmdc:mga05p37_19294_c1 3300050507 Bacteria 8247
383 nmdc:mga05p37_20515_c1 3300050507 Bacteria 7995
384 nmdc:mga05p37_2215183_c1 3300050507 Bacteria 510
385 nmdc:mga05p37_430560_c1 3300050507 Bacteria 1533
386 nmdc:mga05p37_45759_c1 3300050507 Bacteria 5381
387 nmdc:mga05p37_601865_c1 3300050507 Bacteria 1241
388 nmdc:mga05p37_628074_c1 3300050507 Bacteria 1207
389 nmdc:mga05p37_64401_c1 3300050507 Bacteria 4511
390 nmdc:mga05p37_647688_c1 3300050507 Bacteria 1184
391 nmdc:mga05p37_89758_c1 3300050507 Bacteria 3787
392 nmdc:mga09592_100185_c1 3300050508 Bacteria 2481
393 nmdc:mga09592_1040674_c1 3300050508 Unclassified 683
394 nmdc:mga09592_13110_c1 3300050508 Bacteria 6765
395 nmdc:mga09592_160384_c1 3300050508 Bacteria 1943
396 nmdc:mga09592_2871_c1 3300050508 Bacteria 13972
397 nmdc:mga09592_394401_c1 3300050508 Bacteria 1197
398 nmdc:mga09592_402318_c1 3300050508 Bacteria 1183
399 nmdc:mga09592_46174_c1 3300050508 Bacteria 3669
400 nmdc:mga09592_639881_c1 3300050508 Bacteria 909
401 nmdc:mga09592_643553_c1 3300050508 Bacteria 906
402 nmdc:mga0qj67_12530_c1 3300050509 Bacteria 6390
403 nmdc:mga0qj67_130548_c1 3300050509 Unclassified 2035
404 nmdc:mga0qj67_279441_c1 3300050509 Bacteria 1353
405 nmdc:mga0qj67_350923_c1 3300050509 Bacteria 1193
406 nmdc:mga0qj67_359661_c1 3300050509 Bacteria 1176
407 nmdc:mga0qj67_500867_c1 3300050509 Bacteria 976
408 nmdc:mga0qj67_671_c1 3300050509 Bacteria 23302
409 nmdc:mga06r32_102906_c1 3300050510 Bacteria 2804
410 nmdc:mga06r32_1418459_c1 3300050510 Unclassified 636
411 nmdc:mga06r32_1489_c1 3300050510 Bacteria 21053
412 nmdc:mga06r32_25094_c1 3300050510 Bacteria 5540
413 nmdc:mga06r32_259066_c1 3300050510 Unclassified 1727
414 nmdc:mga06r32_28112_c1 3300050510 Bacteria 5259
415 nmdc:mga06r32_382498_c1 3300050510 Bacteria 1390
416 nmdc:mga06r32_3864_c1 3300050510 Bacteria 13408
417 nmdc:mga06r32_5720_c1 3300050510 Bacteria 11198
418 nmdc:mga06r32_712_c1 3300050510 Bacteria 29086
419 nmdc:mga06r32_768067_c1 3300050510 Bacteria 926
420 nmdc:mga06r32_855110_c1 3300050510 Unclassified 868
421 nmdc:mga08y16_1708_c1 3300050511 Bacteria 22269
422 nmdc:mga08y16_2097728_c1 3300050511 Bacteria 513
423 nmdc:mga08y16_36390_c1 3300050511 Bacteria 5170
424 nmdc:mga0n895_157571_c1 3300050512 Bacteria 2302
425 nmdc:mga0n895_185134_c1 3300050512 Bacteria 2113
426 nmdc:mga0n895_242576_c1 3300050512 Bacteria 1829
427 nmdc:mga0n895_25516_c1 3300050512 Bacteria 5585
428 nmdc:mga0n895_289867_c1 3300050512 Bacteria 1660
429 nmdc:mga0n895_543735_c1 3300050512 Bacteria 1168
430 nmdc:mga0n895_552738_c1 3300050512 Bacteria 1157
431 nmdc:mga0n895_776737_c1 3300050512 Bacteria 950
432 nmdc:mga0n895_81785_c1 3300050512 Bacteria 3219
433 nmdc:mga0rr50_126267_c1 3300050513 Bacteria 2043
434 nmdc:mga0rr50_1382241_c1 3300050513 Bacteria 596
