F449086
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 463 | 264 | 463 | 306 |
Family's Representative Sequence
| Representative Sequence | 3300005981|Ga0081538_10114926|Ga0081538_101149261 |
| Length | 361 |
| Sequence | MTVSDVRGLLERAGTHLGYTDWQVMTQERVDAFADVTGDHQFIHVDPERAKATPFGGTIAHGYLTLSLLAPFSQELLRVTDASMSVNYGLDRVRFPAPLPVGARFRVGGEIAEVGEVVATQVRLAQELGAEAIRTVATAAIREAKNRKQAVKEIERIAGVDVDVLSDEEEGRLAFVGATKTLGHPVDGDIGVVDVGGGSCEIIIGTVAEGVHWVQSFKIGSGGLTDDFLQQDPPSASEIRKLRDHIDDFFDGVDVPKPDQAVAVGGSATSLRTLVGAVLEYETLERGVRVLAGDPIADVAKRFELDPRRVRILPSGVLLLEKLSELLGQPLQIGKGGLREGIILDLLNGSANGAPVERLAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 50 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 51 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 131 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 134 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 135 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 136 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 137 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 138 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 139 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 141 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 142 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 143 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 144 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 145 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 146 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 148 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 149 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 150 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 151 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 152 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 153 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 154 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 155 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 156 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 157 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 193 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 194 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 195 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 196 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 197 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 198 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 201 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 202 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 203 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 204 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 205 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 206 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 207 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 208 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 209 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 210 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 211 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 212 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 213 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 214 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 215 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 245 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 246 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 247 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 248 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 261 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 262 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 263 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.78 |
| Metatranscriptomes | 0.22 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.89 |
| Nodule | 0 |
| Rhizoplane | 12.96 |
| Rhizosphere | 80.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000040 | 3300001977 | Bacteria | 12452 |
| 2 | JGI24743J22301_10008983 | 3300001991 | Bacteria | 1764 |
| 3 | JGI24034J26672_10000824 | 3300002239 | Bacteria | 4021 |
| 4 | JGI25407J50210_10012898 | 3300003373 | Bacteria | 2144 |
| 5 | JGI25407J50210_10024720 | 3300003373 | Bacteria | 1558 |
| 6 | Ga0070658_10021068 | 3300005327 | Bacteria | 5222 |
| 7 | Ga0070683_100001716 | 3300005329 | Bacteria | 17041 |
| 8 | Ga0070690_100293809 | 3300005330 | Bacteria | 1163 |
| 9 | Ga0068869_100043238 | 3300005334 | Bacteria | 3235 |
| 10 | Ga0070666_10076795 | 3300005335 | Bacteria | 2279 |
| 11 | Ga0070682_100000013 | 3300005337 | Bacteria | 254641 |
| 12 | Ga0070682_100000390 | 3300005337 | Bacteria | 29210 |
| 13 | Ga0070682_100047832 | 3300005337 | Bacteria | 2661 |
| 14 | Ga0070682_100098755 | 3300005337 | Bacteria | 1924 |
| 15 | Ga0070689_100028048 | 3300005340 | Bacteria | 4252 |
| 16 | Ga0070691_10006507 | 3300005341 | Bacteria | 5343 |
| 17 | Ga0070687_100021718 | 3300005343 | Bacteria | 3023 |
| 18 | Ga0070661_100019294 | 3300005344 | Bacteria | 4860 |
| 19 | Ga0070692_10016188 | 3300005345 | Bacteria | 3544 |
| 20 | Ga0070668_100025460 | 3300005347 | Bacteria | 4485 |
| 21 | Ga0070675_100008073 | 3300005354 | Bacteria | 8158 |
| 22 | Ga0070674_100000008 | 3300005356 | Bacteria | 143844 |
| 23 | Ga0070674_100063692 | 3300005356 | Bacteria | 2581 |
| 24 | Ga0070674_100371248 | 3300005356 | Unclassified | 1161 |
| 25 | Ga0070673_100110783 | 3300005364 | Bacteria | 2276 |
| 26 | Ga0070688_100000167 | 3300005365 | Bacteria | 35374 |
| 27 | Ga0070688_100000252 | 3300005365 | Bacteria | 28245 |
| 28 | Ga0070659_100001783 | 3300005366 | Bacteria | 15474 |
| 29 | Ga0070659_100024118 | 3300005366 | Bacteria | 4662 |
| 30 | Ga0070667_100295984 | 3300005367 | Bacteria | 1456 |
| 31 | Ga0070709_10383745 | 3300005434 | Bacteria | 1045 |
| 32 | Ga0070714_100032681 | 3300005435 | Bacteria | 4345 |
| 33 | Ga0070713_100000009 | 3300005436 | Bacteria | 153056 |
| 34 | Ga0070711_100229139 | 3300005439 | Bacteria | 1448 |
| 35 | Ga0070700_100004516 | 3300005441 | Bacteria | 7277 |
| 36 | Ga0070694_100159258 | 3300005444 | Bacteria | 1655 |
| 37 | Ga0070663_100018499 | 3300005455 | Bacteria | 4571 |
| 38 | Ga0070663_100087391 | 3300005455 | Bacteria | 2304 |
| 39 | Ga0070663_100229331 | 3300005455 | Bacteria | 1462 |
| 40 | Ga0070681_10025352 | 3300005458 | Bacteria | 5965 |
| 41 | Ga0068867_100016658 | 3300005459 | Bacteria | 5220 |
| 42 | Ga0070685_10000127 | 3300005466 | Bacteria | 48844 |
| 43 | Ga0070685_10000232 | 3300005466 | Bacteria | 36782 |
| 44 | Ga0070685_10072805 | 3300005466 | Bacteria | 2041 |
| 45 | Ga0070684_100004649 | 3300005535 | Bacteria | 10477 |
| 46 | Ga0070684_100027761 | 3300005535 | Bacteria | 4781 |
| 47 | Ga0070684_100332778 | 3300005535 | Bacteria | 1396 |
| 48 | Ga0068853_100059882 | 3300005539 | Bacteria | 3290 |
| 49 | Ga0068853_100310041 | 3300005539 | Unclassified | 1461 |
| 50 | Ga0068853_100361251 | 3300005539 | Bacteria | 1353 |
| 51 | Ga0070686_100090373 | 3300005544 | Bacteria | 2047 |
| 52 | Ga0070686_100293798 | 3300005544 | Bacteria | 1203 |
| 53 | Ga0070696_100187738 | 3300005546 | Unclassified | 1537 |
| 54 | Ga0070665_100021566 | 3300005548 | Bacteria | 6476 |
| 55 | Ga0070665_100066787 | 3300005548 | Bacteria | 3608 |
| 56 | Ga0070665_100116749 | 3300005548 | Bacteria | 2671 |
| 57 | Ga0070704_100208958 | 3300005549 | Bacteria | 1580 |
| 58 | Ga0068857_100175935 | 3300005577 | Bacteria | 1947 |
| 59 | Ga0068857_100226974 | 3300005577 | Bacteria | 1707 |
| 60 | Ga0068854_100000114 | 3300005578 | Bacteria | 55089 |
| 61 | Ga0068854_100125622 | 3300005578 | Bacteria | 1953 |
| 62 | Ga0068854_100128961 | 3300005578 | Bacteria | 1929 |
| 63 | Ga0068852_100035107 | 3300005616 | Bacteria | 4178 |
| 64 | Ga0068859_100535189 | 3300005617 | Bacteria | 1266 |
| 65 | Ga0068864_100000045 | 3300005618 | Bacteria | 154739 |
| 66 | Ga0068864_100111753 | 3300005618 | Bacteria | 2434 |
| 67 | Ga0068866_10000031 | 3300005718 | Bacteria | 56943 |
| 68 | Ga0068861_100256401 | 3300005719 | Bacteria | 1495 |
| 69 | Ga0068851_10018718 | 3300005834 | Bacteria | 3340 |
| 70 | Ga0068851_10019736 | 3300005834 | Bacteria | 3258 |
| 71 | Ga0068858_100000267 | 3300005842 | Bacteria | 55818 |
| 72 | Ga0068858_100000590 | 3300005842 | Bacteria | 37996 |
| 73 | Ga0081455_10021655 | 3300005937 | Bacteria | 6023 |
| 74 | Ga0081455_10031938 | 3300005937 | Bacteria | 4753 |
| 75 | Ga0081455_10045577 | 3300005937 | Bacteria | 3814 |
| 76 | Ga0081455_10182078 | 3300005937 | Bacteria | 1589 |
