F449086

General Info

Members Datasets Scaffolds Average Seq Length
463 264 463 306

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10114926|Ga0081538_101149261
Length 361
Sequence MTVSDVRGLLERAGTHLGYTDWQVMTQERVDAFADVTGDHQFIHVDPERAKATPFGGTIAHGYLTLSLLAPFSQELLRVTDASMSVNYGLDRVRFPAPLPVGARFRVGGEIAEVGEVVATQVRLAQELGAEAIRTVATAAIREAKNRKQAVKEIERIAGVDVDVLSDEEEGRLAFVGATKTLGHPVDGDIGVVDVGGGSCEIIIGTVAEGVHWVQSFKIGSGGLTDDFLQQDPPSASEIRKLRDHIDDFFDGVDVPKPDQAVAVGGSATSLRTLVGAVLEYETLERGVRVLAGDPIADVAKRFELDPRRVRILPSGVLLLEKLSELLGQPLQIGKGGLREGIILDLLNGSANGAPVERLAA

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
134 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
135 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
136 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
137 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
140 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
141 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
142 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
210 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
245 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
246 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
257 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
261 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
262 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.89
Nodule 0
Rhizoplane 12.96
Rhizosphere 80.78
Stem 0
Stem Tuber 0
Unclassified 2.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000040 3300001977 Bacteria 12452
2 JGI24743J22301_10008983 3300001991 Bacteria 1764
3 JGI24034J26672_10000824 3300002239 Bacteria 4021
4 JGI25407J50210_10012898 3300003373 Bacteria 2144
5 JGI25407J50210_10024720 3300003373 Bacteria 1558
6 Ga0070658_10021068 3300005327 Bacteria 5222
7 Ga0070683_100001716 3300005329 Bacteria 17041
8 Ga0070690_100293809 3300005330 Bacteria 1163
9 Ga0068869_100043238 3300005334 Bacteria 3235
10 Ga0070666_10076795 3300005335 Bacteria 2279
11 Ga0070682_100000013 3300005337 Bacteria 254641
12 Ga0070682_100000390 3300005337 Bacteria 29210
13 Ga0070682_100047832 3300005337 Bacteria 2661
14 Ga0070682_100098755 3300005337 Bacteria 1924
15 Ga0070689_100028048 3300005340 Bacteria 4252
16 Ga0070691_10006507 3300005341 Bacteria 5343
17 Ga0070687_100021718 3300005343 Bacteria 3023
18 Ga0070661_100019294 3300005344 Bacteria 4860
19 Ga0070692_10016188 3300005345 Bacteria 3544
20 Ga0070668_100025460 3300005347 Bacteria 4485
21 Ga0070675_100008073 3300005354 Bacteria 8158
22 Ga0070674_100000008 3300005356 Bacteria 143844
23 Ga0070674_100063692 3300005356 Bacteria 2581
24 Ga0070674_100371248 3300005356 Unclassified 1161
25 Ga0070673_100110783 3300005364 Bacteria 2276
26 Ga0070688_100000167 3300005365 Bacteria 35374
27 Ga0070688_100000252 3300005365 Bacteria 28245
28 Ga0070659_100001783 3300005366 Bacteria 15474
29 Ga0070659_100024118 3300005366 Bacteria 4662
30 Ga0070667_100295984 3300005367 Bacteria 1456
31 Ga0070709_10383745 3300005434 Bacteria 1045
32 Ga0070714_100032681 3300005435 Bacteria 4345
33 Ga0070713_100000009 3300005436 Bacteria 153056
34 Ga0070711_100229139 3300005439 Bacteria 1448
35 Ga0070700_100004516 3300005441 Bacteria 7277
36 Ga0070694_100159258 3300005444 Bacteria 1655
37 Ga0070663_100018499 3300005455 Bacteria 4571
38 Ga0070663_100087391 3300005455 Bacteria 2304
39 Ga0070663_100229331 3300005455 Bacteria 1462
40 Ga0070681_10025352 3300005458 Bacteria 5965
41 Ga0068867_100016658 3300005459 Bacteria 5220
42 Ga0070685_10000127 3300005466 Bacteria 48844
43 Ga0070685_10000232 3300005466 Bacteria 36782
44 Ga0070685_10072805 3300005466 Bacteria 2041
45 Ga0070684_100004649 3300005535 Bacteria 10477
46 Ga0070684_100027761 3300005535 Bacteria 4781
47 Ga0070684_100332778 3300005535 Bacteria 1396
48 Ga0068853_100059882 3300005539 Bacteria 3290
49 Ga0068853_100310041 3300005539 Unclassified 1461
50 Ga0068853_100361251 3300005539 Bacteria 1353
51 Ga0070686_100090373 3300005544 Bacteria 2047
52 Ga0070686_100293798 3300005544 Bacteria 1203
53 Ga0070696_100187738 3300005546 Unclassified 1537
54 Ga0070665_100021566 3300005548 Bacteria 6476
55 Ga0070665_100066787 3300005548 Bacteria 3608
56 Ga0070665_100116749 3300005548 Bacteria 2671
57 Ga0070704_100208958 3300005549 Bacteria 1580
58 Ga0068857_100175935 3300005577 Bacteria 1947
59 Ga0068857_100226974 3300005577 Bacteria 1707
60 Ga0068854_100000114 3300005578 Bacteria 55089
61 Ga0068854_100125622 3300005578 Bacteria 1953
62 Ga0068854_100128961 3300005578 Bacteria 1929
63 Ga0068852_100035107 3300005616 Bacteria 4178
64 Ga0068859_100535189 3300005617 Bacteria 1266
65 Ga0068864_100000045 3300005618 Bacteria 154739
66 Ga0068864_100111753 3300005618 Bacteria 2434
67 Ga0068866_10000031 3300005718 Bacteria 56943
68 Ga0068861_100256401 3300005719 Bacteria 1495
69 Ga0068851_10018718 3300005834 Bacteria 3340
70 Ga0068851_10019736 3300005834 Bacteria 3258
71 Ga0068858_100000267 3300005842 Bacteria 55818
72 Ga0068858_100000590 3300005842 Bacteria 37996
73 Ga0081455_10021655 3300005937 Bacteria 6023
74 Ga0081455_10031938 3300005937 Bacteria 4753
75 Ga0081455_10045577 3300005937 Bacteria 3814
76 Ga0081455_10182078 3300005937 Bacteria 1589
77 Ga0081538_10000045 3300005981 Bacteria 114622
78 Ga0081538_10000066 3300005981 Bacteria 98455
79 Ga0081538_10114926 3300005981 Bacteria 1310
80 Ga0075365_10008195 3300006038 Bacteria 5913
81 Ga0075365_10021745 3300006038 Bacteria 4007
82 Ga0075365_10023349 3300006038 Bacteria 3889
83 Ga0075363_100001743 3300006048 Bacteria 8473
84 Ga0075363_100011512 3300006048 Bacteria 4237
85 Ga0075364_10051781 3300006051 Bacteria 2682
86 Ga0070712_100053703 3300006175 Bacteria 2814
87 Ga0075428_100282820 3300006844 Bacteria 1785
88 Ga0075430_100019802 3300006846 Bacteria 5723
89 Ga0075430_100026911 3300006846 Bacteria 4890
90 Ga0075431_100004107 3300006847 Bacteria 14218
91 Ga0075431_100013653 3300006847 Bacteria 8209
92 Ga0075431_100483663 3300006847 Unclassified 1230
93 Ga0075433_10001110 3300006852 Bacteria 19439
94 Ga0075434_100071436 3300006871 Bacteria 3462
95 Ga0075429_100009655 3300006880 Bacteria 8369
96 Ga0068865_100020725 3300006881 Bacteria 4267
97 Ga0075436_100177666 3300006914 Bacteria 1504
98 Ga0097620_100535246 3300006931 Bacteria 1266
99 Ga0075435_100048988 3300007076 Unclassified 3396
100 Ga0111539_10197850 3300009094 Unclassified 2344
101 Ga0111539_10292035 3300009094 Bacteria 1897
102 Ga0105245_10000016 3300009098 Bacteria 204372
103 Ga0105245_10019296 3300009098 Bacteria 5969
104 Ga0105245_10060727 3300009098 Bacteria 3405
105 Ga0105247_10001765 3300009101 Bacteria 15212
106 Ga0105247_10044718 3300009101 Bacteria 2716
107 Ga0114129_10082970 3300009147 Bacteria 4453
108 Ga0114129_10153385 3300009147 Unclassified 3152
109 Ga0114129_10315792 3300009147 Unclassified 2078
110 Ga0114129_10559131 3300009147 Bacteria 1487
111 Ga0114129_10912307 3300009147 Unclassified 1112
112 Ga0105243_10005428 3300009148 Bacteria 9950
113 Ga0105243_10093782 3300009148 Bacteria 2478
114 Ga0105242_10000194 3300009176 Bacteria 47231
115 Ga0105242_10002110 3300009176 Bacteria 15676
116 Ga0105242_10163200 3300009176 Bacteria 1952
117 Ga0105237_10150989 3300009545 Bacteria 2320
118 Ga0105249_10230141 3300009553 Unclassified 1828
119 Ga0105239_10092004 3300010375 Bacteria 3347
120 Ga0157370_10017638 3300013104 Bacteria 7197
121 Ga0157370_10090783 3300013104 Bacteria 2868
122 Ga0157369_10000110 3300013105 Bacteria 115514
123 Ga0157374_10120480 3300013296 Bacteria 2532
124 Ga0163162_10584992 3300013306 Bacteria 1243
125 Ga0157372_10071933 3300013307 Bacteria 3896
126 Ga0157375_10000112 3300013308 Bacteria 79146
127 Ga0157375_10061162 3300013308 Bacteria 3738
128 Ga0157375_10063673 3300013308 Bacteria 3670
129 Ga0163163_10218729 3300014325 Bacteria 1953
130 Ga0157377_10008665 3300014745 Bacteria 4967
131 Ga0157379_10542311 3300014968 Bacteria 1082
132 Ga0157376_10059627 3300014969 Bacteria 3200
133 Ga0224712_10122368 3300022467 Bacteria 1128