435 nmdc:mga0rr50_175037_c1 3300050513 Bacteria 1751
436 nmdc:mga0rr50_28412_c1 3300050513 Bacteria 3932
437 nmdc:mga0rr50_355458_c1 3300050513 Bacteria 1233
438 nmdc:mga0rr50_50454_c1 3300050513 Bacteria 3083
439 nmdc:mga0rr50_697381_c1 3300050513 Unclassified 867
440 nmdc:mga0rr50_74766_c1 3300050513 Bacteria 2595
441 nmdc:mga0rr50_810247_c1 3300050513 Bacteria 799
442 nmdc:mga08x19_107779_c1 3300050514 Bacteria 1855
443 nmdc:mga08x19_49117_c1 3300050514 Bacteria 2705
444 nmdc:mga08x19_664875_c1 3300050514 Unclassified 739
445 nmdc:mga08x19_721423_c1 3300050514 Unclassified 708
446 nmdc:mga0a205_1027636_c1 3300050515 Bacteria 671
447 nmdc:mga0a205_1031830_c1 3300050515 Bacteria 669
448 nmdc:mga0a205_171694_c1 3300050515 Bacteria 2064
449 nmdc:mga0a205_195134_c1 3300050515 Bacteria 1916
450 nmdc:mga0a205_512090_c1 3300050515 Bacteria 1057
451 nmdc:mga0a205_520422_c1 3300050515 Bacteria 1046
452 nmdc:mga0a205_617619_c1 3300050515 Bacteria 936
453 nmdc:mga0a205_63634_c1 3300050515 Bacteria 3564
454 nmdc:mga0a205_76078_c1 3300050515 Bacteria 3243
455 nmdc:mga0a205_930_c1 3300050515 Bacteria 24169
456 Ga0501084_0018373 3300054114 Bacteria 5822
457 Ga0501084_1083543 3300054114 Bacteria 673
458 Ga0501084_1132979 3300054114 Unclassified 657
459 Ga0501084_1287038 3300054114 Unclassified 613
460 Ga0501082_0004431 3300060353 Bacteria 12261
461 Ga0501082_0094971 3300060353 Bacteria 2577
462 Ga0530510_0034402 3300061734 Bacteria 3650
463 Ga0530510_0182970 3300061734 Bacteria 1554
464 Ga0495580_0003807
465 Ga0065704_10782883
466 Ga0065707_10129538
467 Ga0065707_10172836
468 Ga0065707_10179611
469 Ga0070676_10100946
470 Ga0070690_100108658
471 Ga0070690_100380780
472 Ga0070690_100825297
473 Ga0068869_100492732
474 Ga0070680_100026106
475 Ga0070680_101246646
476 Ga0070689_100358371
477 Ga0070691_10011361
478 Ga0070691_10272514
479 Ga0070687_100116292
480 Ga0070687_100273540
481 Ga0070692_10053675
482 Ga0070668_100032425
483 Ga0070667_101008864
484 Ga0070703_10034830
485 Ga0070701_10056499
486 Ga0070701_10112449
487 Ga0070705_100004256
488 Ga0070705_100548062
489 Ga0070700_100168516
490 Ga0070700_100805311
491 Ga0070694_100069117
492 Ga0070694_100116335
493 Ga0070694_101226935
494 Ga0070708_100048551
495 Ga0070708_100601713
496 Ga0068867_100252315
497 Ga0068867_100716165
498 Ga0070706_100578947
499 Ga0070706_101345952
500 Ga0070706_101771907
501 Ga0070707_100955582
502 Ga0070698_100102198
503 Ga0070699_100004758
504 Ga0070699_100062672
505 Ga0070699_100108594
506 Ga0070699_100335057
507 Ga0070699_100524137
508 Ga0070699_100652324
509 Ga0070697_100006314
510 Ga0070697_100137695
511 Ga0070697_100204065
512 Ga0070672_100358518
513 Ga0070686_100311365
514 Ga0070695_100325371
515 Ga0070695_100359112
516 Ga0070696_100774583
517 Ga0070693_100494829
518 Ga0070704_100185779
519 Ga0070704_100369151