| 77 | Ga0081538_10000045 | 3300005981 | Bacteria | 114622 |
| 78 | Ga0081538_10000066 | 3300005981 | Bacteria | 98455 |
| 79 | Ga0081538_10114926 | 3300005981 | Bacteria | 1310 |
| 80 | Ga0075365_10008195 | 3300006038 | Bacteria | 5913 |
| 81 | Ga0075365_10021745 | 3300006038 | Bacteria | 4007 |
| 82 | Ga0075365_10023349 | 3300006038 | Bacteria | 3889 |
| 83 | Ga0075363_100001743 | 3300006048 | Bacteria | 8473 |
| 84 | Ga0075363_100011512 | 3300006048 | Bacteria | 4237 |
| 85 | Ga0075364_10051781 | 3300006051 | Bacteria | 2682 |
| 86 | Ga0070712_100053703 | 3300006175 | Bacteria | 2814 |
| 87 | Ga0075428_100282820 | 3300006844 | Bacteria | 1785 |
| 88 | Ga0075430_100019802 | 3300006846 | Bacteria | 5723 |
| 89 | Ga0075430_100026911 | 3300006846 | Bacteria | 4890 |
| 90 | Ga0075431_100004107 | 3300006847 | Bacteria | 14218 |
| 91 | Ga0075431_100013653 | 3300006847 | Bacteria | 8209 |
| 92 | Ga0075431_100483663 | 3300006847 | Unclassified | 1230 |
| 93 | Ga0075433_10001110 | 3300006852 | Bacteria | 19439 |
| 94 | Ga0075434_100071436 | 3300006871 | Bacteria | 3462 |
| 95 | Ga0075429_100009655 | 3300006880 | Bacteria | 8369 |
| 96 | Ga0068865_100020725 | 3300006881 | Bacteria | 4267 |
| 97 | Ga0075436_100177666 | 3300006914 | Bacteria | 1504 |
| 98 | Ga0097620_100535246 | 3300006931 | Bacteria | 1266 |
| 99 | Ga0075435_100048988 | 3300007076 | Unclassified | 3396 |
| 100 | Ga0111539_10197850 | 3300009094 | Unclassified | 2344 |
| 101 | Ga0111539_10292035 | 3300009094 | Bacteria | 1897 |
| 102 | Ga0105245_10000016 | 3300009098 | Bacteria | 204372 |
| 103 | Ga0105245_10019296 | 3300009098 | Bacteria | 5969 |
| 104 | Ga0105245_10060727 | 3300009098 | Bacteria | 3405 |
| 105 | Ga0105247_10001765 | 3300009101 | Bacteria | 15212 |
| 106 | Ga0105247_10044718 | 3300009101 | Bacteria | 2716 |
| 107 | Ga0114129_10082970 | 3300009147 | Bacteria | 4453 |
| 108 | Ga0114129_10153385 | 3300009147 | Unclassified | 3152 |
| 109 | Ga0114129_10315792 | 3300009147 | Unclassified | 2078 |
| 110 | Ga0114129_10559131 | 3300009147 | Bacteria | 1487 |
| 111 | Ga0114129_10912307 | 3300009147 | Unclassified | 1112 |
| 112 | Ga0105243_10005428 | 3300009148 | Bacteria | 9950 |
| 113 | Ga0105243_10093782 | 3300009148 | Bacteria | 2478 |
| 114 | Ga0105242_10000194 | 3300009176 | Bacteria | 47231 |
| 115 | Ga0105242_10002110 | 3300009176 | Bacteria | 15676 |
| 116 | Ga0105242_10163200 | 3300009176 | Bacteria | 1952 |
| 117 | Ga0105237_10150989 | 3300009545 | Bacteria | 2320 |
| 118 | Ga0105249_10230141 | 3300009553 | Unclassified | 1828 |
| 119 | Ga0105239_10092004 | 3300010375 | Bacteria | 3347 |
| 120 | Ga0157370_10017638 | 3300013104 | Bacteria | 7197 |
| 121 | Ga0157370_10090783 | 3300013104 | Bacteria | 2868 |
| 122 | Ga0157369_10000110 | 3300013105 | Bacteria | 115514 |
| 123 | Ga0157374_10120480 | 3300013296 | Bacteria | 2532 |
| 124 | Ga0163162_10584992 | 3300013306 | Bacteria | 1243 |
| 125 | Ga0157372_10071933 | 3300013307 | Bacteria | 3896 |
| 126 | Ga0157375_10000112 | 3300013308 | Bacteria | 79146 |
| 127 | Ga0157375_10061162 | 3300013308 | Bacteria | 3738 |
| 128 | Ga0157375_10063673 | 3300013308 | Bacteria | 3670 |
| 129 | Ga0163163_10218729 | 3300014325 | Bacteria | 1953 |
| 130 | Ga0157377_10008665 | 3300014745 | Bacteria | 4967 |
| 131 | Ga0157379_10542311 | 3300014968 | Bacteria | 1082 |
| 132 | Ga0157376_10059627 | 3300014969 | Bacteria | 3200 |
| 133 | Ga0224712_10122368 | 3300022467 | Bacteria | 1128 |
| 134 | Ga0207656_10000188 | 3300025321 | Bacteria | 22311 |
| 135 | Ga0207656_10011673 | 3300025321 | Bacteria | 3323 |
| 136 | Ga0207682_10002513 | 3300025893 | Bacteria | 8198 |
| 137 | Ga0207642_10000034 | 3300025899 | Bacteria | 43362 |
| 138 | Ga0207642_10012692 | 3300025899 | Bacteria | 3051 |
| 139 | Ga0207710_10003137 | 3300025900 | Bacteria | 7404 |
| 140 | Ga0207688_10056110 | 3300025901 | Bacteria | 2212 |
| 141 | Ga0207680_10181737 | 3300025903 | Bacteria | 1423 |
| 142 | Ga0207643_10024653 | 3300025908 | Bacteria | 3319 |
| 143 | Ga0207705_10017858 | 3300025909 | Bacteria | 5073 |
| 144 | Ga0207707_10125178 | 3300025912 | Bacteria | 2248 |
| 145 | Ga0207693_10015717 | 3300025915 | Bacteria | 6065 |
| 146 | Ga0207662_10053071 | 3300025918 | Bacteria | 2414 |
| 147 | Ga0207657_10009312 | 3300025919 | Bacteria | 9891 |
| 148 | Ga0207649_10000063 | 3300025920 | Bacteria | 96360 |
| 149 | Ga0207649_10013391 | 3300025920 | Bacteria | 4579 |
| 150 | Ga0207652_10000349 | 3300025921 | Bacteria | 47896 |
| 151 | Ga0207650_10099223 | 3300025925 | Bacteria | 2238 |
| 152 | Ga0207659_10003385 | 3300025926 | Bacteria | 9559 |
| 153 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 154 | Ga0207687_10000018 | 3300025927 | Bacteria | 236159 |
| 155 | Ga0207687_10000177 | 3300025927 | Bacteria | 42164 |
| 156 | Ga0207687_10002435 | 3300025927 | Bacteria | 12638 |
| 157 | Ga0207687_10013820 | 3300025927 | Bacteria | 5273 |
| 158 | Ga0207700_10000025 | 3300025928 | Bacteria | 147429 |
| 159 | Ga0207700_10151241 | 3300025928 | Bacteria | 1918 |
| 160 | Ga0207664_10330208 | 3300025929 | Bacteria | 1347 |
| 161 | Ga0207690_10003058 | 3300025932 | Bacteria | 10080 |
| 162 | Ga0207690_10015179 | 3300025932 | Bacteria | 4664 |
| 163 | Ga0207706_10000068 | 3300025933 | Bacteria | 105795 |
| 164 | Ga0207686_10000033 | 3300025934 | Bacteria | 143602 |
| 165 | Ga0207686_10001393 | 3300025934 | Bacteria | 13742 |
| 166 | Ga0207686_10006883 | 3300025934 | Bacteria | 6121 |
| 167 | Ga0207686_10172699 | 3300025934 | Bacteria | 1526 |
| 168 | Ga0207709_10007874 | 3300025935 | Bacteria | 5905 |
| 169 | Ga0207709_10039513 | 3300025935 | Bacteria | 2818 |
| 170 | Ga0207669_10000004 | 3300025937 | Bacteria | 196828 |
| 171 | Ga0207669_10099472 | 3300025937 | Bacteria | 1918 |
| 172 | Ga0207669_10213782 | 3300025937 | Bacteria | 1410 |
| 173 | Ga0207665_10146905 | 3300025939 | Bacteria | 1685 |
| 174 | Ga0207665_10211422 | 3300025939 | Bacteria | 1417 |
| 175 | Ga0207711_10000020 | 3300025941 | Bacteria | 363325 |
| 176 | Ga0207661_10000610 | 3300025944 | Bacteria | 22901 |
| 177 | Ga0207661_10007089 | 3300025944 | Bacteria | 7964 |
| 178 | Ga0207661_10098705 | 3300025944 | Bacteria | 2448 |
| 179 | Ga0207661_10106593 | 3300025944 | Bacteria | 2362 |
| 180 | Ga0207661_10159335 | 3300025944 | Bacteria | 1957 |
| 181 | Ga0207661_10231009 | 3300025944 | Bacteria | 1638 |
| 182 | Ga0207679_10028283 | 3300025945 | Bacteria | 3887 |
| 183 | Ga0207667_10558824 | 3300025949 | Bacteria | 1157 |
| 184 | Ga0207651_10013700 | 3300025960 | Bacteria | 4651 |
| 185 | Ga0207651_10133987 | 3300025960 | Bacteria | 1902 |
| 186 | Ga0207712_10015480 | 3300025961 | Bacteria | 4922 |
| 187 | Ga0207668_10028792 | 3300025972 | Bacteria | 3636 |
| 188 | Ga0207640_10000015 | 3300025981 | Bacteria | 215411 |
| 189 | Ga0207640_10008136 | 3300025981 | Bacteria | 5808 |
| 190 | Ga0207640_10038313 | 3300025981 | Bacteria | 3024 |
| 191 | Ga0207658_10017073 | 3300025986 | Bacteria | 4998 |
| 192 | Ga0207658_10065959 | 3300025986 | Bacteria | 2721 |
| 193 | Ga0207703_10000020 | 3300026035 | Bacteria | 251603 |
| 194 | Ga0207703_10000040 | 3300026035 | Bacteria | 168191 |
| 195 | Ga0207703_10516885 | 3300026035 | Bacteria | 1122 |
| 196 | Ga0207639_10000915 | 3300026041 | Bacteria | 19983 |
| 197 | Ga0207639_10257000 | 3300026041 | Bacteria | 1526 |
| 198 | Ga0207678_10001881 | 3300026067 | Bacteria | 19142 |
| 199 | Ga0207678_10050868 | 3300026067 | Bacteria | 3579 |
| 200 | Ga0207708_10081025 | 3300026075 | Bacteria | 2494 |
| 201 | Ga0207702_10000060 | 3300026078 | Bacteria | 125473 |
| 202 | Ga0207702_10001486 | 3300026078 | Bacteria | 23204 |
| 203 | Ga0207641_10001324 | 3300026088 | Bacteria | 24526 |
| 204 | Ga0207648_10025576 | 3300026089 | Bacteria | 5256 |
| 205 | Ga0207676_10000016 | 3300026095 | Bacteria | 311561 |
| 206 | Ga0207676_10137956 | 3300026095 | Bacteria | 2084 |
| 207 | Ga0207674_10068212 | 3300026116 | Bacteria | 3579 |
| 208 | Ga0207675_100029822 | 3300026118 | Bacteria | 5079 |
| 209 | Ga0207675_100180654 | 3300026118 | Bacteria | 2020 |
| 210 | Ga0207675_100400929 | 3300026118 | Bacteria | 1352 |
| 211 | Ga0207683_10187876 | 3300026121 | Bacteria | 1875 |
| 212 | Ga0207698_10197979 | 3300026142 | Bacteria | 1796 |
| 213 | Ga0207428_10008841 | 3300027907 | Bacteria | 9079 |
| 214 | Ga0207428_10339829 | 3300027907 | Bacteria | 1106 |
| 215 | Ga0268266_10000020 | 3300028379 | Bacteria | 527065 |
| 216 | Ga0268266_10000085 | 3300028379 | Bacteria | 201288 |
| 217 | Ga0268266_10006388 | 3300028379 | Bacteria | 10798 |