134 Ga0207656_10000188 3300025321 Bacteria 22311
135 Ga0207656_10011673 3300025321 Bacteria 3323
136 Ga0207682_10002513 3300025893 Bacteria 8198
137 Ga0207642_10000034 3300025899 Bacteria 43362
138 Ga0207642_10012692 3300025899 Bacteria 3051
139 Ga0207710_10003137 3300025900 Bacteria 7404
140 Ga0207688_10056110 3300025901 Bacteria 2212
141 Ga0207680_10181737 3300025903 Bacteria 1423
142 Ga0207643_10024653 3300025908 Bacteria 3319
143 Ga0207705_10017858 3300025909 Bacteria 5073
144 Ga0207707_10125178 3300025912 Bacteria 2248
145 Ga0207693_10015717 3300025915 Bacteria 6065
146 Ga0207662_10053071 3300025918 Bacteria 2414
147 Ga0207657_10009312 3300025919 Bacteria 9891
148 Ga0207649_10000063 3300025920 Bacteria 96360
149 Ga0207649_10013391 3300025920 Bacteria 4579
150 Ga0207652_10000349 3300025921 Bacteria 47896
151 Ga0207650_10099223 3300025925 Bacteria 2238
152 Ga0207659_10003385 3300025926 Bacteria 9559
153 Ga0207687_10000007 3300025927 Bacteria 604185
154 Ga0207687_10000018 3300025927 Bacteria 236159
155 Ga0207687_10000177 3300025927 Bacteria 42164
156 Ga0207687_10002435 3300025927 Bacteria 12638
157 Ga0207687_10013820 3300025927 Bacteria 5273
158 Ga0207700_10000025 3300025928 Bacteria 147429
159 Ga0207700_10151241 3300025928 Bacteria 1918
160 Ga0207664_10330208 3300025929 Bacteria 1347
161 Ga0207690_10003058 3300025932 Bacteria 10080
162 Ga0207690_10015179 3300025932 Bacteria 4664
163 Ga0207706_10000068 3300025933 Bacteria 105795
164 Ga0207686_10000033 3300025934 Bacteria 143602
165 Ga0207686_10001393 3300025934 Bacteria 13742
166 Ga0207686_10006883 3300025934 Bacteria 6121
167 Ga0207686_10172699 3300025934 Bacteria 1526
168 Ga0207709_10007874 3300025935 Bacteria 5905
169 Ga0207709_10039513 3300025935 Bacteria 2818
170 Ga0207669_10000004 3300025937 Bacteria 196828
171 Ga0207669_10099472 3300025937 Bacteria 1918
172 Ga0207669_10213782 3300025937 Bacteria 1410
173 Ga0207665_10146905 3300025939 Bacteria 1685
174 Ga0207665_10211422 3300025939 Bacteria 1417
175 Ga0207711_10000020 3300025941 Bacteria 363325
176 Ga0207661_10000610 3300025944 Bacteria 22901
177 Ga0207661_10007089 3300025944 Bacteria 7964
178 Ga0207661_10098705 3300025944 Bacteria 2448
179 Ga0207661_10106593 3300025944 Bacteria 2362
180 Ga0207661_10159335 3300025944 Bacteria 1957
181 Ga0207661_10231009 3300025944 Bacteria 1638
182 Ga0207679_10028283 3300025945 Bacteria 3887
183 Ga0207667_10558824 3300025949 Bacteria 1157
184 Ga0207651_10013700 3300025960 Bacteria 4651
185 Ga0207651_10133987 3300025960 Bacteria 1902
186 Ga0207712_10015480 3300025961 Bacteria 4922
187 Ga0207668_10028792 3300025972 Bacteria 3636
188 Ga0207640_10000015 3300025981 Bacteria 215411
189 Ga0207640_10008136 3300025981 Bacteria 5808
190 Ga0207640_10038313 3300025981 Bacteria 3024
191 Ga0207658_10017073 3300025986 Bacteria 4998
192 Ga0207658_10065959 3300025986 Bacteria 2721
193 Ga0207703_10000020 3300026035 Bacteria 251603
194 Ga0207703_10000040 3300026035 Bacteria 168191
195 Ga0207703_10516885 3300026035 Bacteria 1122
196 Ga0207639_10000915 3300026041 Bacteria 19983
197 Ga0207639_10257000 3300026041 Bacteria 1526
198 Ga0207678_10001881 3300026067 Bacteria 19142
199 Ga0207678_10050868 3300026067 Bacteria 3579
200 Ga0207708_10081025 3300026075 Bacteria 2494
201 Ga0207702_10000060 3300026078 Bacteria 125473
202 Ga0207702_10001486 3300026078 Bacteria 23204
203 Ga0207641_10001324 3300026088 Bacteria 24526
204 Ga0207648_10025576 3300026089 Bacteria 5256
205 Ga0207676_10000016 3300026095 Bacteria 311561
206 Ga0207676_10137956 3300026095 Bacteria 2084
207 Ga0207674_10068212 3300026116 Bacteria 3579
208 Ga0207675_100029822 3300026118 Bacteria 5079
209 Ga0207675_100180654 3300026118 Bacteria 2020
210 Ga0207675_100400929 3300026118 Bacteria 1352
211 Ga0207683_10187876 3300026121 Bacteria 1875
212 Ga0207698_10197979 3300026142 Bacteria 1796
213 Ga0207428_10008841 3300027907 Bacteria 9079
214 Ga0207428_10339829 3300027907 Bacteria 1106
215 Ga0268266_10000020 3300028379 Bacteria 527065
216 Ga0268266_10000085 3300028379 Bacteria 201288
217 Ga0268266_10006388 3300028379 Bacteria 10798
218 Ga0268264_10138332 3300028381 Bacteria 2168
219 Ga0265337_1000259 3300028556 Bacteria 28578
220 Ga0265326_10000007 3300028558 Bacteria 223057
221 Ga0265319_1000025 3300028563 Bacteria 142639
222 Ga0265322_10000001 3300028654 Bacteria 543854
223 Ga0265336_10001017 3300028666 Bacteria 13775
224 Ga0265338_10000473 3300028800 Bacteria 71777
225 Ga0265324_10002362 3300029957 Bacteria 9735
226 Ga0265320_10000002 3300031240 Bacteria 542875
227 Ga0265325_10009920 3300031241 Bacteria 5540
228 Ga0265329_10009101 3300031242 Bacteria 3724
229 Ga0265331_10002720 3300031250 Bacteria 11779
230 Ga0265331_10033488 3300031250 Bacteria 2540
231 Ga0265327_10000011 3300031251 Bacteria 543807
232 Ga0265316_10054160 3300031344 Bacteria 3141
233 Ga0265314_10000058 3300031711 Bacteria 167476
234 Ga0307409_100137861 3300031995 Bacteria 2097
235 Ga0307416_100211335 3300032002 Bacteria 1851
236 Ga0307416_100281493 3300032002 Bacteria 1640
237 Ga0307415_100532533 3300032126 Unclassified 1033
238 Ga0373931_0175411 3300035691 Bacteria 1266
239 Ga0395900_0104093 3300037418 Bacteria 2916
240 Ga0395901_0021396 3300038443 Bacteria 6626
241 Ga0395901_0042505 3300038443 Bacteria 4712
242 Ga0395901_0131300 3300038443 Bacteria 2632
243 Ga0395901_0317267 3300038443 Bacteria 1613
244 Ga0466963_0000001 3300044694 Bacteria 110556
245 Ga0466957_0004093 3300044842 Bacteria 8077
246 Ga0466958_0191992 3300045836 Bacteria 1298
247 Ga0466967_0000065 3300045976 Bacteria 39018
248 Ga0495592_0000036 3300046454 Bacteria 125461
249 Ga0495592_0043483 3300046454 Bacteria 3361
250 Ga0495603_0000030 3300046455 Bacteria 60760
251 Ga0495603_0202970 3300046455 Bacteria 1146
252 Ga0495629_0251781 3300046459 Bacteria 1215
253 Ga0495653_0140060 3300046463 Bacteria 1703
254 Ga0495606_0000221 3300046507 Bacteria 101157
255 Ga0495608_0000068 3300046511 Bacteria 79694
256 Ga0495608_0014505 3300046511 Bacteria 5466
257 Ga0495620_0000951 3300046515 Bacteria 17818
258 Ga0495628_0000144 3300046516 Bacteria 61254
259 Ga0495628_0032541 3300046516 Bacteria 4210
260 Ga0495628_0040858 3300046516 Bacteria 3704
261 Ga0495628_0043470 3300046516 Bacteria 3579
262 Ga0495628_0089409 3300046516 Bacteria 2385
263 Ga0495630_0000251 3300046517 Bacteria 43193
264 Ga0495630_0312353 3300046517 Unclassified 1201
265 Ga0495652_0005533 3300046529 Bacteria 11884
266 Ga0495652_0128883 3300046529 Bacteria 2006
267 Ga0495640_0010855 3300046533 Bacteria 7026
268 Ga0495640_0024327 3300046533 Bacteria 4408
269 Ga0495586_0001076 3300046535 Bacteria 15423
270 Ga0495587_0049897 3300046536 Bacteria 2476
271 Ga0495587_0062587 3300046536 Bacteria 2178
272 Ga0495645_0005903 3300046543 Bacteria 8456
273 Ga0495645_0041022 3300046543 Bacteria 3375
274 Ga0495667_0000032 3300046559 Bacteria 143493
275 Ga0495656_0000532 3300046615 Bacteria 12411
276 Ga0495634_0000018 3300046642 Bacteria 121323
277 Ga0495634_0004028 3300046642 Bacteria 11655
278 Ga0495634_0004337 3300046642 Bacteria 11178
279 Ga0495625_0000766 3300046660 Bacteria 44778
280 Ga0495635_0015200 3300046663 Bacteria 5385
281 Ga0495657_0000004 3300046675 Bacteria 266465
282 Ga0495657_0008222 3300046675 Bacteria 7997
283 Ga0495623_0227299 3300046679 Bacteria 1060
284 Ga0495658_0000005 3300046683 Bacteria 149839
285 Ga0495658_0052484 3300046683 Bacteria 2312
286 Ga0495658_0206541 3300046683 Bacteria 1226
287 Ga0495669_0021311 3300046684 Bacteria 2812
288 Ga0495613_0009169 3300046689 Bacteria 7334
289 Ga0495600_0012893 3300046809 Bacteria 5237
290 Ga0495600_0052833 3300046809 Bacteria 2653
291 Ga0495600_0073921 3300046809 Bacteria 2226
292 Ga0495604_0000398 3300047317 Bacteria 39366
293 Ga0495604_0073290 3300047317 Bacteria 2585
294 Ga0495604_0131686 3300047317 Bacteria 1796
295 Ga0495674_0000251 3300047319 Bacteria 45351
296 Ga0495676_0001271 3300047321 Bacteria 21659
297 Ga0495676_0228032 3300047321 Unclassified 1280
298 Ga0495680_0000317 3300047322 Bacteria 53949