520 Ga0070704_101079049
521 Ga0068857_100027448
522 Ga0068857_100357370
523 Ga0068857_100578597
524 Ga0070702_100745440
525 Ga0068859_100020049
526 Ga0068859_100166148
527 Ga0068859_100202774
528 Ga0068864_100735870
529 Ga0068866_10159754
530 Ga0068866_10278762
531 Ga0068866_10871894
532 Ga0068861_100494970
533 Ga0068861_100654762
534 Ga0068870_10048720
535 Ga0068863_100600789
536 Ga0068863_100636810
537 Ga0068860_100178646
538 Ga0068860_100231403
539 Ga0068860_100261054
540 Ga0068860_101554660
541 Ga0068862_100021656
542 Ga0068862_100329923
543 Ga0068862_100878416
544 Ga0068862_101550895
545 Ga0081455_10406630
546 Ga0081538_10011198
547 Ga0081540_1043500
548 Ga0075432_10387270
549 Ga0075428_100007874
550 Ga0075428_100072008
551 Ga0075428_100295995
552 Ga0075428_100594131
553 Ga0075428_100785138
554 Ga0075428_101297354
555 Ga0075430_100001198
556 Ga0075430_100030104
557 Ga0075430_100030178
558 Ga0075430_100033303
559 Ga0075430_100058406
560 Ga0075430_100157649
561 Ga0075430_100234245
562 Ga0075430_100343904
563 Ga0075430_100397671
564 Ga0075430_100458301
565 Ga0075431_100000348
566 Ga0075431_100001551
567 Ga0075431_100002031
568 Ga0075431_100007916
569 Ga0075431_100009120
570 Ga0075431_100011496
571 Ga0075431_100034330
572 Ga0075431_100078630
573 Ga0075431_100363352
574 Ga0075431_100595493
575 Ga0075431_100684368
576 Ga0075431_100697241
577 Ga0075433_10001981
578 Ga0075433_10003837
579 Ga0075433_10113974
580 Ga0075433_10236593
581 Ga0075433_11090016
582 Ga0075433_11519777
583 Ga0075434_100000103
584 Ga0075434_100003343
585 Ga0075434_100038534
586 Ga0075434_100081259
587 Ga0075434_100139541
588 Ga0075434_100186610
589 Ga0075434_100229612
590 Ga0075434_100674404
591 Ga0075434_101086775
592 Ga0075429_100000799
593 Ga0075429_100001290
594 Ga0075429_100010158
595 Ga0075429_100105910
596 Ga0075429_100109782
597 Ga0075429_100384083
598 Ga0075429_100670533
599 Ga0068865_100103869
600 Ga0068865_101787617
601 Ga0075436_100004968
602 Ga0075436_100053913
603 Ga0075436_100134652
604 Ga0075436_100936942
605 Ga0097620_100020050
606 Ga0097620_100166151
607 Ga0097620_100202774
608 Ga0075435_100003274
609 Ga0075435_100003704
610 Ga0075435_100005460
611 Ga0075435_100029066
612 Ga0075435_100088400
613 Ga0075435_100096833
614 Ga0075435_100183887
615 Ga0075435_100632068
616 Ga0075435_100879484
617 Ga0099794_10054805
618 Ga0099794_10080519
619 Ga0111539_10002907
620 Ga0111539_10066031
621 Ga0111539_10066685
622 Ga0111539_10464298
623 Ga0111539_12261738
624 Ga0105247_10128619
625 Ga0114129_10001501
626 Ga0114129_10006636
627 Ga0114129_10009777
628 Ga0114129_10030912
629 Ga0114129_10039255
630 Ga0114129_10045233
631 Ga0114129_10070988
632 Ga0114129_10144155
633 Ga0114129_10146316
634 Ga0114129_10163784
635 Ga0114129_10280557
636 Ga0114129_10487131
637 Ga0114129_10495465
638 Ga0114129_10824410