| 218 | Ga0268264_10138332 | 3300028381 | Bacteria | 2168 |
| 219 | Ga0265337_1000259 | 3300028556 | Bacteria | 28578 |
| 220 | Ga0265326_10000007 | 3300028558 | Bacteria | 223057 |
| 221 | Ga0265319_1000025 | 3300028563 | Bacteria | 142639 |
| 222 | Ga0265322_10000001 | 3300028654 | Bacteria | 543854 |
| 223 | Ga0265336_10001017 | 3300028666 | Bacteria | 13775 |
| 224 | Ga0265338_10000473 | 3300028800 | Bacteria | 71777 |
| 225 | Ga0265324_10002362 | 3300029957 | Bacteria | 9735 |
| 226 | Ga0265320_10000002 | 3300031240 | Bacteria | 542875 |
| 227 | Ga0265325_10009920 | 3300031241 | Bacteria | 5540 |
| 228 | Ga0265329_10009101 | 3300031242 | Bacteria | 3724 |
| 229 | Ga0265331_10002720 | 3300031250 | Bacteria | 11779 |
| 230 | Ga0265331_10033488 | 3300031250 | Bacteria | 2540 |
| 231 | Ga0265327_10000011 | 3300031251 | Bacteria | 543807 |
| 232 | Ga0265316_10054160 | 3300031344 | Bacteria | 3141 |
| 233 | Ga0265314_10000058 | 3300031711 | Bacteria | 167476 |
| 234 | Ga0307409_100137861 | 3300031995 | Bacteria | 2097 |
| 235 | Ga0307416_100211335 | 3300032002 | Bacteria | 1851 |
| 236 | Ga0307416_100281493 | 3300032002 | Bacteria | 1640 |
| 237 | Ga0307415_100532533 | 3300032126 | Unclassified | 1033 |
| 238 | Ga0373931_0175411 | 3300035691 | Bacteria | 1266 |
| 239 | Ga0395900_0104093 | 3300037418 | Bacteria | 2916 |
| 240 | Ga0395901_0021396 | 3300038443 | Bacteria | 6626 |
| 241 | Ga0395901_0042505 | 3300038443 | Bacteria | 4712 |
| 242 | Ga0395901_0131300 | 3300038443 | Bacteria | 2632 |
| 243 | Ga0395901_0317267 | 3300038443 | Bacteria | 1613 |
| 244 | Ga0466963_0000001 | 3300044694 | Bacteria | 110556 |
| 245 | Ga0466957_0004093 | 3300044842 | Bacteria | 8077 |
| 246 | Ga0466958_0191992 | 3300045836 | Bacteria | 1298 |
| 247 | Ga0466967_0000065 | 3300045976 | Bacteria | 39018 |
| 248 | Ga0495592_0000036 | 3300046454 | Bacteria | 125461 |
| 249 | Ga0495592_0043483 | 3300046454 | Bacteria | 3361 |
| 250 | Ga0495603_0000030 | 3300046455 | Bacteria | 60760 |
| 251 | Ga0495603_0202970 | 3300046455 | Bacteria | 1146 |
| 252 | Ga0495629_0251781 | 3300046459 | Bacteria | 1215 |
| 253 | Ga0495653_0140060 | 3300046463 | Bacteria | 1703 |
| 254 | Ga0495606_0000221 | 3300046507 | Bacteria | 101157 |
| 255 | Ga0495608_0000068 | 3300046511 | Bacteria | 79694 |
| 256 | Ga0495608_0014505 | 3300046511 | Bacteria | 5466 |
| 257 | Ga0495620_0000951 | 3300046515 | Bacteria | 17818 |
| 258 | Ga0495628_0000144 | 3300046516 | Bacteria | 61254 |
| 259 | Ga0495628_0032541 | 3300046516 | Bacteria | 4210 |
| 260 | Ga0495628_0040858 | 3300046516 | Bacteria | 3704 |
| 261 | Ga0495628_0043470 | 3300046516 | Bacteria | 3579 |
| 262 | Ga0495628_0089409 | 3300046516 | Bacteria | 2385 |
| 263 | Ga0495630_0000251 | 3300046517 | Bacteria | 43193 |
| 264 | Ga0495630_0312353 | 3300046517 | Unclassified | 1201 |
| 265 | Ga0495652_0005533 | 3300046529 | Bacteria | 11884 |
| 266 | Ga0495652_0128883 | 3300046529 | Bacteria | 2006 |
| 267 | Ga0495640_0010855 | 3300046533 | Bacteria | 7026 |
| 268 | Ga0495640_0024327 | 3300046533 | Bacteria | 4408 |
| 269 | Ga0495586_0001076 | 3300046535 | Bacteria | 15423 |
| 270 | Ga0495587_0049897 | 3300046536 | Bacteria | 2476 |
| 271 | Ga0495587_0062587 | 3300046536 | Bacteria | 2178 |
| 272 | Ga0495645_0005903 | 3300046543 | Bacteria | 8456 |
| 273 | Ga0495645_0041022 | 3300046543 | Bacteria | 3375 |
| 274 | Ga0495667_0000032 | 3300046559 | Bacteria | 143493 |
| 275 | Ga0495656_0000532 | 3300046615 | Bacteria | 12411 |
| 276 | Ga0495634_0000018 | 3300046642 | Bacteria | 121323 |
| 277 | Ga0495634_0004028 | 3300046642 | Bacteria | 11655 |
| 278 | Ga0495634_0004337 | 3300046642 | Bacteria | 11178 |
| 279 | Ga0495625_0000766 | 3300046660 | Bacteria | 44778 |
| 280 | Ga0495635_0015200 | 3300046663 | Bacteria | 5385 |
| 281 | Ga0495657_0000004 | 3300046675 | Bacteria | 266465 |
| 282 | Ga0495657_0008222 | 3300046675 | Bacteria | 7997 |
| 283 | Ga0495623_0227299 | 3300046679 | Bacteria | 1060 |
| 284 | Ga0495658_0000005 | 3300046683 | Bacteria | 149839 |
| 285 | Ga0495658_0052484 | 3300046683 | Bacteria | 2312 |
| 286 | Ga0495658_0206541 | 3300046683 | Bacteria | 1226 |
| 287 | Ga0495669_0021311 | 3300046684 | Bacteria | 2812 |
| 288 | Ga0495613_0009169 | 3300046689 | Bacteria | 7334 |
| 289 | Ga0495600_0012893 | 3300046809 | Bacteria | 5237 |
| 290 | Ga0495600_0052833 | 3300046809 | Bacteria | 2653 |
| 291 | Ga0495600_0073921 | 3300046809 | Bacteria | 2226 |
| 292 | Ga0495604_0000398 | 3300047317 | Bacteria | 39366 |
| 293 | Ga0495604_0073290 | 3300047317 | Bacteria | 2585 |
| 294 | Ga0495604_0131686 | 3300047317 | Bacteria | 1796 |
| 295 | Ga0495674_0000251 | 3300047319 | Bacteria | 45351 |
| 296 | Ga0495676_0001271 | 3300047321 | Bacteria | 21659 |
| 297 | Ga0495676_0228032 | 3300047321 | Unclassified | 1280 |
| 298 | Ga0495680_0000317 | 3300047322 | Bacteria | 53949 |
| 299 | Ga0495680_0004162 | 3300047322 | Bacteria | 13902 |
| 300 | Ga0495680_0234289 | 3300047322 | Bacteria | 1306 |
| 301 | Ga0495675_0000380 | 3300047444 | Bacteria | 30671 |
| 302 | Ga0495684_0080723 | 3300047471 | Bacteria | 2469 |
| 303 | Ga0495602_0084137 | 3300048088 | Bacteria | 2662 |
| 304 | Ga0495602_0092591 | 3300048088 | Bacteria | 2503 |
| 305 | Ga0495614_0059273 | 3300048089 | Bacteria | 1644 |
| 306 | Ga0496100_0000002 | 3300048903 | Bacteria | 489057 |
| 307 | Ga0496100_0000018 | 3300048903 | Bacteria | 162451 |
| 308 | Ga0496100_0043698 | 3300048903 | Bacteria | 2867 |
| 309 | Ga0496100_0144354 | 3300048903 | Bacteria | 1691 |
| 310 | Ga0496101_0000001 | 3300048904 | Bacteria | 489057 |
| 311 | Ga0496101_0000308 | 3300048904 | Bacteria | 33852 |
| 312 | Ga0496102_0000039 | 3300048905 | Bacteria | 198306 |
| 313 | Ga0496102_0036225 | 3300048905 | Bacteria | 4444 |
| 314 | Ga0496102_0202851 | 3300048905 | Bacteria | 1869 |
| 315 | Ga0496102_0516332 | 3300048905 | Bacteria | 1117 |
| 316 | Ga0496103_0000008 | 3300048906 | Bacteria | 340474 |
| 317 | Ga0496103_0004689 | 3300048906 | Bacteria | 8273 |
| 318 | Ga0496103_0007480 | 3300048906 | Bacteria | 6508 |
| 319 | Ga0496104_0000004 | 3300048907 | Bacteria | 641830 |
| 320 | Ga0496104_0000129 | 3300048907 | Bacteria | 69982 |
| 321 | Ga0496104_0010598 | 3300048907 | Bacteria | 8234 |
| 322 | Ga0496104_0017296 | 3300048907 | Bacteria | 6563 |
| 323 | Ga0496104_0030287 | 3300048907 | Bacteria | 5027 |
| 324 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 325 | Ga0496105_0007931 | 3300048908 | Bacteria | 8250 |
| 326 | Ga0496105_0199700 | 3300048908 | Bacteria | 1632 |
| 327 | Ga0496106_0000098 | 3300048909 | Bacteria | 66098 |
| 328 | Ga0496106_0000229 | 3300048909 | Bacteria | 39124 |
| 329 | Ga0496106_0069920 | 3300048909 | Bacteria | 2680 |
| 330 | Ga0496106_0190748 | 3300048909 | Bacteria | 1629 |
| 331 | Ga0496107_0000006 | 3300048910 | Bacteria | 258746 |
| 332 | Ga0496107_0000013 | 3300048910 | Bacteria | 178284 |
| 333 | Ga0496107_0008011 | 3300048910 | Bacteria | 7293 |
| 334 | Ga0496107_0018829 | 3300048910 | Bacteria | 4866 |
| 335 | Ga0496107_0293223 | 3300048910 | Bacteria | 1211 |
| 336 | Ga0496108_0000062 | 3300048911 | Bacteria | 122391 |
| 337 | Ga0496108_0001220 | 3300048911 | Bacteria | 20175 |
| 338 | Ga0496108_0003808 | 3300048911 | Bacteria | 12080 |
| 339 | Ga0496108_0008000 | 3300048911 | Bacteria | 8578 |
| 340 | Ga0496108_0021083 | 3300048911 | Bacteria | 5354 |
| 341 | Ga0496108_0026678 | 3300048911 | Bacteria | 4767 |
| 342 | Ga0496108_0134647 | 3300048911 | Bacteria | 2125 |
| 343 | Ga0496109_0000007 | 3300048912 | Bacteria | 247554 |
| 344 | Ga0496109_0000168 | 3300048912 | Bacteria | 64462 |
| 345 | Ga0496109_0002556 | 3300048912 | Bacteria | 15232 |
| 346 | Ga0496109_0061146 | 3300048912 | Bacteria | 3443 |
| 347 | Ga0496109_0088772 | 3300048912 | Bacteria | 2857 |
| 348 | Ga0496109_0294979 | 3300048912 | Bacteria | 1529 |
| 349 | Ga0496109_0303207 | 3300048912 | Bacteria | 1506 |
| 350 | Ga0496110_0041280 | 3300048913 | Bacteria | 4025 |
| 351 | Ga0496110_0054649 | 3300048913 | Bacteria | 3512 |
| 352 | Ga0496110_0120734 | 3300048913 | Bacteria | 2361 |
| 353 | Ga0496111_0092942 | 3300048914 | Bacteria | 2211 |
| 354 | Ga0496111_0118479 | 3300048914 | Bacteria | 1954 |
| 355 | Ga0496112_0237643 | 3300048915 | Bacteria | 1775 |
| 356 | Ga0496113_0000029 | 3300048916 | Bacteria | 61873 |
| 357 | Ga0496113_0011015 | 3300048916 | Bacteria | 6010 |
| 358 | Ga0496113_0012202 | 3300048916 | Bacteria | 5767 |
| 359 | Ga0496113_0142085 | 3300048916 | Bacteria | 1889 |