299 Ga0495680_0004162 3300047322 Bacteria 13902
300 Ga0495680_0234289 3300047322 Bacteria 1306
301 Ga0495675_0000380 3300047444 Bacteria 30671
302 Ga0495684_0080723 3300047471 Bacteria 2469
303 Ga0495602_0084137 3300048088 Bacteria 2662
304 Ga0495602_0092591 3300048088 Bacteria 2503
305 Ga0495614_0059273 3300048089 Bacteria 1644
306 Ga0496100_0000002 3300048903 Bacteria 489057
307 Ga0496100_0000018 3300048903 Bacteria 162451
308 Ga0496100_0043698 3300048903 Bacteria 2867
309 Ga0496100_0144354 3300048903 Bacteria 1691
310 Ga0496101_0000001 3300048904 Bacteria 489057
311 Ga0496101_0000308 3300048904 Bacteria 33852
312 Ga0496102_0000039 3300048905 Bacteria 198306
313 Ga0496102_0036225 3300048905 Bacteria 4444
314 Ga0496102_0202851 3300048905 Bacteria 1869
315 Ga0496102_0516332 3300048905 Bacteria 1117
316 Ga0496103_0000008 3300048906 Bacteria 340474
317 Ga0496103_0004689 3300048906 Bacteria 8273
318 Ga0496103_0007480 3300048906 Bacteria 6508
319 Ga0496104_0000004 3300048907 Bacteria 641830
320 Ga0496104_0000129 3300048907 Bacteria 69982
321 Ga0496104_0010598 3300048907 Bacteria 8234
322 Ga0496104_0017296 3300048907 Bacteria 6563
323 Ga0496104_0030287 3300048907 Bacteria 5027
324 Ga0496105_0000001 3300048908 Bacteria 1328178
325 Ga0496105_0007931 3300048908 Bacteria 8250
326 Ga0496105_0199700 3300048908 Bacteria 1632
327 Ga0496106_0000098 3300048909 Bacteria 66098
328 Ga0496106_0000229 3300048909 Bacteria 39124
329 Ga0496106_0069920 3300048909 Bacteria 2680
330 Ga0496106_0190748 3300048909 Bacteria 1629
331 Ga0496107_0000006 3300048910 Bacteria 258746
332 Ga0496107_0000013 3300048910 Bacteria 178284
333 Ga0496107_0008011 3300048910 Bacteria 7293
334 Ga0496107_0018829 3300048910 Bacteria 4866
335 Ga0496107_0293223 3300048910 Bacteria 1211
336 Ga0496108_0000062 3300048911 Bacteria 122391
337 Ga0496108_0001220 3300048911 Bacteria 20175
338 Ga0496108_0003808 3300048911 Bacteria 12080
339 Ga0496108_0008000 3300048911 Bacteria 8578
340 Ga0496108_0021083 3300048911 Bacteria 5354
341 Ga0496108_0026678 3300048911 Bacteria 4767
342 Ga0496108_0134647 3300048911 Bacteria 2125
343 Ga0496109_0000007 3300048912 Bacteria 247554
344 Ga0496109_0000168 3300048912 Bacteria 64462
345 Ga0496109_0002556 3300048912 Bacteria 15232
346 Ga0496109_0061146 3300048912 Bacteria 3443
347 Ga0496109_0088772 3300048912 Bacteria 2857
348 Ga0496109_0294979 3300048912 Bacteria 1529
349 Ga0496109_0303207 3300048912 Bacteria 1506
350 Ga0496110_0041280 3300048913 Bacteria 4025
351 Ga0496110_0054649 3300048913 Bacteria 3512
352 Ga0496110_0120734 3300048913 Bacteria 2361
353 Ga0496111_0092942 3300048914 Bacteria 2211
354 Ga0496111_0118479 3300048914 Bacteria 1954
355 Ga0496112_0237643 3300048915 Bacteria 1775
356 Ga0496113_0000029 3300048916 Bacteria 61873
357 Ga0496113_0011015 3300048916 Bacteria 6010
358 Ga0496113_0012202 3300048916 Bacteria 5767
359 Ga0496113_0142085 3300048916 Bacteria 1889
360 Ga0496113_0186048 3300048916 Bacteria 1647
361 Ga0496114_0006594 3300048917 Bacteria 9150
362 Ga0496115_0000003 3300048918 Bacteria 354994
363 Ga0496115_0000125 3300048918 Bacteria 69936
364 Ga0496115_0002008 3300048918 Bacteria 14544
365 Ga0496115_0126147 3300048918 Bacteria 2108
366 Ga0496116_0000680 3300048919 Bacteria 44185
367 Ga0496117_0044456 3300048920 Bacteria 3217
368 Ga0496118_0023216 3300048921 Bacteria 5394
369 Ga0496119_0004679 3300048922 Bacteria 13483
370 Ga0496119_0018061 3300048922 Bacteria 5269
371 Ga0496120_0089241 3300048923 Bacteria 1651
372 Ga0496121_0021463 3300048924 Bacteria 6322
373 Ga0496124_0177755 3300048927 Bacteria 1641
374 Ga0496125_0012682 3300048928 Bacteria 8343
375 Ga0496125_0120854 3300048928 Bacteria 1869
376 Ga0496126_0041262 3300048929 Bacteria 4272
377 Ga0501032_0006299 3300049569 Bacteria 8741
378 Ga0501033_0000223 3300049570 Bacteria 54471
379 Ga0501033_0128136 3300049570 Bacteria 1840
380 Ga0501036_0007859 3300049572 Bacteria 8723
381 Ga0501037_0000315 3300049573 Bacteria 41061
382 Ga0501038_0000323 3300049574 Bacteria 41119
383 Ga0501039_0007406 3300049575 Bacteria 8371
384 Ga0501039_0043662 3300049575 Bacteria 3462
385 Ga0501040_0068231 3300049576 Bacteria 2452
386 Ga0501040_0217543 3300049576 Unclassified 1359
387 Ga0501042_0084770 3300049578 Bacteria 2272
388 Ga0501042_0092117 3300049578 Bacteria 2176
389 Ga0501043_0007344 3300049579 Bacteria 8744
390 Ga0501046_0000443 3300049580 Bacteria 41637
391 Ga0501046_0248001 3300049580 Bacteria 1312
392 Ga0501047_0000321 3300049581 Bacteria 55420
393 Ga0501048_0006771 3300049582 Bacteria 8705
394 Ga0501068_0067392 3300049584 Bacteria 2181
395 Ga0501069_0007104 3300049585 Bacteria 5865
396 Ga0501070_0000354 3300049586 Bacteria 41627
397 Ga0501070_0058413 3300049586 Bacteria 3197
398 Ga0501070_0202006 3300049586 Bacteria 1632
399 Ga0501071_0025819 3300049587 Bacteria 4117
400 Ga0501072_0005666 3300049588 Bacteria 9510
401 Ga0501072_0052336 3300049588 Bacteria 3215
402 Ga0501073_0009026 3300049589 Bacteria 7360
403 Ga0501074_0092143 3300049590 Bacteria 2170
404 Ga0501074_0097021 3300049590 Bacteria 2110
405 Ga0501074_0183690 3300049590 Bacteria 1491
406 Ga0501074_0184800 3300049590 Bacteria 1486
407 Ga0501075_0026545 3300049591 Bacteria 4265
408 Ga0501076_0062835 3300049592 Bacteria 2958
409 Ga0501077_0019045 3300049593 Bacteria 4340
410 Ga0501079_0075406 3300049741 Bacteria 2608
411 Ga0501080_0058243 3300049742 Bacteria 3596
412 Ga0501080_0271548 3300049742 Bacteria 1543
413 Ga0501081_0070069 3300049743 Bacteria 2443
414 Ga0501083_0089921 3300049744 Bacteria 2028
415 Ga0501035_0000380 3300049822 Bacteria 51102
416 Ga0501044_0000681 3300049823 Bacteria 41084
417 Ga0501044_0374724 3300049823 Bacteria 1339
418 Ga0501044_0580430 3300049823 Bacteria 1015
419 Ga0501045_0018748 3300049824 Bacteria 4925
420 nmdc:mga03n38_41005_c1 3300050490 Bacteria 2015
421 nmdc:mga00v17_15198_c1 3300050491 Bacteria 4315
422 nmdc:mga00v17_156919_c1 3300050491 Bacteria 1463
423 nmdc:mga00v17_41175_c1 3300050491 Bacteria 2773
424 nmdc:mga0yw44_2016_c1 3300050492 Bacteria 8448
425 nmdc:mga0yw44_39112_c1 3300050492 Bacteria 2810
426 nmdc:mga0yw44_40987_c1 3300050492 Bacteria 2755
427 nmdc:mga0yw44_62400_c1 3300050492 Bacteria 2289
428 nmdc:mga06z11_35222_c1 3300050494 Bacteria 2462
429 nmdc:mga05p37_236951_c1 3300050507 Unclassified 2196
430 nmdc:mga05p37_49566_c1 3300050507 Bacteria 5165
431 nmdc:mga05p37_683787_c1 3300050507 Unclassified 1143
432 nmdc:mga05p37_69788_c1 3300050507 Bacteria 4322
433 nmdc:mga09592_30990_c1 3300050508 Bacteria 4454
434 nmdc:mga0qj67_17294_c1 3300050509 Bacteria 5481
435 nmdc:mga06r32_407488_c1 3300050510 Unclassified 1341
436 nmdc:mga06r32_6900_c1 3300050510 Bacteria 10210
437 nmdc:mga08y16_501650_c1 3300050511 Bacteria 1233
438 nmdc:mga0n895_256752_c1 3300050512 Bacteria 1774
439 nmdc:mga0a205_11_c1 3300050515 Bacteria 121735
440 nmdc:mga0a205_16346_c2 3300050515 Bacteria 5331
441 Ga0495601_0000435 3300053077 Bacteria 21841
442 Ga0495601_0001639 3300053077 Bacteria 12351
443 Ga0495601_0027849 3300053077 Bacteria 3496
444 Ga0495601_0142269 3300053077 Bacteria 1565
445 Ga0495612_0000068 3300053078 Bacteria 47169
446 Ga0495612_0007177 3300053078 Bacteria 4559
447 Ga0495655_0000001 3300053083 Bacteria 419518
448 Ga0495595_0000003 3300053084 Bacteria 266465
449 Ga0495595_0014813 3300053084 Bacteria 3315
450 Ga0495619_0000021 3300053085 Bacteria 187095
451 Ga0495619_0000055 3300053085 Bacteria 95570
452 Ga0495619_0000106 3300053085 Bacteria 62413
453 Ga0495619_0000589 3300053085 Bacteria 24114
454 Ga0495619_0001139 3300053085 Bacteria 17465
455 Ga0495619_0005075 3300053085 Bacteria 8363
456 Ga0495619_0012149 3300053085 Bacteria 5422
457 Ga0495619_0195692 3300053085 Unclassified 1399
458 Ga0500641_0005914 3300053096 Bacteria 4329
459 Ga0500595_004881 3300053119 Bacteria 5932
460 Ga0500628_000065 3300053129 Bacteria 28526
461 Ga0501082_0042477 3300060353 Bacteria 3920
462 Ga0501082_0049003 3300060353 Bacteria 3642
463 Ga0530510_0001247 3300061734 Bacteria 16980