639 Ga0114129_10945331
640 Ga0114129_11046358
641 Ga0114129_11691868
642 Ga0105243_10046515
643 Ga0105243_10318351
644 Ga0105243_11187370
645 Ga0105241_10066051
646 Ga0105241_10541771
647 Ga0105241_11460545
648 Ga0105242_10016100
649 Ga0105242_10792775
650 Ga0105242_11012304
651 Ga0105242_12285184
652 Ga0105248_10086490
653 Ga0105248_11443553
654 Ga0105249_10006982
655 Ga0105249_10077735
656 Ga0105249_12745927
657 Ga0157378_10341708
658 Ga0163162_10020436
659 Ga0163162_10090006
660 Ga0163162_10448077
661 Ga0163162_12271128
662 Ga0157375_10475392
663 Ga0157377_11779085
664 Ga0157379_10279512
665 Ga0207653_10197587
666 Ga0207642_10191351
667 Ga0207645_10869995
668 Ga0207643_10075597
669 Ga0207643_10298291
670 Ga0207684_10003137
671 Ga0207654_10291423
672 Ga0207660_10061440
673 Ga0207660_10343680
674 Ga0207660_11464950
675 Ga0207662_10151727
676 Ga0207646_10538323
677 Ga0207681_10046832
678 Ga0207659_10715935
679 Ga0207686_10059790
680 Ga0207709_10012945
681 Ga0207709_11405029
682 Ga0207670_10079497
683 Ga0207669_10449927
684 Ga0207704_10021078
685 Ga0207704_11675576
686 Ga0207711_10031989
687 Ga0207711_11715144
688 Ga0207689_10188408
689 Ga0207712_10059681
690 Ga0207712_10245209
691 Ga0207712_10747003
692 Ga0207668_10033823
693 Ga0207668_10160805
694 Ga0207703_10301856
695 Ga0207641_10427036
696 Ga0207641_10498776
697 Ga0207641_10796203
698 Ga0207648_10012613
699 Ga0207648_10165838
700 Ga0207648_10458991
701 Ga0207676_10958525
702 Ga0207674_10012454
703 Ga0207674_10033553
704 Ga0207674_10427160
705 Ga0207675_100038395
706 Ga0207675_100479502
707 Ga0209983_1076762
708 Ga0209588_1172778
709 Ga0209971_1058936
710 Ga0207428_10000682
711 Ga0207428_10004521
712 Ga0207428_10460932
713 Ga0268265_10009518
714 Ga0268265_10159552
715 Ga0268265_10162384
716 Ga0268265_10288081
717 Ga0268264_10029495
718 Ga0268264_11946644
719 Ga0307408_100008686
720 Ga0307408_100163430
721 Ga0307408_100242622
722 Ga0307408_100285679
723 Ga0307408_100497637
724 Ga0307408_100565578
725 Ga0307408_101392002
726 Ga0307405_10912230
727 Ga0307405_11360733
728 Ga0307410_10108601
729 Ga0307406_10114626
730 Ga0307406_10190121
731 Ga0307406_11044290
732 Ga0307416_100047037
733 Ga0307416_100260610
734 Ga0307416_100280765
735 Ga0307416_100566935
736 Ga0307416_101833972
737 Ga0307416_102769089
738 Ga0307411_10439286
739 Ga0307411_10439880
740 Ga0373929_0012973
741 Ga0373940_0000496
742 Ga0373949_0068472
743 Ga0373951_0113914
744 Ga0373932_0002448
745 Ga0373932_0004724
746 Ga0373939_0027757
747 Ga0373962_0108396
748 Ga0373962_0129677
749 Ga0373931_0043773
750 Ga0373931_0150148
751 Ga0395898_1334105
752 Ga0242420_094746
753 Ga0439461_0189423
754 Ga0439441_021802
755 Ga0439460_0162980
756 Ga0451577_0157422
757 Ga0451577_0660490
758 Ga0439440_0172084
759 Ga0453683_0691645
760 Ga0453684_1960588
761 Ga0451576_0126906