| 360 | Ga0496113_0186048 | 3300048916 | Bacteria | 1647 |
| 361 | Ga0496114_0006594 | 3300048917 | Bacteria | 9150 |
| 362 | Ga0496115_0000003 | 3300048918 | Bacteria | 354994 |
| 363 | Ga0496115_0000125 | 3300048918 | Bacteria | 69936 |
| 364 | Ga0496115_0002008 | 3300048918 | Bacteria | 14544 |
| 365 | Ga0496115_0126147 | 3300048918 | Bacteria | 2108 |
| 366 | Ga0496116_0000680 | 3300048919 | Bacteria | 44185 |
| 367 | Ga0496117_0044456 | 3300048920 | Bacteria | 3217 |
| 368 | Ga0496118_0023216 | 3300048921 | Bacteria | 5394 |
| 369 | Ga0496119_0004679 | 3300048922 | Bacteria | 13483 |
| 370 | Ga0496119_0018061 | 3300048922 | Bacteria | 5269 |
| 371 | Ga0496120_0089241 | 3300048923 | Bacteria | 1651 |
| 372 | Ga0496121_0021463 | 3300048924 | Bacteria | 6322 |
| 373 | Ga0496124_0177755 | 3300048927 | Bacteria | 1641 |
| 374 | Ga0496125_0012682 | 3300048928 | Bacteria | 8343 |
| 375 | Ga0496125_0120854 | 3300048928 | Bacteria | 1869 |
| 376 | Ga0496126_0041262 | 3300048929 | Bacteria | 4272 |
| 377 | Ga0501032_0006299 | 3300049569 | Bacteria | 8741 |
| 378 | Ga0501033_0000223 | 3300049570 | Bacteria | 54471 |
| 379 | Ga0501033_0128136 | 3300049570 | Bacteria | 1840 |
| 380 | Ga0501036_0007859 | 3300049572 | Bacteria | 8723 |
| 381 | Ga0501037_0000315 | 3300049573 | Bacteria | 41061 |
| 382 | Ga0501038_0000323 | 3300049574 | Bacteria | 41119 |
| 383 | Ga0501039_0007406 | 3300049575 | Bacteria | 8371 |
| 384 | Ga0501039_0043662 | 3300049575 | Bacteria | 3462 |
| 385 | Ga0501040_0068231 | 3300049576 | Bacteria | 2452 |
| 386 | Ga0501040_0217543 | 3300049576 | Unclassified | 1359 |
| 387 | Ga0501042_0084770 | 3300049578 | Bacteria | 2272 |
| 388 | Ga0501042_0092117 | 3300049578 | Bacteria | 2176 |
| 389 | Ga0501043_0007344 | 3300049579 | Bacteria | 8744 |
| 390 | Ga0501046_0000443 | 3300049580 | Bacteria | 41637 |
| 391 | Ga0501046_0248001 | 3300049580 | Bacteria | 1312 |
| 392 | Ga0501047_0000321 | 3300049581 | Bacteria | 55420 |
| 393 | Ga0501048_0006771 | 3300049582 | Bacteria | 8705 |
| 394 | Ga0501068_0067392 | 3300049584 | Bacteria | 2181 |
| 395 | Ga0501069_0007104 | 3300049585 | Bacteria | 5865 |
| 396 | Ga0501070_0000354 | 3300049586 | Bacteria | 41627 |
| 397 | Ga0501070_0058413 | 3300049586 | Bacteria | 3197 |
| 398 | Ga0501070_0202006 | 3300049586 | Bacteria | 1632 |
| 399 | Ga0501071_0025819 | 3300049587 | Bacteria | 4117 |
| 400 | Ga0501072_0005666 | 3300049588 | Bacteria | 9510 |
| 401 | Ga0501072_0052336 | 3300049588 | Bacteria | 3215 |
| 402 | Ga0501073_0009026 | 3300049589 | Bacteria | 7360 |
| 403 | Ga0501074_0092143 | 3300049590 | Bacteria | 2170 |
| 404 | Ga0501074_0097021 | 3300049590 | Bacteria | 2110 |
| 405 | Ga0501074_0183690 | 3300049590 | Bacteria | 1491 |
| 406 | Ga0501074_0184800 | 3300049590 | Bacteria | 1486 |
| 407 | Ga0501075_0026545 | 3300049591 | Bacteria | 4265 |
| 408 | Ga0501076_0062835 | 3300049592 | Bacteria | 2958 |
| 409 | Ga0501077_0019045 | 3300049593 | Bacteria | 4340 |
| 410 | Ga0501079_0075406 | 3300049741 | Bacteria | 2608 |
| 411 | Ga0501080_0058243 | 3300049742 | Bacteria | 3596 |
| 412 | Ga0501080_0271548 | 3300049742 | Bacteria | 1543 |
| 413 | Ga0501081_0070069 | 3300049743 | Bacteria | 2443 |
| 414 | Ga0501083_0089921 | 3300049744 | Bacteria | 2028 |
| 415 | Ga0501035_0000380 | 3300049822 | Bacteria | 51102 |
| 416 | Ga0501044_0000681 | 3300049823 | Bacteria | 41084 |
| 417 | Ga0501044_0374724 | 3300049823 | Bacteria | 1339 |
| 418 | Ga0501044_0580430 | 3300049823 | Bacteria | 1015 |
| 419 | Ga0501045_0018748 | 3300049824 | Bacteria | 4925 |
| 420 | nmdc:mga03n38_41005_c1 | 3300050490 | Bacteria | 2015 |
| 421 | nmdc:mga00v17_15198_c1 | 3300050491 | Bacteria | 4315 |
| 422 | nmdc:mga00v17_156919_c1 | 3300050491 | Bacteria | 1463 |
| 423 | nmdc:mga00v17_41175_c1 | 3300050491 | Bacteria | 2773 |
| 424 | nmdc:mga0yw44_2016_c1 | 3300050492 | Bacteria | 8448 |
| 425 | nmdc:mga0yw44_39112_c1 | 3300050492 | Bacteria | 2810 |
| 426 | nmdc:mga0yw44_40987_c1 | 3300050492 | Bacteria | 2755 |
| 427 | nmdc:mga0yw44_62400_c1 | 3300050492 | Bacteria | 2289 |
| 428 | nmdc:mga06z11_35222_c1 | 3300050494 | Bacteria | 2462 |
| 429 | nmdc:mga05p37_236951_c1 | 3300050507 | Unclassified | 2196 |
| 430 | nmdc:mga05p37_49566_c1 | 3300050507 | Bacteria | 5165 |
| 431 | nmdc:mga05p37_683787_c1 | 3300050507 | Unclassified | 1143 |
| 432 | nmdc:mga05p37_69788_c1 | 3300050507 | Bacteria | 4322 |
| 433 | nmdc:mga09592_30990_c1 | 3300050508 | Bacteria | 4454 |
| 434 | nmdc:mga0qj67_17294_c1 | 3300050509 | Bacteria | 5481 |
| 435 | nmdc:mga06r32_407488_c1 | 3300050510 | Unclassified | 1341 |
| 436 | nmdc:mga06r32_6900_c1 | 3300050510 | Bacteria | 10210 |
| 437 | nmdc:mga08y16_501650_c1 | 3300050511 | Bacteria | 1233 |
| 438 | nmdc:mga0n895_256752_c1 | 3300050512 | Bacteria | 1774 |
| 439 | nmdc:mga0a205_11_c1 | 3300050515 | Bacteria | 121735 |
| 440 | nmdc:mga0a205_16346_c2 | 3300050515 | Bacteria | 5331 |
| 441 | Ga0495601_0000435 | 3300053077 | Bacteria | 21841 |
| 442 | Ga0495601_0001639 | 3300053077 | Bacteria | 12351 |
| 443 | Ga0495601_0027849 | 3300053077 | Bacteria | 3496 |
| 444 | Ga0495601_0142269 | 3300053077 | Bacteria | 1565 |
| 445 | Ga0495612_0000068 | 3300053078 | Bacteria | 47169 |
| 446 | Ga0495612_0007177 | 3300053078 | Bacteria | 4559 |
| 447 | Ga0495655_0000001 | 3300053083 | Bacteria | 419518 |
| 448 | Ga0495595_0000003 | 3300053084 | Bacteria | 266465 |
| 449 | Ga0495595_0014813 | 3300053084 | Bacteria | 3315 |
| 450 | Ga0495619_0000021 | 3300053085 | Bacteria | 187095 |
| 451 | Ga0495619_0000055 | 3300053085 | Bacteria | 95570 |
| 452 | Ga0495619_0000106 | 3300053085 | Bacteria | 62413 |
| 453 | Ga0495619_0000589 | 3300053085 | Bacteria | 24114 |
| 454 | Ga0495619_0001139 | 3300053085 | Bacteria | 17465 |
| 455 | Ga0495619_0005075 | 3300053085 | Bacteria | 8363 |
| 456 | Ga0495619_0012149 | 3300053085 | Bacteria | 5422 |
| 457 | Ga0495619_0195692 | 3300053085 | Unclassified | 1399 |
| 458 | Ga0500641_0005914 | 3300053096 | Bacteria | 4329 |
| 459 | Ga0500595_004881 | 3300053119 | Bacteria | 5932 |
| 460 | Ga0500628_000065 | 3300053129 | Bacteria | 28526 |
| 461 | Ga0501082_0042477 | 3300060353 | Bacteria | 3920 |
| 462 | Ga0501082_0049003 | 3300060353 | Bacteria | 3642 |
| 463 | Ga0530510_0001247 | 3300061734 | Bacteria | 16980 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013306 | Ga0163162_10584992 | Ga0163162_105849921 | 274 |
| 2 | 3300048905 | Ga0496102_0202851 | Ga0496102_0202851_345_1304 | 274 |
| 3 | 3300048906 | Ga0496103_0007480 | Ga0496103_0007480_113_1072 | 274 |
| 4 | 3300048920 | Ga0496117_0044456 | Ga0496117_0044456_2125_3084 | 274 |
| 5 | 3300048921 | Ga0496118_0023216 | Ga0496118_0023216_4318_5277 | 274 |
| 6 | 3300048919 | Ga0496116_0000680 | Ga0496116_0000680_7963_8922 | 275 |
| 7 | 3300048922 | Ga0496119_0004679 | Ga0496119_0004679_3632_4591 | 275 |
| 8 | 3300053119 | Ga0500595_004881 | Ga0500595_004881_1702_2661 | 277 |
| 9 | 3300049823 | Ga0501044_0374724 | Ga0501044_0374724_211_1170 | 278 |
| 10 | 3300049742 | Ga0501080_0271548 | Ga0501080_0271548_43_1002 | 280 |
| 11 | 3300014968 | Ga0157379_10542311 | Ga0157379_105423111 | 281 |
| 12 | 3300048903 | Ga0496100_0144354 | Ga0496100_0144354_180_1148 | 282 |
| 13 | 3300013308 | Ga0157375_10063673 | Ga0157375_100636733 | 289 |
| 14 | 3300046535 | Ga0495586_0001076 | Ga0495586_0001076_6131_7036 | 290 |
| 15 | 3300046809 | Ga0495600_0052833 | Ga0495600_0052833_311_1219 | 290 |
| 16 | 3300047317 | Ga0495604_0131686 | Ga0495604_0131686_134_1042 | 290 |
| 17 | 3300053085 | Ga0495619_0012149 | Ga0495619_0012149_1231_2139 | 290 |
| 18 | 3300005330 | Ga0070690_100293809 | Ga0070690_1002938092 | 291 |
| 19 | 3300005548 | Ga0070665_100021566 | Ga0070665_1000215664 | 291 |
| 20 | 3300028379 | Ga0268266_10006388 | Ga0268266_100063886 | 291 |
| 21 | 3300049585 | Ga0501069_0007104 | Ga0501069_0007104_177_1085 | 292 |
| 22 | 3300048929 | Ga0496126_0041262 | Ga0496126_0041262_2985_3902 | 293 |
| 23 | 3300005335 | Ga0070666_10076795 | Ga0070666_100767953 | 294 |
| 24 | 3300005367 | Ga0070667_100295984 | Ga0070667_1002959841 | 294 |
| 25 | 3300005548 | Ga0070665_100116749 | Ga0070665_1001167492 | 294 |
| 26 | 3300025986 | Ga0207658_10017073 | Ga0207658_100170731 | 294 |
| 27 | 3300028379 | Ga0268266_10000085 | Ga0268266_10000085127 | 294 |
| 28 | 3300053085 | Ga0495619_0000021 | Ga0495619_0000021_156826_157752 | 294 |
| 29 | 3300048088 | Ga0495602_0084137 | Ga0495602_0084137_1073_1963 | 295 |
| 30 | 3300003373 | JGI25407J50210_10024720 | JGI25407J50210_100247202 | 296 |