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_10584992 Ga0163162_105849921 274
2 3300048905 Ga0496102_0202851 Ga0496102_0202851_345_1304 274
3 3300048906 Ga0496103_0007480 Ga0496103_0007480_113_1072 274
4 3300048920 Ga0496117_0044456 Ga0496117_0044456_2125_3084 274
5 3300048921 Ga0496118_0023216 Ga0496118_0023216_4318_5277 274
6 3300048919 Ga0496116_0000680 Ga0496116_0000680_7963_8922 275
7 3300048922 Ga0496119_0004679 Ga0496119_0004679_3632_4591 275
8 3300053119 Ga0500595_004881 Ga0500595_004881_1702_2661 277
9 3300049823 Ga0501044_0374724 Ga0501044_0374724_211_1170 278
10 3300049742 Ga0501080_0271548 Ga0501080_0271548_43_1002 280
11 3300014968 Ga0157379_10542311 Ga0157379_105423111 281
12 3300048903 Ga0496100_0144354 Ga0496100_0144354_180_1148 282
13 3300013308 Ga0157375_10063673 Ga0157375_100636733 289
14 3300046535 Ga0495586_0001076 Ga0495586_0001076_6131_7036 290
15 3300046809 Ga0495600_0052833 Ga0495600_0052833_311_1219 290
16 3300047317 Ga0495604_0131686 Ga0495604_0131686_134_1042 290
17 3300053085 Ga0495619_0012149 Ga0495619_0012149_1231_2139 290
18 3300005330 Ga0070690_100293809 Ga0070690_1002938092 291
19 3300005548 Ga0070665_100021566 Ga0070665_1000215664 291
20 3300028379 Ga0268266_10006388 Ga0268266_100063886 291
21 3300049585 Ga0501069_0007104 Ga0501069_0007104_177_1085 292
22 3300048929 Ga0496126_0041262 Ga0496126_0041262_2985_3902 293
23 3300005335 Ga0070666_10076795 Ga0070666_100767953 294
24 3300005367 Ga0070667_100295984 Ga0070667_1002959841 294
25 3300005548 Ga0070665_100116749 Ga0070665_1001167492 294
26 3300025986 Ga0207658_10017073 Ga0207658_100170731 294
27 3300028379 Ga0268266_10000085 Ga0268266_10000085127 294
28 3300053085 Ga0495619_0000021 Ga0495619_0000021_156826_157752 294
29 3300048088 Ga0495602_0084137 Ga0495602_0084137_1073_1963 295
30 3300003373 JGI25407J50210_10024720 JGI25407J50210_100247202 296
31 3300005834 Ga0068851_10018718 Ga0068851_100187184 296
32 3300005981 Ga0081538_10000066 Ga0081538_1000006661 296
33 3300025321 Ga0207656_10011673 Ga0207656_100116734 296
34 3300005937 Ga0081455_10182078 Ga0081455_101820782 297
35 3300005981 Ga0081538_10114926 Ga0081538_101149261 297
36 3300049590 Ga0501074_0097021 Ga0501074_0097021_266_1180 297
37 3300006048 Ga0075363_100001743 Ga0075363_10000174310 298
38 3300049586 Ga0501070_0058413 Ga0501070_0058413_289_1188 298
39 3300049588 Ga0501072_0052336 Ga0501072_0052336_255_1172 298
40 3300049590 Ga0501074_0092143 Ga0501074_0092143_725_1642 298
41 3300050491 nmdc:mga00v17_15198_c1 nmdc:mga00v17_15198_c1_874_1851 298
42 3300050494 nmdc:mga06z11_35222_c1 nmdc:mga06z11_35222_c1_918_1847 298
43 3300001991 JGI24743J22301_10008983 JGI24743J22301_100089832 299
44 3300005327 Ga0070658_10021068 Ga0070658_100210682 299
45 3300005329 Ga0070683_100001716 Ga0070683_1000017165 299
46 3300005334 Ga0068869_100043238 Ga0068869_1000432383 299
47 3300005337 Ga0070682_100000390 Ga0070682_10000039015 299
48 3300005340 Ga0070689_100028048 Ga0070689_1000280483 299
49 3300005343 Ga0070687_100021718 Ga0070687_1000217183 299
50 3300005344 Ga0070661_100019294 Ga0070661_1000192943 299
51 3300005345 Ga0070692_10016188 Ga0070692_100161882 299
52 3300005347 Ga0070668_100025460 Ga0070668_1000254604 299
53 3300005354 Ga0070675_100008073 Ga0070675_1000080739 299
54 3300005356 Ga0070674_100371248 Ga0070674_1003712481 299
55 3300005364 Ga0070673_100110783 Ga0070673_1001107832 299
56 3300005366 Ga0070659_100001783 Ga0070659_1000017833 299
57 3300005441 Ga0070700_100004516 Ga0070700_1000045168 299
58 3300005455 Ga0070663_100018499 Ga0070663_1000184994 299
59 3300005459 Ga0068867_100016658 Ga0068867_1000166582 299
60 3300005535 Ga0070684_100004649 Ga0070684_10000464910 299
61 3300005539 Ga0068853_100310041 Ga0068853_1003100412 299
62 3300005548 Ga0070665_100066787 Ga0070665_1000667872 299
63 3300005577 Ga0068857_100175935 Ga0068857_1001759352 299
64 3300005578 Ga0068854_100128961 Ga0068854_1001289612 299
65 3300005616 Ga0068852_100035107 Ga0068852_1000351073 299
66 3300005617 Ga0068859_100535189 Ga0068859_1005351891 299
67 3300005618 Ga0068864_100111753 Ga0068864_1001117531 299
68 3300005834 Ga0068851_10019736 Ga0068851_100197362 299
69 3300006038 Ga0075365_10008195 Ga0075365_100081952 299
70 3300006881 Ga0068865_100020725 Ga0068865_1000207255 299
71 3300006931 Ga0097620_100535246 Ga0097620_1005352461 299
72 3300009098 Ga0105245_10019296 Ga0105245_100192965 299
73 3300009148 Ga0105243_10005428 Ga0105243_100054282 299
74 3300010375 Ga0105239_10092004 Ga0105239_100920043 299
75 3300013307 Ga0157372_10071933 Ga0157372_100719332 299
76 3300014745 Ga0157377_10008665 Ga0157377_100086654 299
77 3300025901 Ga0207688_10056110 Ga0207688_100561102 299
78 3300025908 Ga0207643_10024653 Ga0207643_100246534 299
79 3300025909 Ga0207705_10017858 Ga0207705_100178586 299
80 3300025918 Ga0207662_10053071 Ga0207662_100530713 299
81 3300025919 Ga0207657_10009312 Ga0207657_100093123 299
82 3300025920 Ga0207649_10013391 Ga0207649_100133911 299
83 3300025925 Ga0207650_10099223 Ga0207650_100992232 299
84 3300025926 Ga0207659_10003385 Ga0207659_1000338511 299
85 3300025927 Ga0207687_10013820 Ga0207687_100138204 299
86 3300025932 Ga0207690_10003058 Ga0207690_100030587 299
87 3300025935 Ga0207709_10007874 Ga0207709_100078746 299
88 3300025944 Ga0207661_10106593 Ga0207661_101065932 299
89 3300025944 Ga0207661_10159335 Ga0207661_101593353 299
90 3300025945 Ga0207679_10028283 Ga0207679_100282834 299
91 3300025960 Ga0207651_10133987 Ga0207651_101339871 299
92 3300025972 Ga0207668_10028792 Ga0207668_100287924 299
93 3300025981 Ga0207640_10038313 Ga0207640_100383133 299
94 3300026041 Ga0207639_10257000 Ga0207639_102570002 299
95 3300026067 Ga0207678_10001881 Ga0207678_1000188119 299
96 3300026075 Ga0207708_10081025 Ga0207708_100810253 299
97 3300026089 Ga0207648_10025576 Ga0207648_100255766 299
98 3300026095 Ga0207676_10137956 Ga0207676_101379563 299
99 3300026116 Ga0207674_10068212 Ga0207674_100682124 299
100 3300026118 Ga0207675_100180654 Ga0207675_1001806542 299
101 3300026142 Ga0207698_10197979 Ga0207698_101979792 299
102 3300028381 Ga0268264_10138332 Ga0268264_101383322 299
103 3300048909 Ga0496106_0190748 Ga0496106_0190748_415_1404 299
104 3300048910 Ga0496107_0008011 Ga0496107_0008011_5616_6605 299
105 3300048911 Ga0496108_0008000 Ga0496108_0008000_3286_4275 299
106 3300048912 Ga0496109_0088772 Ga0496109_0088772_1520_2509 299
107 3300048916 Ga0496113_0142085 Ga0496113_0142085_623_1612 299
108 3300050491 nmdc:mga00v17_41175_c1 nmdc:mga00v17_41175_c1_1520_2509 299
109 3300003373 JGI25407J50210_10012898 JGI25407J50210_100128982 301
110 3300005337 Ga0070682_100000013 Ga0070682_100000013131 301
111 3300005337 Ga0070682_100047832 Ga0070682_1000478322 301
112 3300005337 Ga0070682_100098755 Ga0070682_1000987552 301
113 3300005434 Ga0070709_10383745 Ga0070709_103837451 301
114 3300005439 Ga0070711_100229139 Ga0070711_1002291391 301
115 3300005444 Ga0070694_100159258 Ga0070694_1001592582 301
116 3300005455 Ga0070663_100229331 Ga0070663_1002293311 301
117 3300005458 Ga0070681_10025352 Ga0070681_100253525 301
118 3300005466 Ga0070685_10072805 Ga0070685_100728052 301
119 3300005535 Ga0070684_100027761 Ga0070684_1000277612 301
120 3300005535 Ga0070684_100332778 Ga0070684_1003327781 301