762 Ga0451576_0380256
763 Ga0451576_0389057
764 Ga0451576_0727795
765 Ga0451576_2325081
766 Ga0495584_0148065
767 Ga0495584_0511622
768 Ga0495642_0183330
769 Ga0495656_0031013
770 Ga0495659_0046040
771 Ga0495659_0118876
772 Ga0495669_0049874
773 Ga0495669_0120681
774 Ga0495669_0239703
775 Ga0495670_0264182
776 Ga0495636_0033680
777 Ga0496106_0241819
778 Ga0496107_0654735
779 Ga0501031_0379941
780 Ga0501033_0275428
781 Ga0501033_1141698
782 Ga0501036_0172624
783 Ga0501038_0507925
784 Ga0501038_1104425
785 Ga0501039_0079147
786 Ga0501039_1228856
787 Ga0501040_0007385
788 Ga0501040_0280052
789 Ga0501040_0687370
790 Ga0501041_0026053
791 Ga0501041_0519140
792 Ga0501042_0071004
793 Ga0501042_0249979
794 Ga0501042_0258774
795 Ga0501042_0333813
796 Ga0501043_0142979
797 Ga0501046_0126142
798 Ga0501046_0543457
799 Ga0501046_1141630
800 Ga0501048_0048609
801 Ga0501048_0284947
802 Ga0501048_0495543
803 Ga0501067_0680864
804 Ga0501068_0012151
805 Ga0501068_0687084
806 Ga0501069_0031130
807 Ga0501070_0045417
808 Ga0501071_0054736
809 Ga0501072_0011236
810 Ga0501072_0016501
811 Ga0501072_0355859
812 Ga0501072_0990254
813 Ga0501074_0197518
814 Ga0501074_0546747
815 Ga0501074_0547478
816 Ga0501075_0001478
817 Ga0501075_0068800
818 Ga0501075_0227773
819 Ga0501075_0615642
820 Ga0501075_0763627
821 Ga0501075_1092867
822 Ga0501075_1096122
823 Ga0501076_0018503
824 Ga0501076_0048507
825 Ga0501076_0669056
826 Ga0501076_1777214
827 Ga0501077_0004801
828 Ga0501077_0051950
829 Ga0501077_0971752
830 Ga0501079_0001176
831 Ga0501079_0009227
832 Ga0501079_0311385
833 Ga0501079_0670462
834 Ga0501080_0236125
835 Ga0501081_0001330
836 Ga0501081_0579757
837 Ga0501035_0064524
838 Ga0501045_0197363
839 nmdc:mga05p37_1158924_c1
840 nmdc:mga05p37_119556_c1
841 nmdc:mga05p37_121263_c1
842 nmdc:mga05p37_1269943_c1
843 nmdc:mga05p37_1379_c1
844 nmdc:mga05p37_18562_c1
845 nmdc:mga05p37_19294_c1
846 nmdc:mga05p37_20515_c1
847 nmdc:mga05p37_2215183_c1
848 nmdc:mga05p37_430560_c1
849 nmdc:mga05p37_45759_c1
850 nmdc:mga05p37_601865_c1
851 nmdc:mga05p37_628074_c1
852 nmdc:mga05p37_64401_c1
853 nmdc:mga05p37_647688_c1
854 nmdc:mga05p37_89758_c1
855 nmdc:mga09592_100185_c1
856 nmdc:mga09592_1040674_c1
857 nmdc:mga09592_13110_c1
858 nmdc:mga09592_160384_c1
859 nmdc:mga09592_2871_c1
860 nmdc:mga09592_394401_c1
861 nmdc:mga09592_402318_c1
862 nmdc:mga09592_46174_c1
863 nmdc:mga09592_639881_c1
864 nmdc:mga09592_643553_c1
865 nmdc:mga0qj67_12530_c1
866 nmdc:mga0qj67_130548_c1
867 nmdc:mga0qj67_279441_c1
868 nmdc:mga0qj67_350923_c1
869 nmdc:mga0qj67_359661_c1
870 nmdc:mga0qj67_500867_c1
871 nmdc:mga0qj67_671_c1
872 nmdc:mga06r32_102906_c1
873 nmdc:mga06r32_1418459_c1
874 nmdc:mga06r32_1489_c1
875 nmdc:mga06r32_25094_c1
876 nmdc:mga06r32_259066_c1
877 nmdc:mga06r32_28112_c1
878 nmdc:mga06r32_382498_c1
879 nmdc:mga06r32_3864_c1