| 31 | 3300005834 | Ga0068851_10018718 | Ga0068851_100187184 | 296 |
| 32 | 3300005981 | Ga0081538_10000066 | Ga0081538_1000006661 | 296 |
| 33 | 3300025321 | Ga0207656_10011673 | Ga0207656_100116734 | 296 |
| 34 | 3300005937 | Ga0081455_10182078 | Ga0081455_101820782 | 297 |
| 35 | 3300005981 | Ga0081538_10114926 | Ga0081538_101149261 | 297 |
| 36 | 3300049590 | Ga0501074_0097021 | Ga0501074_0097021_266_1180 | 297 |
| 37 | 3300006048 | Ga0075363_100001743 | Ga0075363_10000174310 | 298 |
| 38 | 3300049586 | Ga0501070_0058413 | Ga0501070_0058413_289_1188 | 298 |
| 39 | 3300049588 | Ga0501072_0052336 | Ga0501072_0052336_255_1172 | 298 |
| 40 | 3300049590 | Ga0501074_0092143 | Ga0501074_0092143_725_1642 | 298 |
| 41 | 3300050491 | nmdc:mga00v17_15198_c1 | nmdc:mga00v17_15198_c1_874_1851 | 298 |
| 42 | 3300050494 | nmdc:mga06z11_35222_c1 | nmdc:mga06z11_35222_c1_918_1847 | 298 |
| 43 | 3300001991 | JGI24743J22301_10008983 | JGI24743J22301_100089832 | 299 |
| 44 | 3300005327 | Ga0070658_10021068 | Ga0070658_100210682 | 299 |
| 45 | 3300005329 | Ga0070683_100001716 | Ga0070683_1000017165 | 299 |
| 46 | 3300005334 | Ga0068869_100043238 | Ga0068869_1000432383 | 299 |
| 47 | 3300005337 | Ga0070682_100000390 | Ga0070682_10000039015 | 299 |
| 48 | 3300005340 | Ga0070689_100028048 | Ga0070689_1000280483 | 299 |
| 49 | 3300005343 | Ga0070687_100021718 | Ga0070687_1000217183 | 299 |
| 50 | 3300005344 | Ga0070661_100019294 | Ga0070661_1000192943 | 299 |
| 51 | 3300005345 | Ga0070692_10016188 | Ga0070692_100161882 | 299 |
| 52 | 3300005347 | Ga0070668_100025460 | Ga0070668_1000254604 | 299 |
| 53 | 3300005354 | Ga0070675_100008073 | Ga0070675_1000080739 | 299 |
| 54 | 3300005356 | Ga0070674_100371248 | Ga0070674_1003712481 | 299 |
| 55 | 3300005364 | Ga0070673_100110783 | Ga0070673_1001107832 | 299 |
| 56 | 3300005366 | Ga0070659_100001783 | Ga0070659_1000017833 | 299 |
| 57 | 3300005441 | Ga0070700_100004516 | Ga0070700_1000045168 | 299 |
| 58 | 3300005455 | Ga0070663_100018499 | Ga0070663_1000184994 | 299 |
| 59 | 3300005459 | Ga0068867_100016658 | Ga0068867_1000166582 | 299 |
| 60 | 3300005535 | Ga0070684_100004649 | Ga0070684_10000464910 | 299 |
| 61 | 3300005539 | Ga0068853_100310041 | Ga0068853_1003100412 | 299 |
| 62 | 3300005548 | Ga0070665_100066787 | Ga0070665_1000667872 | 299 |
| 63 | 3300005577 | Ga0068857_100175935 | Ga0068857_1001759352 | 299 |
| 64 | 3300005578 | Ga0068854_100128961 | Ga0068854_1001289612 | 299 |
| 65 | 3300005616 | Ga0068852_100035107 | Ga0068852_1000351073 | 299 |
| 66 | 3300005617 | Ga0068859_100535189 | Ga0068859_1005351891 | 299 |
| 67 | 3300005618 | Ga0068864_100111753 | Ga0068864_1001117531 | 299 |
| 68 | 3300005834 | Ga0068851_10019736 | Ga0068851_100197362 | 299 |
| 69 | 3300006038 | Ga0075365_10008195 | Ga0075365_100081952 | 299 |
| 70 | 3300006881 | Ga0068865_100020725 | Ga0068865_1000207255 | 299 |
| 71 | 3300006931 | Ga0097620_100535246 | Ga0097620_1005352461 | 299 |
| 72 | 3300009098 | Ga0105245_10019296 | Ga0105245_100192965 | 299 |
| 73 | 3300009148 | Ga0105243_10005428 | Ga0105243_100054282 | 299 |
| 74 | 3300010375 | Ga0105239_10092004 | Ga0105239_100920043 | 299 |
| 75 | 3300013307 | Ga0157372_10071933 | Ga0157372_100719332 | 299 |
| 76 | 3300014745 | Ga0157377_10008665 | Ga0157377_100086654 | 299 |
| 77 | 3300025901 | Ga0207688_10056110 | Ga0207688_100561102 | 299 |
| 78 | 3300025908 | Ga0207643_10024653 | Ga0207643_100246534 | 299 |
| 79 | 3300025909 | Ga0207705_10017858 | Ga0207705_100178586 | 299 |
| 80 | 3300025918 | Ga0207662_10053071 | Ga0207662_100530713 | 299 |
| 81 | 3300025919 | Ga0207657_10009312 | Ga0207657_100093123 | 299 |
| 82 | 3300025920 | Ga0207649_10013391 | Ga0207649_100133911 | 299 |
| 83 | 3300025925 | Ga0207650_10099223 | Ga0207650_100992232 | 299 |
| 84 | 3300025926 | Ga0207659_10003385 | Ga0207659_1000338511 | 299 |
| 85 | 3300025927 | Ga0207687_10013820 | Ga0207687_100138204 | 299 |
| 86 | 3300025932 | Ga0207690_10003058 | Ga0207690_100030587 | 299 |
| 87 | 3300025935 | Ga0207709_10007874 | Ga0207709_100078746 | 299 |
| 88 | 3300025944 | Ga0207661_10106593 | Ga0207661_101065932 | 299 |
| 89 | 3300025944 | Ga0207661_10159335 | Ga0207661_101593353 | 299 |
| 90 | 3300025945 | Ga0207679_10028283 | Ga0207679_100282834 | 299 |
| 91 | 3300025960 | Ga0207651_10133987 | Ga0207651_101339871 | 299 |
| 92 | 3300025972 | Ga0207668_10028792 | Ga0207668_100287924 | 299 |
| 93 | 3300025981 | Ga0207640_10038313 | Ga0207640_100383133 | 299 |
| 94 | 3300026041 | Ga0207639_10257000 | Ga0207639_102570002 | 299 |
| 95 | 3300026067 | Ga0207678_10001881 | Ga0207678_1000188119 | 299 |
| 96 | 3300026075 | Ga0207708_10081025 | Ga0207708_100810253 | 299 |
| 97 | 3300026089 | Ga0207648_10025576 | Ga0207648_100255766 | 299 |
| 98 | 3300026095 | Ga0207676_10137956 | Ga0207676_101379563 | 299 |
| 99 | 3300026116 | Ga0207674_10068212 | Ga0207674_100682124 | 299 |
| 100 | 3300026118 | Ga0207675_100180654 | Ga0207675_1001806542 | 299 |
| 101 | 3300026142 | Ga0207698_10197979 | Ga0207698_101979792 | 299 |
| 102 | 3300028381 | Ga0268264_10138332 | Ga0268264_101383322 | 299 |
| 103 | 3300048909 | Ga0496106_0190748 | Ga0496106_0190748_415_1404 | 299 |
| 104 | 3300048910 | Ga0496107_0008011 | Ga0496107_0008011_5616_6605 | 299 |
| 105 | 3300048911 | Ga0496108_0008000 | Ga0496108_0008000_3286_4275 | 299 |
| 106 | 3300048912 | Ga0496109_0088772 | Ga0496109_0088772_1520_2509 | 299 |
| 107 | 3300048916 | Ga0496113_0142085 | Ga0496113_0142085_623_1612 | 299 |
| 108 | 3300050491 | nmdc:mga00v17_41175_c1 | nmdc:mga00v17_41175_c1_1520_2509 | 299 |
| 109 | 3300003373 | JGI25407J50210_10012898 | JGI25407J50210_100128982 | 301 |
| 110 | 3300005337 | Ga0070682_100000013 | Ga0070682_100000013131 | 301 |
| 111 | 3300005337 | Ga0070682_100047832 | Ga0070682_1000478322 | 301 |
| 112 | 3300005337 | Ga0070682_100098755 | Ga0070682_1000987552 | 301 |
| 113 | 3300005434 | Ga0070709_10383745 | Ga0070709_103837451 | 301 |
| 114 | 3300005439 | Ga0070711_100229139 | Ga0070711_1002291391 | 301 |
| 115 | 3300005444 | Ga0070694_100159258 | Ga0070694_1001592582 | 301 |
| 116 | 3300005455 | Ga0070663_100229331 | Ga0070663_1002293311 | 301 |
| 117 | 3300005458 | Ga0070681_10025352 | Ga0070681_100253525 | 301 |
| 118 | 3300005466 | Ga0070685_10072805 | Ga0070685_100728052 | 301 |
| 119 | 3300005535 | Ga0070684_100027761 | Ga0070684_1000277612 | 301 |
| 120 | 3300005535 | Ga0070684_100332778 | Ga0070684_1003327781 | 301 |
| 121 | 3300005539 | Ga0068853_100059882 | Ga0068853_1000598823 | 301 |
| 122 | 3300005544 | Ga0070686_100293798 | Ga0070686_1002937982 | 301 |
| 123 | 3300005546 | Ga0070696_100187738 | Ga0070696_1001877382 | 301 |
| 124 | 3300005549 | Ga0070704_100208958 | Ga0070704_1002089581 | 301 |
| 125 | 3300005577 | Ga0068857_100226974 | Ga0068857_1002269742 | 301 |
| 126 | 3300005578 | Ga0068854_100125622 | Ga0068854_1001256222 | 301 |
| 127 | 3300005719 | Ga0068861_100256401 | Ga0068861_1002564012 | 301 |
| 128 | 3300005842 | Ga0068858_100000590 | Ga0068858_1000005908 | 301 |
| 129 | 3300005937 | Ga0081455_10021655 | Ga0081455_100216552 | 301 |
| 130 | 3300005937 | Ga0081455_10045577 | Ga0081455_100455774 | 301 |
| 131 | 3300005981 | Ga0081538_10000045 | Ga0081538_10000045106 | 301 |
| 132 | 3300006038 | Ga0075365_10021745 | Ga0075365_100217452 | 301 |
| 133 | 3300006038 | Ga0075365_10023349 | Ga0075365_100233492 | 301 |
| 134 | 3300006048 | Ga0075363_100011512 | Ga0075363_1000115122 | 301 |
| 135 | 3300006051 | Ga0075364_10051781 | Ga0075364_100517813 | 301 |
| 136 | 3300006175 | Ga0070712_100053703 | Ga0070712_1000537033 | 301 |
| 137 | 3300006844 | Ga0075428_100282820 | Ga0075428_1002828202 | 301 |
| 138 | 3300006846 | Ga0075430_100026911 | Ga0075430_1000269115 | 301 |
| 139 | 3300006847 | Ga0075431_100004107 | Ga0075431_1000041077 | 301 |
| 140 | 3300006852 | Ga0075433_10001110 | Ga0075433_1000111023 | 301 |
| 141 | 3300006871 | Ga0075434_100071436 | Ga0075434_1000714362 | 301 |
| 142 | 3300006914 | Ga0075436_100177666 | Ga0075436_1001776661 | 301 |
| 143 | 3300007076 | Ga0075435_100048988 | Ga0075435_1000489884 | 301 |
| 144 | 3300009094 | Ga0111539_10197850 | Ga0111539_101978502 | 301 |
| 145 | 3300009094 | Ga0111539_10292035 | Ga0111539_102920352 | 301 |
| 146 | 3300009098 | Ga0105245_10000016 | Ga0105245_10000016109 | 301 |
| 147 | 3300009098 | Ga0105245_10060727 | Ga0105245_100607273 | 301 |
| 148 | 3300009147 | Ga0114129_10082970 | Ga0114129_100829704 | 301 |
| 149 | 3300009147 | Ga0114129_10153385 | Ga0114129_101533852 | 301 |