121 3300005539 Ga0068853_100059882 Ga0068853_1000598823 301
122 3300005544 Ga0070686_100293798 Ga0070686_1002937982 301
123 3300005546 Ga0070696_100187738 Ga0070696_1001877382 301
124 3300005549 Ga0070704_100208958 Ga0070704_1002089581 301
125 3300005577 Ga0068857_100226974 Ga0068857_1002269742 301
126 3300005578 Ga0068854_100125622 Ga0068854_1001256222 301
127 3300005719 Ga0068861_100256401 Ga0068861_1002564012 301
128 3300005842 Ga0068858_100000590 Ga0068858_1000005908 301
129 3300005937 Ga0081455_10021655 Ga0081455_100216552 301
130 3300005937 Ga0081455_10045577 Ga0081455_100455774 301
131 3300005981 Ga0081538_10000045 Ga0081538_10000045106 301
132 3300006038 Ga0075365_10021745 Ga0075365_100217452 301
133 3300006038 Ga0075365_10023349 Ga0075365_100233492 301
134 3300006048 Ga0075363_100011512 Ga0075363_1000115122 301
135 3300006051 Ga0075364_10051781 Ga0075364_100517813 301
136 3300006175 Ga0070712_100053703 Ga0070712_1000537033 301
137 3300006844 Ga0075428_100282820 Ga0075428_1002828202 301
138 3300006846 Ga0075430_100026911 Ga0075430_1000269115 301
139 3300006847 Ga0075431_100004107 Ga0075431_1000041077 301
140 3300006852 Ga0075433_10001110 Ga0075433_1000111023 301
141 3300006871 Ga0075434_100071436 Ga0075434_1000714362 301
142 3300006914 Ga0075436_100177666 Ga0075436_1001776661 301
143 3300007076 Ga0075435_100048988 Ga0075435_1000489884 301
144 3300009094 Ga0111539_10197850 Ga0111539_101978502 301
145 3300009094 Ga0111539_10292035 Ga0111539_102920352 301
146 3300009098 Ga0105245_10000016 Ga0105245_10000016109 301
147 3300009098 Ga0105245_10060727 Ga0105245_100607273 301
148 3300009147 Ga0114129_10082970 Ga0114129_100829704 301
149 3300009147 Ga0114129_10153385 Ga0114129_101533852 301
150 3300009147 Ga0114129_10315792 Ga0114129_103157921 301
151 3300009147 Ga0114129_10559131 Ga0114129_105591312 301
152 3300009147 Ga0114129_10912307 Ga0114129_109123071 301
153 3300009545 Ga0105237_10150989 Ga0105237_101509894 301
154 3300009553 Ga0105249_10230141 Ga0105249_102301412 301
155 3300013296 Ga0157374_10120480 Ga0157374_101204802 301
156 3300014969 Ga0157376_10059627 Ga0157376_100596273 301
157 3300025893 Ga0207682_10002513 Ga0207682_100025138 301
158 3300025903 Ga0207680_10181737 Ga0207680_101817372 301
159 3300025912 Ga0207707_10125178 Ga0207707_101251784 301
160 3300025915 Ga0207693_10015717 Ga0207693_100157173 301
161 3300025920 Ga0207649_10000063 Ga0207649_1000006355 301
162 3300025921 Ga0207652_10000349 Ga0207652_1000034932 301
163 3300025927 Ga0207687_10000018 Ga0207687_10000018115 301
164 3300025927 Ga0207687_10000177 Ga0207687_1000017737 301
165 3300025933 Ga0207706_10000068 Ga0207706_10000068107 301
166 3300025937 Ga0207669_10213782 Ga0207669_102137822 301
167 3300025939 Ga0207665_10211422 Ga0207665_102114221 301
168 3300025944 Ga0207661_10000610 Ga0207661_1000061012 301
169 3300025944 Ga0207661_10007089 Ga0207661_100070894 301
170 3300025944 Ga0207661_10231009 Ga0207661_102310092 301
171 3300025949 Ga0207667_10558824 Ga0207667_105588242 301
172 3300025960 Ga0207651_10013700 Ga0207651_100137005 301
173 3300025961 Ga0207712_10015480 Ga0207712_100154803 301
174 3300025981 Ga0207640_10008136 Ga0207640_100081363 301
175 3300026035 Ga0207703_10000020 Ga0207703_1000002027 301
176 3300026035 Ga0207703_10516885 Ga0207703_105168852 301
177 3300026041 Ga0207639_10000915 Ga0207639_100009153 301
178 3300026078 Ga0207702_10001486 Ga0207702_1000148622 301
179 3300026118 Ga0207675_100400929 Ga0207675_1004009292 301
180 3300026121 Ga0207683_10187876 Ga0207683_101878761 301
181 3300027907 Ga0207428_10008841 Ga0207428_100088417 301
182 3300027907 Ga0207428_10339829 Ga0207428_103398292 301
183 3300028379 Ga0268266_10000020 Ga0268266_100000208 301
184 3300031995 Ga0307409_100137861 Ga0307409_1001378612 301
185 3300032002 Ga0307416_100211335 Ga0307416_1002113352 301
186 3300032002 Ga0307416_100281493 Ga0307416_1002814932 301
187 3300032126 Ga0307415_100532533 Ga0307415_1005325331 301
188 3300035691 Ga0373931_0175411 Ga0373931_0175411_167_1072 301
189 3300037418 Ga0395900_0104093 Ga0395900_0104093_1246_2151 301
190 3300038443 Ga0395901_0021396 Ga0395901_0021396_4161_5066 301
191 3300038443 Ga0395901_0042505 Ga0395901_0042505_874_1779 301
192 3300038443 Ga0395901_0131300 Ga0395901_0131300_1308_2213 301
193 3300038443 Ga0395901_0317267 Ga0395901_0317267_349_1254 301
194 3300044694 Ga0466963_0000001 Ga0466963_0000001_94909_95820 301
195 3300046454 Ga0495592_0000036 Ga0495592_0000036_92983_93906 301
196 3300046455 Ga0495603_0202970 Ga0495603_0202970_175_1080 301
197 3300046507 Ga0495606_0000221 Ga0495606_0000221_3252_4160 301
198 3300046515 Ga0495620_0000951 Ga0495620_0000951_4246_5169 301
199 3300046516 Ga0495628_0043470 Ga0495628_0043470_1310_2218 301
200 3300046533 Ga0495640_0010855 Ga0495640_0010855_5254_6159 301
201 3300046536 Ga0495587_0049897 Ga0495587_0049897_841_1761 301
202 3300046615 Ga0495656_0000532 Ga0495656_0000532_77_982 301
203 3300046642 Ga0495634_0000018 Ga0495634_0000018_13822_14745 301
204 3300046679 Ga0495623_0227299 Ga0495623_0227299_49_957 301
205 3300046683 Ga0495658_0000005 Ga0495658_0000005_136261_137181 301
206 3300047317 Ga0495604_0073290 Ga0495604_0073290_1497_2402 301
207 3300047322 Ga0495680_0000317 Ga0495680_0000317_7744_8652 301
208 3300048903 Ga0496100_0000002 Ga0496100_0000002_243745_244653 301
209 3300048903 Ga0496100_0043698 Ga0496100_0043698_1488_2393 301
210 3300048904 Ga0496101_0000001 Ga0496101_0000001_243745_244653 301
211 3300048905 Ga0496102_0036225 Ga0496102_0036225_3265_4170 301
212 3300048906 Ga0496103_0004689 Ga0496103_0004689_4728_5633 301
213 3300048907 Ga0496104_0000129 Ga0496104_0000129_48019_48924 301
214 3300048907 Ga0496104_0030287 Ga0496104_0030287_3599_4504 301
215 3300048908 Ga0496105_0007931 Ga0496105_0007931_654_1559 301
216 3300048908 Ga0496105_0199700 Ga0496105_0199700_469_1374 301
217 3300048909 Ga0496106_0000098 Ga0496106_0000098_19421_20329 301
218 3300048909 Ga0496106_0069920 Ga0496106_0069920_390_1295 301
219 3300048910 Ga0496107_0000013 Ga0496107_0000013_71467_72375 301
220 3300048910 Ga0496107_0018829 Ga0496107_0018829_3273_4178 301
221 3300048910 Ga0496107_0293223 Ga0496107_0293223_62_967 301
222 3300048911 Ga0496108_0021083 Ga0496108_0021083_319_1224 301
223 3300048911 Ga0496108_0026678 Ga0496108_0026678_149_1057 301
224 3300048912 Ga0496109_0002556 Ga0496109_0002556_213_1121 301
225 3300048912 Ga0496109_0294979 Ga0496109_0294979_60_965 301
226 3300048912 Ga0496109_0303207 Ga0496109_0303207_30_935 301
227 3300048913 Ga0496110_0041280 Ga0496110_0041280_249_1154 301
228 3300048913 Ga0496110_0054649 Ga0496110_0054649_2057_2962 301
229 3300048914 Ga0496111_0092942 Ga0496111_0092942_483_1391 301
230 3300048914 Ga0496111_0118479 Ga0496111_0118479_229_1134 301
231 3300048915 Ga0496112_0237643 Ga0496112_0237643_330_1235 301
232 3300048916 Ga0496113_0012202 Ga0496113_0012202_2752_3657 301
233 3300048917 Ga0496114_0006594 Ga0496114_0006594_4282_5187 301
234 3300048918 Ga0496115_0126147 Ga0496115_0126147_1077_1982 301
235 3300048927 Ga0496124_0177755 Ga0496124_0177755_138_1046 301
236 3300048928 Ga0496125_0012682 Ga0496125_0012682_136_1041 301
237 3300049570 Ga0501033_0128136 Ga0501033_0128136_494_1399 301