880 nmdc:mga06r32_5720_c1
881 nmdc:mga06r32_712_c1
882 nmdc:mga06r32_768067_c1
883 nmdc:mga06r32_855110_c1
884 nmdc:mga08y16_1708_c1
885 nmdc:mga08y16_2097728_c1
886 nmdc:mga08y16_36390_c1
887 nmdc:mga0n895_157571_c1
888 nmdc:mga0n895_185134_c1
889 nmdc:mga0n895_242576_c1
890 nmdc:mga0n895_25516_c1
891 nmdc:mga0n895_289867_c1
892 nmdc:mga0n895_543735_c1
893 nmdc:mga0n895_552738_c1
894 nmdc:mga0n895_776737_c1
895 nmdc:mga0n895_81785_c1
896 nmdc:mga0rr50_126267_c1
897 nmdc:mga0rr50_1382241_c1
898 nmdc:mga0rr50_175037_c1
899 nmdc:mga0rr50_28412_c1
900 nmdc:mga0rr50_355458_c1
901 nmdc:mga0rr50_50454_c1
902 nmdc:mga0rr50_697381_c1
903 nmdc:mga0rr50_74766_c1
904 nmdc:mga0rr50_810247_c1
905 nmdc:mga08x19_107779_c1
906 nmdc:mga08x19_49117_c1
907 nmdc:mga08x19_664875_c1
908 nmdc:mga08x19_721423_c1
909 nmdc:mga0a205_1027636_c1
910 nmdc:mga0a205_1031830_c1
911 nmdc:mga0a205_171694_c1
912 nmdc:mga0a205_195134_c1
913 nmdc:mga0a205_512090_c1
914 nmdc:mga0a205_520422_c1
915 nmdc:mga0a205_617619_c1
916 nmdc:mga0a205_63634_c1
917 nmdc:mga0a205_76078_c1
918 nmdc:mga0a205_930_c1
919 Ga0501084_0018373
920 Ga0501084_1083543
921 Ga0501084_1132979
922 Ga0501084_1287038
923 Ga0501082_0004431
924 Ga0501082_0094971
925 Ga0530510_0034402
926 Ga0530510_0182970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

32

145

0.91

PF18029

Glyoxalase_6

Glyoxalase-like domain

35

145

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ey8-assembly1.cif.gz_A structure from the mobile metagenome of v. pseudocholerae. vpc_cass1 0.8471 1 119
3ghj-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of halifax harbour sewage outfall: integron cassette protein hfx_cass4 0.8453 6 122
3huh-assembly2.cif.gz_C the structure of biphenyl-2,3-diol 1,2-dioxygenase iii-related protein from salmonella typhimurium 0.8398 3 122
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8379 1 123
3ey7-assembly1.cif.gz_B structure from the mobile metagenome of v. cholerae. integron cassette protein vch_cass1 0.8371 1 119
ID Description Score Start End Superfamily
af_A6NK44_39_157_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8397 8 122 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8374 6 122 3.10.180.10
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.818 3 56 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8176 6 122 3.10.180.10
af_A6NK44_39_157_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8069 8 122 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2V6Z8V6-F1-model_v4 VOC family virulence protein 0.9874 1 123
AF-A0A2V6Q461-F1-model_v4 VOC family virulence protein 0.9719 1 123
AF-A0A2V6Q461-F1-model_v4 VOC family virulence protein 0.9642 1 123
AF-A0A2V7B6X0-F1-model_v4 VOC family virulence protein 0.9417 2 122
AF-A0A6G7LRV2-F1-model_v4 VOC family protein 0.93 1 123

Map