| 150 | 3300009147 | Ga0114129_10315792 | Ga0114129_103157921 | 301 |
| 151 | 3300009147 | Ga0114129_10559131 | Ga0114129_105591312 | 301 |
| 152 | 3300009147 | Ga0114129_10912307 | Ga0114129_109123071 | 301 |
| 153 | 3300009545 | Ga0105237_10150989 | Ga0105237_101509894 | 301 |
| 154 | 3300009553 | Ga0105249_10230141 | Ga0105249_102301412 | 301 |
| 155 | 3300013296 | Ga0157374_10120480 | Ga0157374_101204802 | 301 |
| 156 | 3300014969 | Ga0157376_10059627 | Ga0157376_100596273 | 301 |
| 157 | 3300025893 | Ga0207682_10002513 | Ga0207682_100025138 | 301 |
| 158 | 3300025903 | Ga0207680_10181737 | Ga0207680_101817372 | 301 |
| 159 | 3300025912 | Ga0207707_10125178 | Ga0207707_101251784 | 301 |
| 160 | 3300025915 | Ga0207693_10015717 | Ga0207693_100157173 | 301 |
| 161 | 3300025920 | Ga0207649_10000063 | Ga0207649_1000006355 | 301 |
| 162 | 3300025921 | Ga0207652_10000349 | Ga0207652_1000034932 | 301 |
| 163 | 3300025927 | Ga0207687_10000018 | Ga0207687_10000018115 | 301 |
| 164 | 3300025927 | Ga0207687_10000177 | Ga0207687_1000017737 | 301 |
| 165 | 3300025933 | Ga0207706_10000068 | Ga0207706_10000068107 | 301 |
| 166 | 3300025937 | Ga0207669_10213782 | Ga0207669_102137822 | 301 |
| 167 | 3300025939 | Ga0207665_10211422 | Ga0207665_102114221 | 301 |
| 168 | 3300025944 | Ga0207661_10000610 | Ga0207661_1000061012 | 301 |
| 169 | 3300025944 | Ga0207661_10007089 | Ga0207661_100070894 | 301 |
| 170 | 3300025944 | Ga0207661_10231009 | Ga0207661_102310092 | 301 |
| 171 | 3300025949 | Ga0207667_10558824 | Ga0207667_105588242 | 301 |
| 172 | 3300025960 | Ga0207651_10013700 | Ga0207651_100137005 | 301 |
| 173 | 3300025961 | Ga0207712_10015480 | Ga0207712_100154803 | 301 |
| 174 | 3300025981 | Ga0207640_10008136 | Ga0207640_100081363 | 301 |
| 175 | 3300026035 | Ga0207703_10000020 | Ga0207703_1000002027 | 301 |
| 176 | 3300026035 | Ga0207703_10516885 | Ga0207703_105168852 | 301 |
| 177 | 3300026041 | Ga0207639_10000915 | Ga0207639_100009153 | 301 |
| 178 | 3300026078 | Ga0207702_10001486 | Ga0207702_1000148622 | 301 |
| 179 | 3300026118 | Ga0207675_100400929 | Ga0207675_1004009292 | 301 |
| 180 | 3300026121 | Ga0207683_10187876 | Ga0207683_101878761 | 301 |
| 181 | 3300027907 | Ga0207428_10008841 | Ga0207428_100088417 | 301 |
| 182 | 3300027907 | Ga0207428_10339829 | Ga0207428_103398292 | 301 |
| 183 | 3300028379 | Ga0268266_10000020 | Ga0268266_100000208 | 301 |
| 184 | 3300031995 | Ga0307409_100137861 | Ga0307409_1001378612 | 301 |
| 185 | 3300032002 | Ga0307416_100211335 | Ga0307416_1002113352 | 301 |
| 186 | 3300032002 | Ga0307416_100281493 | Ga0307416_1002814932 | 301 |
| 187 | 3300032126 | Ga0307415_100532533 | Ga0307415_1005325331 | 301 |
| 188 | 3300035691 | Ga0373931_0175411 | Ga0373931_0175411_167_1072 | 301 |
| 189 | 3300037418 | Ga0395900_0104093 | Ga0395900_0104093_1246_2151 | 301 |
| 190 | 3300038443 | Ga0395901_0021396 | Ga0395901_0021396_4161_5066 | 301 |
| 191 | 3300038443 | Ga0395901_0042505 | Ga0395901_0042505_874_1779 | 301 |
| 192 | 3300038443 | Ga0395901_0131300 | Ga0395901_0131300_1308_2213 | 301 |
| 193 | 3300038443 | Ga0395901_0317267 | Ga0395901_0317267_349_1254 | 301 |
| 194 | 3300044694 | Ga0466963_0000001 | Ga0466963_0000001_94909_95820 | 301 |
| 195 | 3300046454 | Ga0495592_0000036 | Ga0495592_0000036_92983_93906 | 301 |
| 196 | 3300046455 | Ga0495603_0202970 | Ga0495603_0202970_175_1080 | 301 |
| 197 | 3300046507 | Ga0495606_0000221 | Ga0495606_0000221_3252_4160 | 301 |
| 198 | 3300046515 | Ga0495620_0000951 | Ga0495620_0000951_4246_5169 | 301 |
| 199 | 3300046516 | Ga0495628_0043470 | Ga0495628_0043470_1310_2218 | 301 |
| 200 | 3300046533 | Ga0495640_0010855 | Ga0495640_0010855_5254_6159 | 301 |
| 201 | 3300046536 | Ga0495587_0049897 | Ga0495587_0049897_841_1761 | 301 |
| 202 | 3300046615 | Ga0495656_0000532 | Ga0495656_0000532_77_982 | 301 |
| 203 | 3300046642 | Ga0495634_0000018 | Ga0495634_0000018_13822_14745 | 301 |
| 204 | 3300046679 | Ga0495623_0227299 | Ga0495623_0227299_49_957 | 301 |
| 205 | 3300046683 | Ga0495658_0000005 | Ga0495658_0000005_136261_137181 | 301 |
| 206 | 3300047317 | Ga0495604_0073290 | Ga0495604_0073290_1497_2402 | 301 |
| 207 | 3300047322 | Ga0495680_0000317 | Ga0495680_0000317_7744_8652 | 301 |
| 208 | 3300048903 | Ga0496100_0000002 | Ga0496100_0000002_243745_244653 | 301 |
| 209 | 3300048903 | Ga0496100_0043698 | Ga0496100_0043698_1488_2393 | 301 |
| 210 | 3300048904 | Ga0496101_0000001 | Ga0496101_0000001_243745_244653 | 301 |
| 211 | 3300048905 | Ga0496102_0036225 | Ga0496102_0036225_3265_4170 | 301 |
| 212 | 3300048906 | Ga0496103_0004689 | Ga0496103_0004689_4728_5633 | 301 |
| 213 | 3300048907 | Ga0496104_0000129 | Ga0496104_0000129_48019_48924 | 301 |
| 214 | 3300048907 | Ga0496104_0030287 | Ga0496104_0030287_3599_4504 | 301 |
| 215 | 3300048908 | Ga0496105_0007931 | Ga0496105_0007931_654_1559 | 301 |
| 216 | 3300048908 | Ga0496105_0199700 | Ga0496105_0199700_469_1374 | 301 |
| 217 | 3300048909 | Ga0496106_0000098 | Ga0496106_0000098_19421_20329 | 301 |
| 218 | 3300048909 | Ga0496106_0069920 | Ga0496106_0069920_390_1295 | 301 |
| 219 | 3300048910 | Ga0496107_0000013 | Ga0496107_0000013_71467_72375 | 301 |
| 220 | 3300048910 | Ga0496107_0018829 | Ga0496107_0018829_3273_4178 | 301 |
| 221 | 3300048910 | Ga0496107_0293223 | Ga0496107_0293223_62_967 | 301 |
| 222 | 3300048911 | Ga0496108_0021083 | Ga0496108_0021083_319_1224 | 301 |
| 223 | 3300048911 | Ga0496108_0026678 | Ga0496108_0026678_149_1057 | 301 |
| 224 | 3300048912 | Ga0496109_0002556 | Ga0496109_0002556_213_1121 | 301 |
| 225 | 3300048912 | Ga0496109_0294979 | Ga0496109_0294979_60_965 | 301 |
| 226 | 3300048912 | Ga0496109_0303207 | Ga0496109_0303207_30_935 | 301 |
| 227 | 3300048913 | Ga0496110_0041280 | Ga0496110_0041280_249_1154 | 301 |
| 228 | 3300048913 | Ga0496110_0054649 | Ga0496110_0054649_2057_2962 | 301 |
| 229 | 3300048914 | Ga0496111_0092942 | Ga0496111_0092942_483_1391 | 301 |
| 230 | 3300048914 | Ga0496111_0118479 | Ga0496111_0118479_229_1134 | 301 |
| 231 | 3300048915 | Ga0496112_0237643 | Ga0496112_0237643_330_1235 | 301 |
| 232 | 3300048916 | Ga0496113_0012202 | Ga0496113_0012202_2752_3657 | 301 |
| 233 | 3300048917 | Ga0496114_0006594 | Ga0496114_0006594_4282_5187 | 301 |
| 234 | 3300048918 | Ga0496115_0126147 | Ga0496115_0126147_1077_1982 | 301 |
| 235 | 3300048927 | Ga0496124_0177755 | Ga0496124_0177755_138_1046 | 301 |
| 236 | 3300048928 | Ga0496125_0012682 | Ga0496125_0012682_136_1041 | 301 |
| 237 | 3300049570 | Ga0501033_0128136 | Ga0501033_0128136_494_1399 | 301 |
| 238 | 3300049575 | Ga0501039_0043662 | Ga0501039_0043662_2214_3119 | 301 |
| 239 | 3300049576 | Ga0501040_0217543 | Ga0501040_0217543_134_1039 | 301 |
| 240 | 3300049580 | Ga0501046_0248001 | Ga0501046_0248001_304_1209 | 301 |
| 241 | 3300049587 | Ga0501071_0025819 | Ga0501071_0025819_1173_2078 | 301 |
| 242 | 3300049588 | Ga0501072_0005666 | Ga0501072_0005666_3875_4780 | 301 |
| 243 | 3300049591 | Ga0501075_0026545 | Ga0501075_0026545_1734_2639 | 301 |
| 244 | 3300049592 | Ga0501076_0062835 | Ga0501076_0062835_374_1282 | 301 |
| 245 | 3300049593 | Ga0501077_0019045 | Ga0501077_0019045_203_1108 | 301 |
| 246 | 3300049743 | Ga0501081_0070069 | Ga0501081_0070069_1478_2383 | 301 |
| 247 | 3300049824 | Ga0501045_0018748 | Ga0501045_0018748_1608_2513 | 301 |
| 248 | 3300050490 | nmdc:mga03n38_41005_c1 | nmdc:mga03n38_41005_c1_1026_1931 | 301 |
| 249 | 3300050491 | nmdc:mga00v17_156919_c1 | nmdc:mga00v17_156919_c1_464_1369 | 301 |
| 250 | 3300050492 | nmdc:mga0yw44_2016_c1 | nmdc:mga0yw44_2016_c1_5899_6804 | 301 |
| 251 | 3300050492 | nmdc:mga0yw44_39112_c1 | nmdc:mga0yw44_39112_c1_1845_2750 | 301 |
| 252 | 3300050492 | nmdc:mga0yw44_40987_c1 | nmdc:mga0yw44_40987_c1_832_1737 | 301 |
| 253 | 3300050492 | nmdc:mga0yw44_62400_c1 | nmdc:mga0yw44_62400_c1_74_979 | 301 |
| 254 | 3300050507 | nmdc:mga05p37_236951_c1 | nmdc:mga05p37_236951_c1_46_951 | 301 |
| 255 | 3300050507 | nmdc:mga05p37_49566_c1 | nmdc:mga05p37_49566_c1_374_1279 | 301 |
| 256 | 3300050507 | nmdc:mga05p37_683787_c1 | nmdc:mga05p37_683787_c1_141_1046 | 301 |
| 257 | 3300050507 | nmdc:mga05p37_69788_c1 | nmdc:mga05p37_69788_c1_1417_2322 | 301 |
| 258 | 3300050510 | nmdc:mga06r32_6900_c1 | nmdc:mga06r32_6900_c1_4803_5708 | 301 |
| 259 | 3300050511 | nmdc:mga08y16_501650_c1 | nmdc:mga08y16_501650_c1_170_1075 | 301 |
| 260 | 3300050512 | nmdc:mga0n895_256752_c1 | nmdc:mga0n895_256752_c1_682_1587 | 301 |
| 261 | 3300050515 | nmdc:mga0a205_16346_c2 | nmdc:mga0a205_16346_c2_1485_2390 | 301 |