238 3300049575 Ga0501039_0043662 Ga0501039_0043662_2214_3119 301
239 3300049576 Ga0501040_0217543 Ga0501040_0217543_134_1039 301
240 3300049580 Ga0501046_0248001 Ga0501046_0248001_304_1209 301
241 3300049587 Ga0501071_0025819 Ga0501071_0025819_1173_2078 301
242 3300049588 Ga0501072_0005666 Ga0501072_0005666_3875_4780 301
243 3300049591 Ga0501075_0026545 Ga0501075_0026545_1734_2639 301
244 3300049592 Ga0501076_0062835 Ga0501076_0062835_374_1282 301
245 3300049593 Ga0501077_0019045 Ga0501077_0019045_203_1108 301
246 3300049743 Ga0501081_0070069 Ga0501081_0070069_1478_2383 301
247 3300049824 Ga0501045_0018748 Ga0501045_0018748_1608_2513 301
248 3300050490 nmdc:mga03n38_41005_c1 nmdc:mga03n38_41005_c1_1026_1931 301
249 3300050491 nmdc:mga00v17_156919_c1 nmdc:mga00v17_156919_c1_464_1369 301
250 3300050492 nmdc:mga0yw44_2016_c1 nmdc:mga0yw44_2016_c1_5899_6804 301
251 3300050492 nmdc:mga0yw44_39112_c1 nmdc:mga0yw44_39112_c1_1845_2750 301
252 3300050492 nmdc:mga0yw44_40987_c1 nmdc:mga0yw44_40987_c1_832_1737 301
253 3300050492 nmdc:mga0yw44_62400_c1 nmdc:mga0yw44_62400_c1_74_979 301
254 3300050507 nmdc:mga05p37_236951_c1 nmdc:mga05p37_236951_c1_46_951 301
255 3300050507 nmdc:mga05p37_49566_c1 nmdc:mga05p37_49566_c1_374_1279 301
256 3300050507 nmdc:mga05p37_683787_c1 nmdc:mga05p37_683787_c1_141_1046 301
257 3300050507 nmdc:mga05p37_69788_c1 nmdc:mga05p37_69788_c1_1417_2322 301
258 3300050510 nmdc:mga06r32_6900_c1 nmdc:mga06r32_6900_c1_4803_5708 301
259 3300050511 nmdc:mga08y16_501650_c1 nmdc:mga08y16_501650_c1_170_1075 301
260 3300050512 nmdc:mga0n895_256752_c1 nmdc:mga0n895_256752_c1_682_1587 301
261 3300050515 nmdc:mga0a205_16346_c2 nmdc:mga0a205_16346_c2_1485_2390 301
262 3300053077 Ga0495601_0001639 Ga0495601_0001639_5064_5972 301
263 3300053077 Ga0495601_0142269 Ga0495601_0142269_177_1082 301
264 3300060353 Ga0501082_0049003 Ga0501082_0049003_2266_3171 301
265 3300061734 Ga0530510_0001247 Ga0530510_0001247_3105_4010 301
266 3300001977 JGI24746J21847_1000040 JGI24746J21847_10000407 302
267 3300002239 JGI24034J26672_10000824 JGI24034J26672_100008245 302
268 3300005341 Ga0070691_10006507 Ga0070691_100065073 302
269 3300005356 Ga0070674_100000008 Ga0070674_10000000865 302
270 3300005356 Ga0070674_100063692 Ga0070674_1000636923 302
271 3300005365 Ga0070688_100000167 Ga0070688_10000016729 302
272 3300005365 Ga0070688_100000252 Ga0070688_10000025219 302
273 3300005366 Ga0070659_100024118 Ga0070659_1000241185 302
274 3300005435 Ga0070714_100032681 Ga0070714_1000326811 302
275 3300005436 Ga0070713_100000009 Ga0070713_100000009127 302
276 3300005455 Ga0070663_100087391 Ga0070663_1000873912 302
277 3300005466 Ga0070685_10000127 Ga0070685_1000012719 302
278 3300005466 Ga0070685_10000232 Ga0070685_1000023213 302
279 3300005539 Ga0068853_100361251 Ga0068853_1003612512 302
280 3300005544 Ga0070686_100090373 Ga0070686_1000903732 302
281 3300005578 Ga0068854_100000114 Ga0068854_10000011436 302
282 3300005618 Ga0068864_100000045 Ga0068864_10000004592 302
283 3300005718 Ga0068866_10000031 Ga0068866_1000003136 302
284 3300005842 Ga0068858_100000267 Ga0068858_1000002675 302
285 3300005937 Ga0081455_10031938 Ga0081455_100319381 302
286 3300006846 Ga0075430_100019802 Ga0075430_1000198022 302
287 3300006847 Ga0075431_100013653 Ga0075431_1000136532 302
288 3300006847 Ga0075431_100483663 Ga0075431_1004836631 302
289 3300006880 Ga0075429_100009655 Ga0075429_1000096553 302
290 3300009101 Ga0105247_10001765 Ga0105247_100017654 302
291 3300009101 Ga0105247_10044718 Ga0105247_100447182 302
292 3300009148 Ga0105243_10093782 Ga0105243_100937821 302
293 3300009176 Ga0105242_10000194 Ga0105242_100001943 302
294 3300009176 Ga0105242_10002110 Ga0105242_100021105 302
295 3300009176 Ga0105242_10163200 Ga0105242_101632002 302
296 3300013104 Ga0157370_10017638 Ga0157370_100176384 302
297 3300013104 Ga0157370_10090783 Ga0157370_100907832 302
298 3300013105 Ga0157369_10000110 Ga0157369_1000011021 302
299 3300013308 Ga0157375_10000112 Ga0157375_1000011231 302
300 3300013308 Ga0157375_10061162 Ga0157375_100611622 302
301 3300014325 Ga0163163_10218729 Ga0163163_102187291 302
302 3300022467 Ga0224712_10122368 Ga0224712_101223682 302
303 3300025321 Ga0207656_10000188 Ga0207656_1000018815 302
304 3300025899 Ga0207642_10000034 Ga0207642_1000003420 302
305 3300025899 Ga0207642_10012692 Ga0207642_100126922 302
306 3300025900 Ga0207710_10003137 Ga0207710_100031378 302
307 3300025927 Ga0207687_10000007 Ga0207687_10000007305 302
308 3300025927 Ga0207687_10002435 Ga0207687_100024354 302
309 3300025928 Ga0207700_10000025 Ga0207700_10000025128 302
310 3300025928 Ga0207700_10151241 Ga0207700_101512412 302
311 3300025929 Ga0207664_10330208 Ga0207664_103302081 302
312 3300025932 Ga0207690_10015179 Ga0207690_100151792 302
313 3300025934 Ga0207686_10000033 Ga0207686_1000003392 302
314 3300025934 Ga0207686_10001393 Ga0207686_100013935 302
315 3300025934 Ga0207686_10006883 Ga0207686_100068833 302
316 3300025934 Ga0207686_10172699 Ga0207686_101726992 302
317 3300025935 Ga0207709_10039513 Ga0207709_100395133 302
318 3300025937 Ga0207669_10000004 Ga0207669_10000004141 302
319 3300025937 Ga0207669_10099472 Ga0207669_100994722 302
320 3300025939 Ga0207665_10146905 Ga0207665_101469051 302
321 3300025941 Ga0207711_10000020 Ga0207711_1000002050 302
322 3300025944 Ga0207661_10098705 Ga0207661_100987052 302
323 3300025981 Ga0207640_10000015 Ga0207640_1000001576 302
324 3300025986 Ga0207658_10065959 Ga0207658_100659592 302
325 3300026035 Ga0207703_10000040 Ga0207703_10000040145 302
326 3300026067 Ga0207678_10050868 Ga0207678_100508684 302
327 3300026078 Ga0207702_10000060 Ga0207702_10000060105 302
328 3300026088 Ga0207641_10001324 Ga0207641_100013248 302
329 3300026095 Ga0207676_10000016 Ga0207676_1000001672 302
330 3300026118 Ga0207675_100029822 Ga0207675_1000298223 302
331 3300028556 Ga0265337_1000259 Ga0265337_100025920 302
332 3300028558 Ga0265326_10000007 Ga0265326_1000000741 302
333 3300028563 Ga0265319_1000025 Ga0265319_100002559 302
334 3300028654 Ga0265322_10000001 Ga0265322_10000001264 302
335 3300028666 Ga0265336_10001017 Ga0265336_100010176 302
336 3300028800 Ga0265338_10000473 Ga0265338_1000047318 302
337 3300029957 Ga0265324_10002362 Ga0265324_100023626 302
338 3300031240 Ga0265320_10000002 Ga0265320_10000002263 302
339 3300031241 Ga0265325_10009920 Ga0265325_100099205 302
340 3300031242 Ga0265329_10009101 Ga0265329_100091014 302
341 3300031250 Ga0265331_10002720 Ga0265331_100027205 302
342 3300031250 Ga0265331_10033488 Ga0265331_100334884 302
343 3300031251 Ga0265327_10000011 Ga0265327_10000011263 302
344 3300031344 Ga0265316_10054160 Ga0265316_100541604 302
345 3300031711 Ga0265314_10000058 Ga0265314_10000058170 302
346 3300044842 Ga0466957_0004093 Ga0466957_0004093_973_1884 302
347 3300045836 Ga0466958_0191992 Ga0466958_0191992_314_1225 302
348 3300045976 Ga0466967_0000065 Ga0466967_0000065_29658_30569 302
349 3300046454 Ga0495592_0043483 Ga0495592_0043483_943_1851 302
350 3300046455 Ga0495603_0000030 Ga0495603_0000030_34050_34958 302
351 3300046459 Ga0495629_0251781 Ga0495629_0251781_270_1178 302
352 3300046463 Ga0495653_0140060 Ga0495653_0140060_291_1199 302
353 3300046511 Ga0495608_0000068 Ga0495608_0000068_94_1005 302
354 3300046511 Ga0495608_0014505 Ga0495608_0014505_1525_2433 302
355 3300046516 Ga0495628_0000144 Ga0495628_0000144_41783_42691 302
356 3300046516 Ga0495628_0032541 Ga0495628_0032541_849_1757 302
357 3300046516 Ga0495628_0040858 Ga0495628_0040858_76_1002 302
358 3300046516 Ga0495628_0089409 Ga0495628_0089409_465_1373 302
359 3300046517 Ga0495630_0000251 Ga0495630_0000251_25590_26498 302
360 3300046517 Ga0495630_0312353 Ga0495630_0312353_52_960 302
361 3300046529 Ga0495652_0005533 Ga0495652_0005533_3413_4339 302
362 3300046529 Ga0495652_0128883 Ga0495652_0128883_843_1751 302
363 3300046533 Ga0495640_0024327 Ga0495640_0024327_58_966 302
364 3300046536 Ga0495587_0062587 Ga0495587_0062587_170_1078 302
365 3300046543 Ga0495645_0005903 Ga0495645_0005903_5718_6644 302
366 3300046543 Ga0495645_0041022 Ga0495645_0041022_2007_2933 302
367 3300046559 Ga0495667_0000032 Ga0495667_0000032_48197_49105 302
368 3300046642 Ga0495634_0004028 Ga0495634_0004028_1631_2539 302
369 3300046642 Ga0495634_0004337 Ga0495634_0004337_6607_7533 302
370 3300046660 Ga0495625_0000766 Ga0495625_0000766_23326_24234 302
371 3300046663 Ga0495635_0015200 Ga0495635_0015200_2641_3549 302
372 3300046675 Ga0495657_0000004 Ga0495657_0000004_43856_44767 302
373 3300046675 Ga0495657_0008222 Ga0495657_0008222_3886_4794 302
374 3300046683 Ga0495658_0052484 Ga0495658_0052484_54_965 302
375 3300046683 Ga0495658_0206541 Ga0495658_0206541_19_927 302
376 3300046684 Ga0495669_0021311 Ga0495669_0021311_1861_2769 302
377 3300046689 Ga0495613_0009169 Ga0495613_0009169_292_1203 302
378 3300046809 Ga0495600_0012893 Ga0495600_0012893_3549_4460 302
379 3300046809 Ga0495600_0073921 Ga0495600_0073921_471_1379 302
380 3300047317 Ga0495604_0000398 Ga0495604_0000398_27834_28745 302
381 3300047319 Ga0495674_0000251 Ga0495674_0000251_24390_25298 302
382 3300047321 Ga0495676_0001271 Ga0495676_0001271_14490_15398 302
383 3300047321 Ga0495676_0228032 Ga0495676_0228032_294_1202 302
384 3300047322 Ga0495680_0004162 Ga0495680_0004162_9523_10431 302
385 3300047322 Ga0495680_0234289 Ga0495680_0234289_75_983 302
386 3300047444 Ga0495675_0000380 Ga0495675_0000380_28296_29207 302
387 3300047471 Ga0495684_0080723 Ga0495684_0080723_519_1427 302
388 3300048088 Ga0495602_0092591 Ga0495602_0092591_842_1750 302
389 3300048089 Ga0495614_0059273 Ga0495614_0059273_633_1541 302
390 3300048903 Ga0496100_0000018 Ga0496100_0000018_58570_59478 302
391 3300048904 Ga0496101_0000308 Ga0496101_0000308_7202_8110 302
392 3300048905 Ga0496102_0000039 Ga0496102_0000039_172592_173500 302
393 3300048905 Ga0496102_0516332 Ga0496102_0516332_59_985 302
394 3300048906 Ga0496103_0000008 Ga0496103_0000008_293847_294755 302
395 3300048907 Ga0496104_0000004 Ga0496104_0000004_127621_128529 302
396 3300048907 Ga0496104_0010598 Ga0496104_0010598_3616_4551 302
397 3300048907 Ga0496104_0017296 Ga0496104_0017296_1285_2196 302
398 3300048908 Ga0496105_0000001 Ga0496105_0000001_513302_514210 302
399 3300048909 Ga0496106_0000229 Ga0496106_0000229_25723_26631 302
400 3300048910 Ga0496107_0000006 Ga0496107_0000006_127493_128401 302
401 3300048911 Ga0496108_0000062 Ga0496108_0000062_14332_15243 302
402 3300048911 Ga0496108_0001220 Ga0496108_0001220_3182_4090 302
403 3300048911 Ga0496108_0003808 Ga0496108_0003808_4767_5675 302
404 3300048911 Ga0496108_0134647 Ga0496108_0134647_1058_1966 302
405 3300048912 Ga0496109_0000007 Ga0496109_0000007_91595_92506 302
406 3300048912 Ga0496109_0000168 Ga0496109_0000168_19952_20860 302
407 3300048912 Ga0496109_0061146 Ga0496109_0061146_1145_2053 302
408 3300048913 Ga0496110_0120734 Ga0496110_0120734_522_1430 302
409 3300048916 Ga0496113_0000029 Ga0496113_0000029_1341_2252 302
410 3300048916 Ga0496113_0011015 Ga0496113_0011015_101_1009 302
411 3300048916 Ga0496113_0186048 Ga0496113_0186048_396_1304 302
412 3300048918 Ga0496115_0000003 Ga0496115_0000003_261398_262306 302
413 3300048918 Ga0496115_0000125 Ga0496115_0000125_98_1006 302
414 3300048918 Ga0496115_0002008 Ga0496115_0002008_431_1339 302
415 3300048922 Ga0496119_0018061 Ga0496119_0018061_633_1568 302
416 3300048923 Ga0496120_0089241 Ga0496120_0089241_557_1492 302
417 3300048924 Ga0496121_0021463 Ga0496121_0021463_3703_4638 302
418 3300048928 Ga0496125_0120854 Ga0496125_0120854_180_1115 302
419 3300049569 Ga0501032_0006299 Ga0501032_0006299_7710_8627 302
420 3300049570 Ga0501033_0000223 Ga0501033_0000223_21133_22050 302
421 3300049572 Ga0501036_0007859 Ga0501036_0007859_7717_8634 302
422 3300049573 Ga0501037_0000315 Ga0501037_0000315_7723_8640 302
423 3300049574 Ga0501038_0000323 Ga0501038_0000323_7809_8726 302
424 3300049575 Ga0501039_0007406 Ga0501039_0007406_7369_8286 302
425 3300049576 Ga0501040_0068231 Ga0501040_0068231_1436_2353 302
426 3300049578 Ga0501042_0084770 Ga0501042_0084770_133_1041 302
427 3300049578 Ga0501042_0092117 Ga0501042_0092117_920_1831 302
428 3300049579 Ga0501043_0007344 Ga0501043_0007344_7673_8590 302
429 3300049580 Ga0501046_0000443 Ga0501046_0000443_32751_33668 302
430 3300049581 Ga0501047_0000321 Ga0501047_0000321_7748_8665 302
431 3300049582 Ga0501048_0006771 Ga0501048_0006771_78_995 302
432 3300049584 Ga0501068_0067392 Ga0501068_0067392_105_1022 302
433 3300049586 Ga0501070_0000354 Ga0501070_0000354_7965_8882 302
434 3300049586 Ga0501070_0202006 Ga0501070_0202006_24_935 302
435 3300049589 Ga0501073_0009026 Ga0501073_0009026_986_1903 302
436 3300049590 Ga0501074_0183690 Ga0501074_0183690_200_1108 302
437 3300049590 Ga0501074_0184800 Ga0501074_0184800_67_984 302
438 3300049741 Ga0501079_0075406 Ga0501079_0075406_1594_2511 302
439 3300049742 Ga0501080_0058243 Ga0501080_0058243_2577_3494 302
440 3300049744 Ga0501083_0089921 Ga0501083_0089921_82_999 302
441 3300049822 Ga0501035_0000380 Ga0501035_0000380_42186_43103 302
442 3300049823 Ga0501044_0000681 Ga0501044_0000681_32422_33339 302
443 3300049823 Ga0501044_0580430 Ga0501044_0580430_58_966 302
444 3300050508 nmdc:mga09592_30990_c1 nmdc:mga09592_30990_c1_2894_3805 302
445 3300050509 nmdc:mga0qj67_17294_c1 nmdc:mga0qj67_17294_c1_1508_2419 302
446 3300050510 nmdc:mga06r32_407488_c1 nmdc:mga06r32_407488_c1_402_1310 302
447 3300050515 nmdc:mga0a205_11_c1 nmdc:mga0a205_11_c1_8792_9700 302
448 3300053077 Ga0495601_0000435 Ga0495601_0000435_5900_6808 302
449 3300053077 Ga0495601_0027849 Ga0495601_0027849_333_1241 302
450 3300053078 Ga0495612_0000068 Ga0495612_0000068_37648_38556 302
451 3300053078 Ga0495612_0007177 Ga0495612_0007177_1614_2522 302
452 3300053083 Ga0495655_0000001 Ga0495655_0000001_117663_118571 302
453 3300053084 Ga0495595_0000003 Ga0495595_0000003_43856_44767 302
454 3300053084 Ga0495595_0014813 Ga0495595_0014813_1501_2412 302
455 3300053085 Ga0495619_0000055 Ga0495619_0000055_1524_2435 302
456 3300053085 Ga0495619_0000106 Ga0495619_0000106_61406_62317 302
457 3300053085 Ga0495619_0000589 Ga0495619_0000589_8669_9577 302
458 3300053085 Ga0495619_0001139 Ga0495619_0001139_2941_3849 302
459 3300053085 Ga0495619_0005075 Ga0495619_0005075_7419_8327 302
460 3300053085 Ga0495619_0195692 Ga0495619_0195692_359_1285 302
461 3300053096 Ga0500641_0005914 Ga0500641_0005914_1117_2025 302
462 3300053129 Ga0500628_000065 Ga0500628_000065_20364_21272 302
463 3300060353 Ga0501082_0042477 Ga0501082_0042477_19_936 302