| 262 | 3300053077 | Ga0495601_0001639 | Ga0495601_0001639_5064_5972 | 301 |
| 263 | 3300053077 | Ga0495601_0142269 | Ga0495601_0142269_177_1082 | 301 |
| 264 | 3300060353 | Ga0501082_0049003 | Ga0501082_0049003_2266_3171 | 301 |
| 265 | 3300061734 | Ga0530510_0001247 | Ga0530510_0001247_3105_4010 | 301 |
| 266 | 3300001977 | JGI24746J21847_1000040 | JGI24746J21847_10000407 | 302 |
| 267 | 3300002239 | JGI24034J26672_10000824 | JGI24034J26672_100008245 | 302 |
| 268 | 3300005341 | Ga0070691_10006507 | Ga0070691_100065073 | 302 |
| 269 | 3300005356 | Ga0070674_100000008 | Ga0070674_10000000865 | 302 |
| 270 | 3300005356 | Ga0070674_100063692 | Ga0070674_1000636923 | 302 |
| 271 | 3300005365 | Ga0070688_100000167 | Ga0070688_10000016729 | 302 |
| 272 | 3300005365 | Ga0070688_100000252 | Ga0070688_10000025219 | 302 |
| 273 | 3300005366 | Ga0070659_100024118 | Ga0070659_1000241185 | 302 |
| 274 | 3300005435 | Ga0070714_100032681 | Ga0070714_1000326811 | 302 |
| 275 | 3300005436 | Ga0070713_100000009 | Ga0070713_100000009127 | 302 |
| 276 | 3300005455 | Ga0070663_100087391 | Ga0070663_1000873912 | 302 |
| 277 | 3300005466 | Ga0070685_10000127 | Ga0070685_1000012719 | 302 |
| 278 | 3300005466 | Ga0070685_10000232 | Ga0070685_1000023213 | 302 |
| 279 | 3300005539 | Ga0068853_100361251 | Ga0068853_1003612512 | 302 |
| 280 | 3300005544 | Ga0070686_100090373 | Ga0070686_1000903732 | 302 |
| 281 | 3300005578 | Ga0068854_100000114 | Ga0068854_10000011436 | 302 |
| 282 | 3300005618 | Ga0068864_100000045 | Ga0068864_10000004592 | 302 |
| 283 | 3300005718 | Ga0068866_10000031 | Ga0068866_1000003136 | 302 |
| 284 | 3300005842 | Ga0068858_100000267 | Ga0068858_1000002675 | 302 |
| 285 | 3300005937 | Ga0081455_10031938 | Ga0081455_100319381 | 302 |
| 286 | 3300006846 | Ga0075430_100019802 | Ga0075430_1000198022 | 302 |
| 287 | 3300006847 | Ga0075431_100013653 | Ga0075431_1000136532 | 302 |
| 288 | 3300006847 | Ga0075431_100483663 | Ga0075431_1004836631 | 302 |
| 289 | 3300006880 | Ga0075429_100009655 | Ga0075429_1000096553 | 302 |
| 290 | 3300009101 | Ga0105247_10001765 | Ga0105247_100017654 | 302 |
| 291 | 3300009101 | Ga0105247_10044718 | Ga0105247_100447182 | 302 |
| 292 | 3300009148 | Ga0105243_10093782 | Ga0105243_100937821 | 302 |
| 293 | 3300009176 | Ga0105242_10000194 | Ga0105242_100001943 | 302 |
| 294 | 3300009176 | Ga0105242_10002110 | Ga0105242_100021105 | 302 |
| 295 | 3300009176 | Ga0105242_10163200 | Ga0105242_101632002 | 302 |
| 296 | 3300013104 | Ga0157370_10017638 | Ga0157370_100176384 | 302 |
| 297 | 3300013104 | Ga0157370_10090783 | Ga0157370_100907832 | 302 |
| 298 | 3300013105 | Ga0157369_10000110 | Ga0157369_1000011021 | 302 |
| 299 | 3300013308 | Ga0157375_10000112 | Ga0157375_1000011231 | 302 |
| 300 | 3300013308 | Ga0157375_10061162 | Ga0157375_100611622 | 302 |
| 301 | 3300014325 | Ga0163163_10218729 | Ga0163163_102187291 | 302 |
| 302 | 3300022467 | Ga0224712_10122368 | Ga0224712_101223682 | 302 |
| 303 | 3300025321 | Ga0207656_10000188 | Ga0207656_1000018815 | 302 |
| 304 | 3300025899 | Ga0207642_10000034 | Ga0207642_1000003420 | 302 |
| 305 | 3300025899 | Ga0207642_10012692 | Ga0207642_100126922 | 302 |
| 306 | 3300025900 | Ga0207710_10003137 | Ga0207710_100031378 | 302 |
| 307 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007305 | 302 |
| 308 | 3300025927 | Ga0207687_10002435 | Ga0207687_100024354 | 302 |
| 309 | 3300025928 | Ga0207700_10000025 | Ga0207700_10000025128 | 302 |
| 310 | 3300025928 | Ga0207700_10151241 | Ga0207700_101512412 | 302 |
| 311 | 3300025929 | Ga0207664_10330208 | Ga0207664_103302081 | 302 |
| 312 | 3300025932 | Ga0207690_10015179 | Ga0207690_100151792 | 302 |
| 313 | 3300025934 | Ga0207686_10000033 | Ga0207686_1000003392 | 302 |
| 314 | 3300025934 | Ga0207686_10001393 | Ga0207686_100013935 | 302 |
| 315 | 3300025934 | Ga0207686_10006883 | Ga0207686_100068833 | 302 |
| 316 | 3300025934 | Ga0207686_10172699 | Ga0207686_101726992 | 302 |
| 317 | 3300025935 | Ga0207709_10039513 | Ga0207709_100395133 | 302 |
| 318 | 3300025937 | Ga0207669_10000004 | Ga0207669_10000004141 | 302 |
| 319 | 3300025937 | Ga0207669_10099472 | Ga0207669_100994722 | 302 |
| 320 | 3300025939 | Ga0207665_10146905 | Ga0207665_101469051 | 302 |
| 321 | 3300025941 | Ga0207711_10000020 | Ga0207711_1000002050 | 302 |
| 322 | 3300025944 | Ga0207661_10098705 | Ga0207661_100987052 | 302 |
| 323 | 3300025981 | Ga0207640_10000015 | Ga0207640_1000001576 | 302 |
| 324 | 3300025986 | Ga0207658_10065959 | Ga0207658_100659592 | 302 |
| 325 | 3300026035 | Ga0207703_10000040 | Ga0207703_10000040145 | 302 |
| 326 | 3300026067 | Ga0207678_10050868 | Ga0207678_100508684 | 302 |
| 327 | 3300026078 | Ga0207702_10000060 | Ga0207702_10000060105 | 302 |
| 328 | 3300026088 | Ga0207641_10001324 | Ga0207641_100013248 | 302 |
| 329 | 3300026095 | Ga0207676_10000016 | Ga0207676_1000001672 | 302 |
| 330 | 3300026118 | Ga0207675_100029822 | Ga0207675_1000298223 | 302 |
| 331 | 3300028556 | Ga0265337_1000259 | Ga0265337_100025920 | 302 |
| 332 | 3300028558 | Ga0265326_10000007 | Ga0265326_1000000741 | 302 |
| 333 | 3300028563 | Ga0265319_1000025 | Ga0265319_100002559 | 302 |
| 334 | 3300028654 | Ga0265322_10000001 | Ga0265322_10000001264 | 302 |
| 335 | 3300028666 | Ga0265336_10001017 | Ga0265336_100010176 | 302 |
| 336 | 3300028800 | Ga0265338_10000473 | Ga0265338_1000047318 | 302 |
| 337 | 3300029957 | Ga0265324_10002362 | Ga0265324_100023626 | 302 |
| 338 | 3300031240 | Ga0265320_10000002 | Ga0265320_10000002263 | 302 |
| 339 | 3300031241 | Ga0265325_10009920 | Ga0265325_100099205 | 302 |
| 340 | 3300031242 | Ga0265329_10009101 | Ga0265329_100091014 | 302 |
| 341 | 3300031250 | Ga0265331_10002720 | Ga0265331_100027205 | 302 |
| 342 | 3300031250 | Ga0265331_10033488 | Ga0265331_100334884 | 302 |
| 343 | 3300031251 | Ga0265327_10000011 | Ga0265327_10000011263 | 302 |
| 344 | 3300031344 | Ga0265316_10054160 | Ga0265316_100541604 | 302 |
| 345 | 3300031711 | Ga0265314_10000058 | Ga0265314_10000058170 | 302 |
| 346 | 3300044842 | Ga0466957_0004093 | Ga0466957_0004093_973_1884 | 302 |
| 347 | 3300045836 | Ga0466958_0191992 | Ga0466958_0191992_314_1225 | 302 |
| 348 | 3300045976 | Ga0466967_0000065 | Ga0466967_0000065_29658_30569 | 302 |
| 349 | 3300046454 | Ga0495592_0043483 | Ga0495592_0043483_943_1851 | 302 |
| 350 | 3300046455 | Ga0495603_0000030 | Ga0495603_0000030_34050_34958 | 302 |
| 351 | 3300046459 | Ga0495629_0251781 | Ga0495629_0251781_270_1178 | 302 |
| 352 | 3300046463 | Ga0495653_0140060 | Ga0495653_0140060_291_1199 | 302 |
| 353 | 3300046511 | Ga0495608_0000068 | Ga0495608_0000068_94_1005 | 302 |
| 354 | 3300046511 | Ga0495608_0014505 | Ga0495608_0014505_1525_2433 | 302 |
| 355 | 3300046516 | Ga0495628_0000144 | Ga0495628_0000144_41783_42691 | 302 |
| 356 | 3300046516 | Ga0495628_0032541 | Ga0495628_0032541_849_1757 | 302 |
| 357 | 3300046516 | Ga0495628_0040858 | Ga0495628_0040858_76_1002 | 302 |
| 358 | 3300046516 | Ga0495628_0089409 | Ga0495628_0089409_465_1373 | 302 |
| 359 | 3300046517 | Ga0495630_0000251 | Ga0495630_0000251_25590_26498 | 302 |
| 360 | 3300046517 | Ga0495630_0312353 | Ga0495630_0312353_52_960 | 302 |
| 361 | 3300046529 | Ga0495652_0005533 | Ga0495652_0005533_3413_4339 | 302 |
| 362 | 3300046529 | Ga0495652_0128883 | Ga0495652_0128883_843_1751 | 302 |
| 363 | 3300046533 | Ga0495640_0024327 | Ga0495640_0024327_58_966 | 302 |
| 364 | 3300046536 | Ga0495587_0062587 | Ga0495587_0062587_170_1078 | 302 |
| 365 | 3300046543 | Ga0495645_0005903 | Ga0495645_0005903_5718_6644 | 302 |
| 366 | 3300046543 | Ga0495645_0041022 | Ga0495645_0041022_2007_2933 | 302 |
| 367 | 3300046559 | Ga0495667_0000032 | Ga0495667_0000032_48197_49105 | 302 |
| 368 | 3300046642 | Ga0495634_0004028 | Ga0495634_0004028_1631_2539 | 302 |
| 369 | 3300046642 | Ga0495634_0004337 | Ga0495634_0004337_6607_7533 | 302 |
| 370 | 3300046660 | Ga0495625_0000766 | Ga0495625_0000766_23326_24234 | 302 |
| 371 | 3300046663 | Ga0495635_0015200 | Ga0495635_0015200_2641_3549 | 302 |
| 372 | 3300046675 | Ga0495657_0000004 | Ga0495657_0000004_43856_44767 | 302 |
| 373 | 3300046675 | Ga0495657_0008222 | Ga0495657_0008222_3886_4794 | 302 |
| 374 | 3300046683 | Ga0495658_0052484 | Ga0495658_0052484_54_965 | 302 |
| 375 | 3300046683 | Ga0495658_0206541 | Ga0495658_0206541_19_927 | 302 |
| 376 | 3300046684 | Ga0495669_0021311 | Ga0495669_0021311_1861_2769 | 302 |
| 377 | 3300046689 | Ga0495613_0009169 | Ga0495613_0009169_292_1203 | 302 |