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

9

132

0.88

PF02541

Ppx-GppA

Ppx/GppA phosphatase family

109

349

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ea8-assembly5.cif.gz_I-4 structure of vacv poxin in pre-reactive state with nonhydrolyzable 2'3' cgamp 0.8449 134 161
1t6d-assembly2.cif.gz_B miras phasing of the aquifex aeolicus ppx/gppa phosphatase: crystal structure of the type ii variant 0.8044 1 286
1t6d-assembly2.cif.gz_B miras phasing of the aquifex aeolicus ppx/gppa phosphatase: crystal structure of the type ii variant 0.7691 1 286
6ea8-assembly2.cif.gz_B structure of vacv poxin in pre-reactive state with nonhydrolyzable 2'3' cgamp 0.7587 4 34
3kny-assembly1.cif.gz_A crystal structure of a two domain protein with unknown function (bt_3535) from bacteroides thetaiotaomicron vpi-5482 at 2.60 a resolution 0.7423 12 33
ID Description Score Start End Superfamily
af_P9WHV5_1_122_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9493 1 114 3.30.420.40
3mdqA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9092 1 111 3.30.420.40
1t6dB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9032 1 113 3.30.420.40
af_P9WHV5_1_122_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8821 1 114 3.30.420.40
2floB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8753 4 106 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A7V9DGI3-F1-model_v4 Ppx/GppA family phosphatase 0.9499 1 80
AF-W1XLQ9-F1-model_v4 Ppx/GppA phosphatase 0.9417 2 108
AF-A0A7V9DGI3-F1-model_v4 Ppx/GppA family phosphatase 0.9385 1 80
AF-G2FSD5-F1-model_v4 Ppx/GppA phosphatase domain protein 0.9369 2 111 GO:0016462
AF-A0A3D1R0S5-F1-model_v4 Ppx/GppA phosphatase N-terminal domain-containing protein 0.9364 1 99 GO:0016462

Feature Viewer

pLDDT pTM Quality
91 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map