| 378 | 3300046809 | Ga0495600_0012893 | Ga0495600_0012893_3549_4460 | 302 |
| 379 | 3300046809 | Ga0495600_0073921 | Ga0495600_0073921_471_1379 | 302 |
| 380 | 3300047317 | Ga0495604_0000398 | Ga0495604_0000398_27834_28745 | 302 |
| 381 | 3300047319 | Ga0495674_0000251 | Ga0495674_0000251_24390_25298 | 302 |
| 382 | 3300047321 | Ga0495676_0001271 | Ga0495676_0001271_14490_15398 | 302 |
| 383 | 3300047321 | Ga0495676_0228032 | Ga0495676_0228032_294_1202 | 302 |
| 384 | 3300047322 | Ga0495680_0004162 | Ga0495680_0004162_9523_10431 | 302 |
| 385 | 3300047322 | Ga0495680_0234289 | Ga0495680_0234289_75_983 | 302 |
| 386 | 3300047444 | Ga0495675_0000380 | Ga0495675_0000380_28296_29207 | 302 |
| 387 | 3300047471 | Ga0495684_0080723 | Ga0495684_0080723_519_1427 | 302 |
| 388 | 3300048088 | Ga0495602_0092591 | Ga0495602_0092591_842_1750 | 302 |
| 389 | 3300048089 | Ga0495614_0059273 | Ga0495614_0059273_633_1541 | 302 |
| 390 | 3300048903 | Ga0496100_0000018 | Ga0496100_0000018_58570_59478 | 302 |
| 391 | 3300048904 | Ga0496101_0000308 | Ga0496101_0000308_7202_8110 | 302 |
| 392 | 3300048905 | Ga0496102_0000039 | Ga0496102_0000039_172592_173500 | 302 |
| 393 | 3300048905 | Ga0496102_0516332 | Ga0496102_0516332_59_985 | 302 |
| 394 | 3300048906 | Ga0496103_0000008 | Ga0496103_0000008_293847_294755 | 302 |
| 395 | 3300048907 | Ga0496104_0000004 | Ga0496104_0000004_127621_128529 | 302 |
| 396 | 3300048907 | Ga0496104_0010598 | Ga0496104_0010598_3616_4551 | 302 |
| 397 | 3300048907 | Ga0496104_0017296 | Ga0496104_0017296_1285_2196 | 302 |
| 398 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_513302_514210 | 302 |
| 399 | 3300048909 | Ga0496106_0000229 | Ga0496106_0000229_25723_26631 | 302 |
| 400 | 3300048910 | Ga0496107_0000006 | Ga0496107_0000006_127493_128401 | 302 |
| 401 | 3300048911 | Ga0496108_0000062 | Ga0496108_0000062_14332_15243 | 302 |
| 402 | 3300048911 | Ga0496108_0001220 | Ga0496108_0001220_3182_4090 | 302 |
| 403 | 3300048911 | Ga0496108_0003808 | Ga0496108_0003808_4767_5675 | 302 |
| 404 | 3300048911 | Ga0496108_0134647 | Ga0496108_0134647_1058_1966 | 302 |
| 405 | 3300048912 | Ga0496109_0000007 | Ga0496109_0000007_91595_92506 | 302 |
| 406 | 3300048912 | Ga0496109_0000168 | Ga0496109_0000168_19952_20860 | 302 |
| 407 | 3300048912 | Ga0496109_0061146 | Ga0496109_0061146_1145_2053 | 302 |
| 408 | 3300048913 | Ga0496110_0120734 | Ga0496110_0120734_522_1430 | 302 |
| 409 | 3300048916 | Ga0496113_0000029 | Ga0496113_0000029_1341_2252 | 302 |
| 410 | 3300048916 | Ga0496113_0011015 | Ga0496113_0011015_101_1009 | 302 |
| 411 | 3300048916 | Ga0496113_0186048 | Ga0496113_0186048_396_1304 | 302 |
| 412 | 3300048918 | Ga0496115_0000003 | Ga0496115_0000003_261398_262306 | 302 |
| 413 | 3300048918 | Ga0496115_0000125 | Ga0496115_0000125_98_1006 | 302 |
| 414 | 3300048918 | Ga0496115_0002008 | Ga0496115_0002008_431_1339 | 302 |
| 415 | 3300048922 | Ga0496119_0018061 | Ga0496119_0018061_633_1568 | 302 |
| 416 | 3300048923 | Ga0496120_0089241 | Ga0496120_0089241_557_1492 | 302 |
| 417 | 3300048924 | Ga0496121_0021463 | Ga0496121_0021463_3703_4638 | 302 |
| 418 | 3300048928 | Ga0496125_0120854 | Ga0496125_0120854_180_1115 | 302 |
| 419 | 3300049569 | Ga0501032_0006299 | Ga0501032_0006299_7710_8627 | 302 |
| 420 | 3300049570 | Ga0501033_0000223 | Ga0501033_0000223_21133_22050 | 302 |
| 421 | 3300049572 | Ga0501036_0007859 | Ga0501036_0007859_7717_8634 | 302 |
| 422 | 3300049573 | Ga0501037_0000315 | Ga0501037_0000315_7723_8640 | 302 |
| 423 | 3300049574 | Ga0501038_0000323 | Ga0501038_0000323_7809_8726 | 302 |
| 424 | 3300049575 | Ga0501039_0007406 | Ga0501039_0007406_7369_8286 | 302 |
| 425 | 3300049576 | Ga0501040_0068231 | Ga0501040_0068231_1436_2353 | 302 |
| 426 | 3300049578 | Ga0501042_0084770 | Ga0501042_0084770_133_1041 | 302 |
| 427 | 3300049578 | Ga0501042_0092117 | Ga0501042_0092117_920_1831 | 302 |
| 428 | 3300049579 | Ga0501043_0007344 | Ga0501043_0007344_7673_8590 | 302 |
| 429 | 3300049580 | Ga0501046_0000443 | Ga0501046_0000443_32751_33668 | 302 |
| 430 | 3300049581 | Ga0501047_0000321 | Ga0501047_0000321_7748_8665 | 302 |
| 431 | 3300049582 | Ga0501048_0006771 | Ga0501048_0006771_78_995 | 302 |
| 432 | 3300049584 | Ga0501068_0067392 | Ga0501068_0067392_105_1022 | 302 |
| 433 | 3300049586 | Ga0501070_0000354 | Ga0501070_0000354_7965_8882 | 302 |
| 434 | 3300049586 | Ga0501070_0202006 | Ga0501070_0202006_24_935 | 302 |
| 435 | 3300049589 | Ga0501073_0009026 | Ga0501073_0009026_986_1903 | 302 |
| 436 | 3300049590 | Ga0501074_0183690 | Ga0501074_0183690_200_1108 | 302 |
| 437 | 3300049590 | Ga0501074_0184800 | Ga0501074_0184800_67_984 | 302 |
| 438 | 3300049741 | Ga0501079_0075406 | Ga0501079_0075406_1594_2511 | 302 |
| 439 | 3300049742 | Ga0501080_0058243 | Ga0501080_0058243_2577_3494 | 302 |
| 440 | 3300049744 | Ga0501083_0089921 | Ga0501083_0089921_82_999 | 302 |
| 441 | 3300049822 | Ga0501035_0000380 | Ga0501035_0000380_42186_43103 | 302 |
| 442 | 3300049823 | Ga0501044_0000681 | Ga0501044_0000681_32422_33339 | 302 |
| 443 | 3300049823 | Ga0501044_0580430 | Ga0501044_0580430_58_966 | 302 |
| 444 | 3300050508 | nmdc:mga09592_30990_c1 | nmdc:mga09592_30990_c1_2894_3805 | 302 |
| 445 | 3300050509 | nmdc:mga0qj67_17294_c1 | nmdc:mga0qj67_17294_c1_1508_2419 | 302 |
| 446 | 3300050510 | nmdc:mga06r32_407488_c1 | nmdc:mga06r32_407488_c1_402_1310 | 302 |
| 447 | 3300050515 | nmdc:mga0a205_11_c1 | nmdc:mga0a205_11_c1_8792_9700 | 302 |
| 448 | 3300053077 | Ga0495601_0000435 | Ga0495601_0000435_5900_6808 | 302 |
| 449 | 3300053077 | Ga0495601_0027849 | Ga0495601_0027849_333_1241 | 302 |
| 450 | 3300053078 | Ga0495612_0000068 | Ga0495612_0000068_37648_38556 | 302 |
| 451 | 3300053078 | Ga0495612_0007177 | Ga0495612_0007177_1614_2522 | 302 |
| 452 | 3300053083 | Ga0495655_0000001 | Ga0495655_0000001_117663_118571 | 302 |
| 453 | 3300053084 | Ga0495595_0000003 | Ga0495595_0000003_43856_44767 | 302 |
| 454 | 3300053084 | Ga0495595_0014813 | Ga0495595_0014813_1501_2412 | 302 |
| 455 | 3300053085 | Ga0495619_0000055 | Ga0495619_0000055_1524_2435 | 302 |
| 456 | 3300053085 | Ga0495619_0000106 | Ga0495619_0000106_61406_62317 | 302 |
| 457 | 3300053085 | Ga0495619_0000589 | Ga0495619_0000589_8669_9577 | 302 |
| 458 | 3300053085 | Ga0495619_0001139 | Ga0495619_0001139_2941_3849 | 302 |
| 459 | 3300053085 | Ga0495619_0005075 | Ga0495619_0005075_7419_8327 | 302 |
| 460 | 3300053085 | Ga0495619_0195692 | Ga0495619_0195692_359_1285 | 302 |
| 461 | 3300053096 | Ga0500641_0005914 | Ga0500641_0005914_1117_2025 | 302 |
| 462 | 3300053129 | Ga0500628_000065 | Ga0500628_000065_20364_21272 | 302 |
| 463 | 3300060353 | Ga0501082_0042477 | Ga0501082_0042477_19_936 | 302 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ea8-assembly5.cif.gz_I-4 | structure of vacv poxin in pre-reactive state with nonhydrolyzable 2'3' cgamp | 0.8449 | 134 | 161 |
| 1t6d-assembly2.cif.gz_B | miras phasing of the aquifex aeolicus ppx/gppa phosphatase: crystal structure of the type ii variant | 0.8044 | 1 | 286 |
| 1t6d-assembly2.cif.gz_B | miras phasing of the aquifex aeolicus ppx/gppa phosphatase: crystal structure of the type ii variant | 0.7691 | 1 | 286 |
| 6ea8-assembly2.cif.gz_B | structure of vacv poxin in pre-reactive state with nonhydrolyzable 2'3' cgamp | 0.7587 | 4 | 34 |
| 3kny-assembly1.cif.gz_A | crystal structure of a two domain protein with unknown function (bt_3535) from bacteroides thetaiotaomicron vpi-5482 at 2.60 a resolution | 0.7423 | 12 | 33 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHV5_1_122_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9493 | 1 | 114 | 3.30.420.40 |
| 3mdqA01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9092 | 1 | 111 | 3.30.420.40 |
| 1t6dB01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9032 | 1 | 113 | 3.30.420.40 |
| af_P9WHV5_1_122_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8821 | 1 | 114 | 3.30.420.40 |
| 2floB01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8753 | 4 | 106 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9DGI3-F1-model_v4 | Ppx/GppA family phosphatase | 0.9499 | 1 | 80 |
|
| AF-W1XLQ9-F1-model_v4 | Ppx/GppA phosphatase | 0.9417 | 2 | 108 |
|
| AF-A0A7V9DGI3-F1-model_v4 | Ppx/GppA family phosphatase | 0.9385 | 1 | 80 |
|
| AF-G2FSD5-F1-model_v4 | Ppx/GppA phosphatase domain protein | 0.9369 | 2 | 111 |
GO:0016462
|
| AF-A0A3D1R0S5-F1-model_v4 | Ppx/GppA phosphatase N-terminal domain-containing protein | 0.9364 | 1 | 99 |
GO:0016462
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar