F449016

General Info

Members Datasets Scaffolds Average Seq Length
462 271 924 212

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2919704043|2919708435
Length 238
Sequence QTSVAAGLPSEAARLHDIAFYFDPISPYAYLAFERLPETLMGLSVRVRYKPVLFAGLLKAHGQRGPAEIVPKRDWTYRHVGWLAQHHGLPLDLPATHPFNPLTLLRMALACTTSDAPGECNRYVAEQVFHHVWRGGQDPNEPARLAALEALLQDHMRQRQKPWLAPDSEEVKQRLRSNTEEALALGLFGVPAIVVNGRVFWGLDGLPMLRDYLDDGAWFTSGAWEAAAALPVGVQRQR

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
175 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
176 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
177 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
178 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
179 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
182 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
183 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
184 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
198 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
199 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
202 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
203 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
204 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
205 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
213 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
214 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
215 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
216 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
246 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
247 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
248 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
249 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
250 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
251 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
252 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
253 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
254 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
255 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
256 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
257 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
258 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
259 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
260 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
261 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
262 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
263 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
264 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
265 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
266 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
267 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
268 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
269 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
270 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
271 2738543013 Variovorax sp. BT01 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.27
Metatranscriptomes 0
Isolates 1.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.5
Nodule 0
Rhizoplane 2.38
Rhizosphere 80.09
Stem 0
Stem Tuber 0
Unclassified 1.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10002861 3300003215 Bacteria 9804
2 rootL2_10001570 3300003322 Bacteria 58042
3 rootL2_10154697 3300003322 Bacteria 1339
4 Ga0055524_1001066 3300003775 Bacteria 16853
5 Ga0055536_1032669 3300003781 Bacteria 1342
6 Ga0055534_1002409 3300003784 Bacteria 6491
7 Ga0055530_10007412 3300003791 Bacteria 4629
8 Ga0055540_1002637 3300003792 Bacteria 9292
9 Ga0055531_10000393 3300003794 Bacteria 42247
10 Ga0055531_10006878 3300003794 Bacteria 6340
11 Ga0055543_1028166 3300004625 Bacteria 991
12 Ga0065165_1000006 3300005262 Bacteria 352298
13 Ga0065165_1000166 3300005262 Bacteria 115866
14 Ga0065165_1001190 3300005262 Bacteria 30067
15 Ga0070658_10195077 3300005327 Bacteria 1707
16 Ga0070658_10399173 3300005327 Bacteria 1181
17 Ga0070658_10444923 3300005327 Bacteria 1116
18 Ga0070676_10001104 3300005328 Bacteria 13479
19 Ga0070676_10084866 3300005328 Bacteria 1928
20 Ga0070690_100001705 3300005330 Bacteria 11594
21 Ga0070670_100010317 3300005331 Bacteria 7972
22 Ga0070670_100176597 3300005331 Bacteria 1853
23 Ga0070670_100222715 3300005331 Bacteria 1641
24 Ga0070670_100267728 3300005331 Bacteria 1490
25 Ga0070677_10129116 3300005333 Bacteria 1151
26 Ga0068869_100004613 3300005334 Bacteria 8591
27 Ga0070666_10002089 3300005335 Bacteria 12139
28 Ga0070666_10090742 3300005335 Bacteria 2099
29 Ga0070682_100191889 3300005337 Bacteria 1435
30 Ga0068868_100042146 3300005338 Bacteria 3560
31 Ga0068868_100048299 3300005338 Bacteria 3338
32 Ga0068868_100157656 3300005338 Bacteria 1873
33 Ga0068868_100688281 3300005338 Bacteria 914
34 Ga0070660_100043006 3300005339 Bacteria 3450
35 Ga0070689_100277220 3300005340 Bacteria 1390
36 Ga0070661_100047356 3300005344 Bacteria 3146
37 Ga0070661_100295354 3300005344 Bacteria 1260
38 Ga0070668_100021512 3300005347 Bacteria 4873
39 Ga0070669_100001069 3300005353 Bacteria 20026
40 Ga0070675_100009912 3300005354 Bacteria 7429
41 Ga0070671_100005866 3300005355 Bacteria 9786
42 Ga0070671_100070936 3300005355 Bacteria 2907
43 Ga0070671_100087271 3300005355 Bacteria 2611
44 Ga0070671_100131896 3300005355 Bacteria 2104
45 Ga0070671_100182706 3300005355 Bacteria 1776
46 Ga0070671_100218346 3300005355 Bacteria 1617
47 Ga0070674_100048490 3300005356 Bacteria 2915
48 Ga0070674_100076678 3300005356 Bacteria 2377
49 Ga0070674_100710700 3300005356 Bacteria 860
50 Ga0070673_100111942 3300005364 Bacteria 2265
51 Ga0070673_100146029 3300005364 Bacteria 1999
52 Ga0070673_100173707 3300005364 Bacteria 1840
53 Ga0070673_100253271 3300005364 Bacteria 1535
54 Ga0070688_100276217 3300005365 Bacteria 1205
55 Ga0070659_100049073 3300005366 Bacteria 3318
56 Ga0070659_100105493 3300005366 Bacteria 2271
57 Ga0070659_100474482 3300005366 Bacteria 1064
58 Ga0070667_100001153 3300005367 Bacteria 23984
59 Ga0070663_100440785 3300005455 Bacteria 1072
60 Ga0070678_100058072 3300005456 Bacteria 2838
61 Ga0070678_100071493 3300005456 Bacteria 2597
62 Ga0070678_100153241 3300005456 Bacteria 1859
63 Ga0070678_100169944 3300005456 Bacteria 1775
64 Ga0070678_100177969 3300005456 Bacteria 1738
65 Ga0070662_100004009 3300005457 Bacteria 9232
66 Ga0070662_100010916 3300005457 Bacteria 5985
67 Ga0068867_100006127 3300005459 Bacteria 8514
68 Ga0068867_100154555 3300005459 Bacteria 1805
69 Ga0068853_100215759 3300005539 Bacteria 1750
70 Ga0068853_100569009 3300005539 Bacteria 1074
71 Ga0070672_100012570 3300005543 Bacteria 5951
72 Ga0070672_100093661 3300005543 Bacteria 2427
73 Ga0070665_100350561 3300005548 Bacteria 1481
74 Ga0068855_100367735 3300005563 Bacteria 1581
75 Ga0070664_100071454 3300005564 Bacteria 2974
76 Ga0070664_100084014 3300005564 Bacteria 2748
77 Ga0070664_100166265 3300005564 Bacteria 1955
78 Ga0070664_100770492 3300005564 Bacteria 899
79 Ga0068854_100038943 3300005578 Bacteria 3346
80 Ga0068854_100158390 3300005578 Bacteria 1751
81 Ga0068852_100020287 3300005616 Bacteria 5283
82 Ga0068852_100076673 3300005616 Bacteria 2952
83 Ga0068859_100008535 3300005617 Bacteria 10364
84 Ga0068864_100007260 3300005618 Bacteria 9111
85 Ga0068864_100041314 3300005618 Bacteria 3944
86 Ga0068864_100349312 3300005618 Bacteria 1395
87 Ga0068864_100517689 3300005618 Bacteria 1150
88 Ga0068866_10007275 3300005718 Bacteria 4633
89 Ga0068861_100005014 3300005719 Bacteria 8926
90 Ga0068861_100309012 3300005719 Bacteria 1372
91 Ga0068851_10114751 3300005834 Bacteria 1442
92 Ga0068851_10123345 3300005834 Bacteria 1394
93 Ga0068851_10165271 3300005834 Unclassified 1218
94 Ga0068863_100013223 3300005841 Bacteria 7961
95 Ga0068863_100028660 3300005841 Bacteria 5316
96 Ga0068863_100120471 3300005841 Bacteria 2501
97 Ga0068863_100138188 3300005841 Bacteria 2328
98 Ga0068863_100293687 3300005841 Bacteria 1576
99 Ga0068858_100001199 3300005842 Bacteria 26879
100 Ga0068860_100001913 3300005843 Bacteria 22095
101 Ga0068862_100005642 3300005844 Bacteria 10450
102 Ga0075365_10290200 3300006038 Bacteria 1151
103 Ga0075365_10450704 3300006038 Bacteria 909
104 Ga0075363_100087073 3300006048 Bacteria 1716
105 Ga0075362_10080828 3300006177 Unclassified 1498
106 Ga0075367_10637420 3300006178 Bacteria 678
107 Ga0075366_10004867 3300006195 Bacteria 7244
108 Ga0075366_10106443 3300006195 Bacteria 1686
109 Ga0075366_10142914 3300006195 Bacteria 1447
110 Ga0097621_100012780 3300006237 Bacteria 6238
111 Ga0068871_100014297 3300006358 Bacteria 5913
112 Ga0068871_100172979 3300006358 Bacteria 1852
113 Ga0068871_100375689 3300006358 Bacteria 1262
114 Ga0075428_100485792 3300006844 Bacteria 1322
115 Ga0075429_100153077 3300006880 Bacteria 2019
116 Ga0068865_100014234 3300006881 Bacteria 5050
117 Ga0075436_100034276 3300006914 Bacteria 3500
118 Ga0097620_100008535 3300006931 Bacteria 10364
119 Ga0075435_100121664 3300007076 Bacteria 2178
120 Ga0111539_10088358 3300009094 Bacteria 3641
121 Ga0105245_10399766 3300009098 Bacteria 1373
122 Ga0114129_10040425 3300009147 Bacteria 6574
123 Ga0114129_10056407 3300009147 Bacteria 5502
124 Ga0105243_10016971 3300009148 Bacteria 5506
125 Ga0105242_10048104 3300009176 Bacteria 3465
126 Ga0105242_10085307 3300009176 Bacteria 2648
127 Ga0105248_10004461 3300009177 Bacteria 15493
128 Ga0105248_10025768 3300009177 Bacteria 6540
129 Ga0105248_10066543 3300009177 Bacteria 4046
130 Ga0105248_10133669 3300009177 Bacteria 2799
131 Ga0105237_10061819 3300009545 Bacteria 3744
132 Ga0105238_10437618 3300009551 Bacteria 1304
133 Ga0105249_10005835 3300009553 Bacteria 10655
134 Ga0105246_10684128 3300011119 Bacteria 897
135 Ga0157319_1000010 3300012497 Bacteria 197331
136 Ga0157369_10184502 3300013105 Bacteria 2194
137 Ga0157374_10028598 3300013296 Bacteria 5036
138 Ga0157374_10066992 3300013296 Bacteria 3374
139 Ga0157374_10480901 3300013296 Bacteria 1245
140 Ga0157378_10263679 3300013297 Bacteria 1654
141 Ga0157378_10298832 3300013297 Bacteria 1557
142 Ga0163162_10030622 3300013306 Bacteria 5331
143 Ga0163162_10587969 3300013306 Bacteria 1240
144 Ga0163162_11227695 3300013306 Bacteria 851
145 Ga0157375_10030567 3300013308 Bacteria 5080
146 Ga0157375_10092222 3300013308 Bacteria 3092
147 Ga0157375_11289522 3300013308 Bacteria 858
148 Ga0163163_10082540 3300014325 Bacteria 3218
149 Ga0163163_10637700 3300014325 Bacteria 1129
150 Ga0163163_10846693 3300014325 Bacteria 978
151 Ga0157380_10000286 3300014326 Bacteria 30329
152 Ga0157380_10305268 3300014326 Bacteria 1468
153 Ga0157379_10012998 3300014968 Bacteria 7286
154 Ga0157379_10051267 3300014968 Bacteria 3686
155 Ga0157379_10583301 3300014968 Bacteria 1042
156 Ga0157376_11100968 3300014969 Bacteria 820
157 Ga0163161_10061255 3300017792 Bacteria 2739
158 Ga0163161_10164178 3300017792 Bacteria 1695
159 Ga0163161_10369130 3300017792 Bacteria 1145
160 Ga0213872_10021147 3300021361 Bacteria 2996
161 Ga0209677_102390 3300025253 Bacteria 7148
162 Ga0209673_1008590 3300025273 Bacteria 4532
163 Ga0209673_1017463 3300025273 Bacteria 2644
164 Ga0209130_1007555 3300025284 Bacteria 3334
165 Ga0209675_1007360 3300025291 Bacteria 4234
166 Ga0209676_1010876 3300025292 Bacteria 3735
167 Ga0209758_1000126 3300025297 Bacteria 189761
168 Ga0209758_1045798 3300025297 Bacteria 1584
169 Ga0209050_1001413 3300025298 Bacteria 25973
170 Ga0209256_1000204 3300025299 Bacteria 112000
171 Ga0209051_1000280 3300025303 Bacteria 83521
172 Ga0209051_1001849 3300025303 Bacteria 16670
173 Ga0209051_1008169 3300025303 Bacteria 5584
174 Ga0209051_1014692 3300025303 Bacteria 3639
175 Ga0209051_1060041 3300025303 Bacteria 1202
176 Ga0209257_1000165 3300025304 Bacteria 172773
177 Ga0209257_1001275 3300025304 Bacteria 30852
178 Ga0209257_1006902 3300025304 Bacteria 7108
179 Ga0207697_10024971 3300025315 Bacteria 2444
180 Ga0207697_10111986 3300025315 Bacteria 1169
181 Ga0207656_10012758 3300025321 Bacteria 3200
182 Ga0207656_10332388 3300025321 Bacteria 756
183 Ga0207682_10128635 3300025893 Bacteria 1129
184 Ga0207642_10001955 3300025899 Bacteria 6354
185 Ga0207688_10015846 3300025901 Bacteria 4089
186 Ga0207680_10000754 3300025903 Bacteria 15248
187 Ga0207680_10284228 3300025903 Bacteria 1150
188 Ga0207645_10012100 3300025907 Bacteria 5864
189 Ga0207645_10090106 3300025907 Bacteria 1972
190 Ga0207645_10180447 3300025907 Bacteria 1385
191 Ga0207643_10045351 3300025908 Bacteria 2483
192 Ga0207705_10168263 3300025909 Bacteria 1649
193 Ga0207705_10366967 3300025909 Bacteria 1111
194 Ga0207705_10415873 3300025909 Bacteria 1041
195 Ga0207705_10422135 3300025909 Bacteria 1033
196 Ga0207662_10029360 3300025918 Bacteria 3186
197 Ga0207649_10138344 3300025920 Bacteria 1663
198 Ga0207649_10203125 3300025920 Bacteria 1401
199 Ga0207649_10791077 3300025920 Bacteria 740
200 Ga0207681_10000311 3300025923 Bacteria 35603
201 Ga0207681_10172616 3300025923 Bacteria 1640
202 Ga0207694_10475591 3300025924 Bacteria 1045
203 Ga0207694_10676928 3300025924 Bacteria 870
204 Ga0207650_10001471 3300025925 Bacteria 16902
205 Ga0207650_10085382 3300025925 Bacteria 2401
206 Ga0207650_10110508 3300025925 Bacteria 2127
207 Ga0207650_10556227 3300025925 Bacteria 962
208 Ga0207659_10330450 3300025926 Bacteria 1260
209 Ga0207687_10042320 3300025927 Bacteria 3132
210 Ga0207644_10033666 3300025931 Bacteria 3583
211 Ga0207644_10098353 3300025931 Bacteria 2193
212 Ga0207644_10208174 3300025931 Bacteria 1545
213 Ga0207690_10189252 3300025932 Bacteria 1555
214 Ga0207706_10004559 3300025933 Bacteria 13007
215 Ga0207706_10063324 3300025933 Bacteria 3256
216 Ga0207706_10074792 3300025933 Bacteria 2978
217 Ga0207706_10200510 3300025933 Bacteria 1750
218 Ga0207706_10246742 3300025933 Bacteria 1560
219 Ga0207686_10031570 3300025934 Bacteria 3146
220 Ga0207686_10099777 3300025934 Bacteria 1936
221 Ga0207709_10003750 3300025935 Bacteria 8945
222 Ga0207670_10444785 3300025936 Bacteria 1044
223 Ga0207669_10024811 3300025937 Bacteria 3228
224 Ga0207704_10004967 3300025938 Bacteria 6119
225 Ga0207665_10157173 3300025939 Bacteria 1633
226 Ga0207691_10073777 3300025940 Bacteria 3078
227 Ga0207691_10102410 3300025940 Bacteria 2554
228 Ga0207691_10121252 3300025940 Bacteria 2317
229 Ga0207691_10229303 3300025940 Bacteria 1609
230 Ga0207691_10276522 3300025940 Bacteria 1445
231 Ga0207691_10318236 3300025940 Bacteria 1334
232 Ga0207711_10006152 3300025941 Bacteria 10143
233 Ga0207711_10038411 3300025941 Bacteria 4071
234 Ga0207711_10348776 3300025941 Bacteria 1370
235 Ga0207689_10035605 3300025942 Bacteria 4135
236 Ga0207661_10474696 3300025944 Bacteria 1141
237 Ga0207679_10353531 3300025945 Bacteria 1281
238 Ga0207667_10391464 3300025949 Unclassified 1415
239 Ga0207651_10029079 3300025960 Bacteria 3497
240 Ga0207651_10064618 3300025960 Bacteria 2562
241 Ga0207651_10411452 3300025960 Bacteria 1152
242 Ga0207712_10023597 3300025961 Bacteria 4062
243 Ga0207668_10003171 3300025972 Bacteria 9631
244 Ga0207640_10602053 3300025981 Bacteria 930
245 Ga0207658_10000459 3300025986 Bacteria 38145
246 Ga0207658_10441436 3300025986 Bacteria 1151
247 Ga0207677_10018408 3300026023 Bacteria 4191
248 Ga0207677_10064150 3300026023 Bacteria 2557
249 Ga0207677_10227924 3300026023 Bacteria 1499
250 Ga0207677_10720378 3300026023 Bacteria 887
251 Ga0207703_10001017 3300026035 Bacteria 26943
252 Ga0207678_10288344 3300026067 Bacteria 1410
253 Ga0207678_10327393 3300026067 Bacteria 1319
254 Ga0207678_10327837 3300026067 Bacteria 1318
255 Ga0207708_10040633 3300026075 Bacteria 3545
256 Ga0207641_10000594 3300026088 Bacteria 39811
257 Ga0207641_10007884 3300026088 Bacteria 8833
258 Ga0207641_10076589 3300026088 Bacteria 2892
259 Ga0207641_10218256 3300026088 Bacteria 1767
260 Ga0207641_10299124 3300026088 Bacteria 1519
261 Ga0207648_10009034 3300026089 Bacteria 9586
262 Ga0207648_10308123 3300026089 Bacteria 1421
263 Ga0207676_10011882 3300026095 Bacteria 6231
264 Ga0207676_10031143 3300026095 Bacteria 4010
265 Ga0207676_10405925 3300026095 Bacteria 1274
266 Ga0207675_100002936 3300026118 Bacteria 16768
267 Ga0207683_10019889 3300026121 Bacteria 5737
268 Ga0207683_10079957 3300026121 Bacteria 2899
269 Ga0207683_10163013 3300026121 Bacteria 2017
270 Ga0207683_10206085 3300026121 Bacteria 1788
271 Ga0207683_10248086 3300026121 Bacteria 1624
272 Ga0207683_10265354 3300026121 Bacteria 1568
273 Ga0207683_10804586 3300026121 Bacteria 872
274 Ga0207698_10009481 3300026142 Bacteria 6211
275 Ga0207698_10049305 3300026142 Bacteria 3204
276 Ga0207698_10051054 3300026142 Bacteria 3160
277 Ga0207698_10144296 3300026142 Bacteria 2056
278 Ga0207698_11300040 3300026142 Bacteria 742
279 Ga0209371_1007586 3300027312 Bacteria 3750
280 Ga0209996_1000973 3300027395 Bacteria 3405
281 Ga0209968_1000333 3300027526 Bacteria 7874
282 Ga0209970_1000798 3300027614 Bacteria 5530
283 Ga0209983_1031770 3300027665 Bacteria 1127
284 Ga0209966_1000161 3300027695 Bacteria 28311
285 Ga0209974_10126737 3300027876 Bacteria 908
286 Ga0268265_10002354 3300028380 Bacteria 14315
287 Ga0268264_10001252 3300028381 Bacteria 24211
288 Ga0307515_10001531 3300028794 Bacteria 51712
289 Ga0307515_10044101 3300028794 Bacteria 6904
290 Ga0268256_1014071 3300030500 Bacteria 2393
291 Ga0307513_10000072 3300031456 Bacteria 138840
292 Ga0307513_10005502 3300031456 Bacteria 16725
293 Ga0307509_10019604 3300031507 Bacteria 7704
294 Ga0307408_100850415 3300031548 Bacteria 832
295 Ga0307516_10266789 3300031730 Bacteria 1400
296 Ga0307410_10106594 3300031852 Bacteria 2020
297 Ga0307412_10047991 3300031911 Bacteria 2806
298 Ga0307412_10086687 3300031911 Bacteria 2180
299 Ga0307416_100501412 3300032002 Bacteria 1278
300 Ga0307415_100813955 3300032126 Bacteria 854
301 Ga0373923_0111096 3300035111 Bacteria 1217
302 Ga0373946_0093396 3300035171 Bacteria 1337
303 Ga0373931_0015514 3300035691 Bacteria 3738
304 Ga0373931_0161981 3300035691 Bacteria 1312
305 Ga0373927_0223968 3300035695 Bacteria 1235
306 Ga0373937_0091838 3300036401 Bacteria 2813
307 Ga0373925_0057331 3300037068 Bacteria 2918
308 Ga0395899_0001803 3300037312 Bacteria 17731
309 Ga0395899_0015812 3300037312 Bacteria 5753
310 Ga0395899_0211531 3300037312 Bacteria 1347
311 Ga0395900_0000125 3300037418 Bacteria 130214
312 Ga0395900_0041362 3300037418 Bacteria 4752
313 Ga0395900_0053779 3300037418 Bacteria 4144
314 Ga0395900_0116587 3300037418 Bacteria 2740
315 Ga0395900_0155913 3300037418 Bacteria 2332
316 Ga0395898_0005307 3300037466 Bacteria 13940
317 Ga0395898_0015619 3300037466 Bacteria 7783
318 Ga0395898_0060564 3300037466 Bacteria 3678
319 Ga0395898_0114014 3300037466 Bacteria 2590
320 Ga0395905_0003956 3300037471 Bacteria 15588
321 Ga0395905_0016077 3300037471 Bacteria 7114
322 Ga0395905_0091126 3300037471 Bacteria 2858
323 Ga0395905_0094288 3300037471 Bacteria 2808
324 Ga0395905_0156885 3300037471 Bacteria 2140
325 Ga0395905_0220658 3300037471 Bacteria 1774
326 Ga0395905_0651235 3300037471 Bacteria 955
327 Ga0395901_0078070 3300038443 Bacteria 3457
328 Ga0395901_0188326 3300038443 Bacteria 2164
329 Ga0395901_0197085 3300038443 Bacteria 2111
330 Ga0395901_0334175 3300038443 Bacteria 1566
331 Ga0395901_0498834 3300038443 Bacteria 1239
332 Ga0436361_0463845 3300039447 Bacteria 3232
333 Ga0451793_0702405 3300041452 Bacteria 1243
334 Ga0439437_014677 3300042000 Bacteria 916
335 Ga0450894_013971 3300042131 Bacteria 1056
336 Ga0450898_003984 3300042134 Bacteria 2157
337 Ga0439459_0005385 3300042438 Bacteria 2101
338 Ga0439464_0011788 3300042439 Bacteria 2321
339 Ga0439464_0027091 3300042439 Bacteria 1593
340 Ga0451577_0003244 3300042876 Bacteria 18290
341 Ga0451577_0003509 3300042876 Bacteria 17383
342 Ga0451577_0060601 3300042876 Bacteria 3373
343 Ga0451577_0408411 3300042876 Bacteria 1233
344 Ga0466969_0000047 3300044656 Bacteria 63979
345 Ga0466972_0000636 3300044658 Bacteria 17006
346 Ga0466972_0026459 3300044658 Bacteria 2876
347 Ga0466972_0089953 3300044658 Bacteria 1456
348 Ga0453683_0004564 3300044673 Bacteria 9800
349 Ga0453683_0017023 3300044673 Bacteria 4686
350 Ga0466965_0048588 3300044683 Bacteria 2102
351 Ga0466965_0257945 3300044683 Bacteria 936
352 Ga0466966_0041339 3300044684 Bacteria 2962
353 Ga0466966_0115991 3300044684 Bacteria 1648
354 Ga0466961_0050023 3300044693 Bacteria 2670
355 Ga0466961_0298264 3300044693 Bacteria 985
356 Ga0466963_0002955 3300044694 Bacteria 9603
357 Ga0466964_0001670 3300044706 Bacteria 7680
358 Ga0453684_0013235 3300044712 Bacteria 13440
359 Ga0453684_0026704 3300044712 Bacteria 8322
360 Ga0453684_0317307 3300044712 Bacteria 1766
361 Ga0453684_0693532 3300044712 Bacteria 1107
362 Ga0466971_0190607 3300044719 Bacteria 966
363 Ga0466970_0006524 3300044765 Bacteria 5832
364 Ga0466957_0039271 3300044842 Bacteria 2855
365 Ga0466957_0074493 3300044842 Bacteria 2105
366 Ga0466959_0000151 3300045049 Bacteria 45408
367 Ga0466959_0009204 3300045049 Bacteria 7014
368 Ga0451576_0005882 3300045051 Bacteria 15225
369 Ga0451576_0157520 3300045051 Bacteria 2369
370 Ga0451576_0862120 3300045051 Bacteria 950
371 Ga0451576_0914206 3300045051 Bacteria 920
372 Ga0466958_0016411 3300045836 Bacteria 4263
373 Ga0466967_0009455 3300045976 Bacteria 7232
374 Ga0495617_003301 3300046452 Bacteria 6111
375 Ga0495617_018999 3300046452 Bacteria 2324
376 Ga0495617_022580 3300046452 Bacteria 2127
377 Ga0495617_045308 3300046452 Bacteria 1466
378 Ga0495638_0065583 3300046460 Bacteria 2234
379 Ga0495650_0006428 3300046471 Bacteria 7323
380 Ga0495580_0015464 3300046472 Bacteria 5753
381 Ga0495584_0000249 3300046491 Bacteria 38940
382 Ga0495585_0030455 3300046492 Bacteria 3068
383 Ga0495607_0020177 3300046501 Bacteria 4218
384 Ga0495610_0140501 3300046512 Unclassified 1040
385 Ga0495616_0000761 3300046513 Bacteria 23546
386 Ga0495628_0163781 3300046516 Bacteria 1689
387 Ga0495632_0024008 3300046519 Bacteria 3246
388 Ga0495652_0115295 3300046529 Bacteria 2153
389 Ga0495654_0002614 3300046530 Bacteria 11476
390 Ga0495645_0054919 3300046543 Bacteria 2893
391 Ga0495633_0008319 3300046558 Bacteria 5859
392 Ga0495656_0104226 3300046615 Bacteria 1316
393 Ga0495668_0255169 3300046616 Bacteria 960
394 Ga0495611_0072547 3300046648 Bacteria 1575
395 Ga0495661_0224228 3300046665 Bacteria 972
396 Ga0495647_0111036 3300046681 Bacteria 1144
397 Ga0495658_0017716 3300046683 Bacteria 3687
398 Ga0495658_0074461 3300046683 Bacteria 1979
399 Ga0495670_0011768 3300046691 Bacteria 4306
400 Ga0495581_0285543 3300047315 Bacteria 965
401 Ga0495604_0025184 3300047317 Bacteria 4741
402 Ga0495672_0029323 3300047320 Bacteria 3467
403 Ga0495675_0144328 3300047444 Bacteria 1474
404 Ga0496101_0715009 3300048904 Bacteria 791
405 Ga0496102_0537907 3300048905 Bacteria 1091
406 Ga0496104_0092392 3300048907 Bacteria 2894
407 Ga0496104_0192512 3300048907 Bacteria 1951
408 Ga0496104_0251750 3300048907 Bacteria 1679
409 Ga0496108_0317195 3300048911 Bacteria 1359
410 Ga0496110_0149984 3300048913 Bacteria 2111
411 Ga0496112_0012435 3300048915 Bacteria 7826
412 Ga0496113_0116611 3300048916 Bacteria 2084
413 Ga0496114_0165463 3300048917 Bacteria 1925
414 Ga0496124_0104977 3300048927 Bacteria 2284
415 Ga0501047_0313482 3300049581 Bacteria 1409
416 Ga0501035_0219584 3300049822 Bacteria 1623
417 Ga0501035_0258503 3300049822 Bacteria 1477
418 nmdc:mga0k408_96006_c1 3300050493 Bacteria 1745
419 nmdc:mga06z11_235194_c1 3300050494 Bacteria 1074
420 nmdc:mga07m45_106210_c1 3300050496 Bacteria 1120
421 nmdc:mga07m45_61253_c1 3300050496 Bacteria 2131
422 nmdc:mga05p37_70196_c2 3300050507 Bacteria 3643
423 nmdc:mga09592_510902_c1 3300050508 Bacteria 1034
424 nmdc:mga08y16_120469_c1 3300050511 Bacteria 2730
425 nmdc:mga08y16_264617_c1 3300050511 Bacteria 1775
426 nmdc:mga0rr50_439579_c1 3300050513 Bacteria 1105
427 nmdc:mga08x19_65721_c1 3300050514 Bacteria 2356
428 Ga0495601_0166086 3300053077 Bacteria 1442
429 Ga0500635_0000040 3300053080 Bacteria 91731
430 Ga0495619_0016423 3300053085 Bacteria 4687
431 Ga0500578_0000040 3300053086 Bacteria 133601
432 Ga0500644_0023183 3300053088 Bacteria 1882
433 Ga0500646_0007132 3300053090 Bacteria 2849
434 Ga0500651_0056811 3300053093 Bacteria 2449
435 Ga0500650_0131435 3300053098 Bacteria 1163
436 Ga0500569_068882 3300053109 Bacteria 1109
437 Ga0500594_0026733 3300053118 Bacteria 1489
438 Ga0500628_001374 3300053129 Bacteria 4186
439 Ga0500642_0017851 3300053130 Bacteria 2730
440 Ga0500652_000133 3300053131 Bacteria 27855
441 Ga0500559_0008376 3300053136 Bacteria 4534
442 Ga0500559_0159595 3300053136 Bacteria 1059
443 Ga0500568_0037770 3300053139 Bacteria 1957
444 Ga0500573_0120427 3300053140 Bacteria 1461
445 Ga0500577_0020770 3300053142 Bacteria 2153
446 Ga0500577_0068350 3300053142 Bacteria 1387
447 Ga0500604_0015469 3300053151 Unclassified 2090
448 Ga0500604_0033475 3300053151 Bacteria 1520
449 Ga0500604_0075350 3300053151 Bacteria 1082
450 Ga0500616_0073400 3300053153 Bacteria 1737
451 Ga0500619_000089 3300053154 Bacteria 25233
452 Ga0500622_0001741 3300053156 Bacteria 16823
453 Ga0500622_0036571 3300053156 Bacteria 2566
454 Ga0500645_078956 3300053730 Bacteria 940
455 2919708435 2919704043 Bacteria 5560311
456 2587725821 2585428057 Bacteria 6737412
457 2587735211 2585428058 Bacteria 6853932
458 2588290749 2588253510 Bacteria 6901809
459 2643972168 2643221592 Bacteria 6608788
460 2644141721 2643221625 Bacteria 6512927
461 2644275508 2643221648 Bacteria 6521465
462 2739249727 2738543013 Bacteria 5618633
463 JGI25153J46596_10002861
464 rootL2_10001570
465 rootL2_10154697
466 Ga0055524_1001066
467 Ga0055536_1032669
468 Ga0055534_1002409
469 Ga0055530_10007412
470 Ga0055540_1002637
471 Ga0055531_10000393
472 Ga0055531_10006878
473 Ga0055543_1028166
474 Ga0065165_1000006
475 Ga0065165_1000166
476 Ga0065165_1001190
477 Ga0070658_10195077
478 Ga0070658_10399173
479 Ga0070658_10444923
480 Ga0070676_10001104
481 Ga0070676_10084866
482 Ga0070690_100001705
483 Ga0070670_100010317
484 Ga0070670_100176597
485 Ga0070670_100222715
486 Ga0070670_100267728
487 Ga0070677_10129116
488 Ga0068869_100004613
489 Ga0070666_10002089
490 Ga0070666_10090742
491 Ga0070682_100191889
492 Ga0068868_100042146
493 Ga0068868_100048299
494 Ga0068868_100157656
495 Ga0068868_100688281
496 Ga0070660_100043006
497 Ga0070689_100277220
498 Ga0070661_100047356
499 Ga0070661_100295354
500 Ga0070668_100021512
501 Ga0070669_100001069
502 Ga0070675_100009912
503 Ga0070671_100005866
504 Ga0070671_100070936
505 Ga0070671_100087271
506 Ga0070671_100131896
507 Ga0070671_100182706
508 Ga0070671_100218346
509 Ga0070674_100048490
510 Ga0070674_100076678
511 Ga0070674_100710700
512 Ga0070673_100111942
513 Ga0070673_100146029
514 Ga0070673_100173707
515 Ga0070673_100253271
516 Ga0070688_100276217
517 Ga0070659_100049073
518 Ga0070659_100105493
519 Ga0070659_100474482
520 Ga0070667_100001153
521 Ga0070663_100440785
522 Ga0070678_100058072
523 Ga0070678_100071493
524 Ga0070678_100153241
525 Ga0070678_100169944
526 Ga0070678_100177969
527 Ga0070662_100004009
528 Ga0070662_100010916
529 Ga0068867_100006127
530 Ga0068867_100154555
531 Ga0068853_100215759
532 Ga0068853_100569009
533 Ga0070672_100012570
534 Ga0070672_100093661
535 Ga0070665_100350561
536 Ga0068855_100367735
537 Ga0070664_100071454
538 Ga0070664_100084014
539 Ga0070664_100166265
540 Ga0070664_100770492
541 Ga0068854_100038943
542 Ga0068854_100158390
543 Ga0068852_100020287
544 Ga0068852_100076673
545 Ga0068859_100008535
546 Ga0068864_100007260
547 Ga0068864_100041314
548 Ga0068864_100349312
549 Ga0068864_100517689
550 Ga0068866_10007275
551 Ga0068861_100005014
552 Ga0068861_100309012
553 Ga0068851_10114751
554 Ga0068851_10123345
555 Ga0068851_10165271
556 Ga0068863_100013223
557 Ga0068863_100028660
558 Ga0068863_100120471
559 Ga0068863_100138188
560 Ga0068863_100293687
561 Ga0068858_100001199
562 Ga0068860_100001913
563 Ga0068862_100005642
564 Ga0075365_10290200
565 Ga0075365_10450704
566 Ga0075363_100087073
567 Ga0075362_10080828
568 Ga0075367_10637420
569 Ga0075366_10004867
570 Ga0075366_10106443
571 Ga0075366_10142914
572 Ga0097621_100012780
573 Ga0068871_100014297
574 Ga0068871_100172979
575 Ga0068871_100375689
576 Ga0075428_100485792
577 Ga0075429_100153077
578 Ga0068865_100014234
579 Ga0075436_100034276
580 Ga0097620_100008535
581 Ga0075435_100121664
582 Ga0111539_10088358
583 Ga0105245_10399766
584 Ga0114129_10040425
585 Ga0114129_10056407
586 Ga0105243_10016971
587 Ga0105242_10048104
588 Ga0105242_10085307
589 Ga0105248_10004461
590 Ga0105248_10025768
591 Ga0105248_10066543
592 Ga0105248_10133669
593 Ga0105237_10061819
594 Ga0105238_10437618
595 Ga0105249_10005835
596 Ga0105246_10684128
597 Ga0157319_1000010
598 Ga0157369_10184502
599 Ga0157374_10028598
600 Ga0157374_10066992
601 Ga0157374_10480901
602 Ga0157378_10263679
603 Ga0157378_10298832
604 Ga0163162_10030622
605 Ga0163162_10587969
606 Ga0163162_11227695
607 Ga0157375_10030567
608 Ga0157375_10092222
609 Ga0157375_11289522
610 Ga0163163_10082540
611 Ga0163163_10637700
612 Ga0163163_10846693
613 Ga0157380_10000286
614 Ga0157380_10305268
615 Ga0157379_10012998
616 Ga0157379_10051267
617 Ga0157379_10583301
618 Ga0157376_11100968
619 Ga0163161_10061255
620 Ga0163161_10164178
621 Ga0163161_10369130
622 Ga0213872_10021147
623 Ga0209677_102390
624 Ga0209673_1008590
625 Ga0209673_1017463
626 Ga0209130_1007555
627 Ga0209675_1007360
628 Ga0209676_1010876
629 Ga0209758_1000126
630 Ga0209758_1045798
631 Ga0209050_1001413
632 Ga0209256_1000204
633 Ga0209051_1000280
634 Ga0209051_1001849
635 Ga0209051_1008169
636 Ga0209051_1014692
637 Ga0209051_1060041
638 Ga0209257_1000165
639 Ga0209257_1001275
640 Ga0209257_1006902
641 Ga0207697_10024971
642 Ga0207697_10111986
643 Ga0207656_10012758
644 Ga0207656_10332388
645 Ga0207682_10128635
646 Ga0207642_10001955
647 Ga0207688_10015846
648 Ga0207680_10000754
649 Ga0207680_10284228
650 Ga0207645_10012100
651 Ga0207645_10090106
652 Ga0207645_10180447
653 Ga0207643_10045351
654 Ga0207705_10168263
655 Ga0207705_10366967
656 Ga0207705_10415873
657 Ga0207705_10422135
658 Ga0207662_10029360
659 Ga0207649_10138344
660 Ga0207649_10203125
661 Ga0207649_10791077
662 Ga0207681_10000311
663 Ga0207681_10172616
664 Ga0207694_10475591
665 Ga0207694_10676928
666 Ga0207650_10001471
667 Ga0207650_10085382
668 Ga0207650_10110508
669 Ga0207650_10556227
670 Ga0207659_10330450
671 Ga0207687_10042320
672 Ga0207644_10033666
673 Ga0207644_10098353
674 Ga0207644_10208174
675 Ga0207690_10189252
676 Ga0207706_10004559
677 Ga0207706_10063324
678 Ga0207706_10074792
679 Ga0207706_10200510
680 Ga0207706_10246742
681 Ga0207686_10031570
682 Ga0207686_10099777
683 Ga0207709_10003750
684 Ga0207670_10444785
685 Ga0207669_10024811
686 Ga0207704_10004967
687 Ga0207665_10157173
688 Ga0207691_10073777
689 Ga0207691_10102410
690 Ga0207691_10121252
691 Ga0207691_10229303
692 Ga0207691_10276522
693 Ga0207691_10318236
694 Ga0207711_10006152
695 Ga0207711_10038411
696 Ga0207711_10348776
697 Ga0207689_10035605
698 Ga0207661_10474696
699 Ga0207679_10353531
700 Ga0207667_10391464
701 Ga0207651_10029079
702 Ga0207651_10064618
703 Ga0207651_10411452
704 Ga0207712_10023597
705 Ga0207668_10003171
706 Ga0207640_10602053
707 Ga0207658_10000459
708 Ga0207658_10441436
709 Ga0207677_10018408
710 Ga0207677_10064150
711 Ga0207677_10227924
712 Ga0207677_10720378
713 Ga0207703_10001017
714 Ga0207678_10288344
715 Ga0207678_10327393
716 Ga0207678_10327837
717 Ga0207708_10040633
718 Ga0207641_10000594
719 Ga0207641_10007884
720 Ga0207641_10076589
721 Ga0207641_10218256
722 Ga0207641_10299124
723 Ga0207648_10009034
724 Ga0207648_10308123
725 Ga0207676_10011882
726 Ga0207676_10031143
727 Ga0207676_10405925
728 Ga0207675_100002936
729 Ga0207683_10019889
730 Ga0207683_10079957
731 Ga0207683_10163013
732 Ga0207683_10206085
733 Ga0207683_10248086
734 Ga0207683_10265354
735 Ga0207683_10804586
736 Ga0207698_10009481
737 Ga0207698_10049305
738 Ga0207698_10051054
739 Ga0207698_10144296
740 Ga0207698_11300040
741 Ga0209371_1007586
742 Ga0209996_1000973
743 Ga0209968_1000333
744 Ga0209970_1000798
745 Ga0209983_1031770
746 Ga0209966_1000161
747 Ga0209974_10126737
748 Ga0268265_10002354
749 Ga0268264_10001252
750 Ga0307515_10001531
751 Ga0307515_10044101
752 Ga0268256_1014071
753 Ga0307513_10000072
754 Ga0307513_10005502
755 Ga0307509_10019604
756 Ga0307408_100850415
757 Ga0307516_10266789
758 Ga0307410_10106594
759 Ga0307412_10047991
760 Ga0307412_10086687
761 Ga0307416_100501412
762 Ga0307415_100813955
763 Ga0373923_0111096
764 Ga0373946_0093396
765 Ga0373931_0015514
766 Ga0373931_0161981
767 Ga0373927_0223968
768 Ga0373937_0091838
769 Ga0373925_0057331
770 Ga0395899_0001803
771 Ga0395899_0015812
772 Ga0395899_0211531
773 Ga0395900_0000125
774 Ga0395900_0041362
775 Ga0395900_0053779
776 Ga0395900_0116587
777 Ga0395900_0155913
778 Ga0395898_0005307
779 Ga0395898_0015619
780 Ga0395898_0060564
781 Ga0395898_0114014
782 Ga0395905_0003956
783 Ga0395905_0016077
784 Ga0395905_0091126
785 Ga0395905_0094288
786 Ga0395905_0156885
787 Ga0395905_0220658
788 Ga0395905_0651235
789 Ga0395901_0078070
790 Ga0395901_0188326
791 Ga0395901_0197085
792 Ga0395901_0334175
793 Ga0395901_0498834
794 Ga0436361_0463845
795 Ga0451793_0702405
796 Ga0439437_014677
797 Ga0450894_013971
798 Ga0450898_003984
799 Ga0439459_0005385
800 Ga0439464_0011788
801 Ga0439464_0027091
802 Ga0451577_0003244
803 Ga0451577_0003509
804 Ga0451577_0060601
805 Ga0451577_0408411
806 Ga0466969_0000047
807 Ga0466972_0000636
808 Ga0466972_0026459
809 Ga0466972_0089953
810 Ga0453683_0004564
811 Ga0453683_0017023
812 Ga0466965_0048588
813 Ga0466965_0257945
814 Ga0466966_0041339
815 Ga0466966_0115991
816 Ga0466961_0050023
817 Ga0466961_0298264
818 Ga0466963_0002955
819 Ga0466964_0001670
820 Ga0453684_0013235
821 Ga0453684_0026704
822 Ga0453684_0317307
823 Ga0453684_0693532
824 Ga0466971_0190607
825 Ga0466970_0006524
826 Ga0466957_0039271
827 Ga0466957_0074493
828 Ga0466959_0000151
829 Ga0466959_0009204
830 Ga0451576_0005882
831 Ga0451576_0157520
832 Ga0451576_0862120
833 Ga0451576_0914206
834 Ga0466958_0016411
835 Ga0466967_0009455
836 Ga0495617_003301
837 Ga0495617_018999
838 Ga0495617_022580
839 Ga0495617_045308
840 Ga0495638_0065583
841 Ga0495650_0006428
842 Ga0495580_0015464
843 Ga0495584_0000249
844 Ga0495585_0030455
845 Ga0495607_0020177
846 Ga0495610_0140501
847 Ga0495616_0000761
848 Ga0495628_0163781
849 Ga0495632_0024008
850 Ga0495652_0115295
851 Ga0495654_0002614
852 Ga0495645_0054919
853 Ga0495633_0008319
854 Ga0495656_0104226
855 Ga0495668_0255169
856 Ga0495611_0072547
857 Ga0495661_0224228
858 Ga0495647_0111036
859 Ga0495658_0017716
860 Ga0495658_0074461
861 Ga0495670_0011768
862 Ga0495581_0285543
863 Ga0495604_0025184
864 Ga0495672_0029323
865 Ga0495675_0144328
866 Ga0496101_0715009
867 Ga0496102_0537907
868 Ga0496104_0092392
869 Ga0496104_0192512
870 Ga0496104_0251750
871 Ga0496108_0317195
872 Ga0496110_0149984
873 Ga0496112_0012435
874 Ga0496113_0116611
875 Ga0496114_0165463
876 Ga0496124_0104977
877 Ga0501047_0313482
878 Ga0501035_0219584
879 Ga0501035_0258503
880 nmdc:mga0k408_96006_c1
881 nmdc:mga06z11_235194_c1
882 nmdc:mga07m45_106210_c1
883 nmdc:mga07m45_61253_c1
884 nmdc:mga05p37_70196_c2
885 nmdc:mga09592_510902_c1
886 nmdc:mga08y16_120469_c1
887 nmdc:mga08y16_264617_c1
888 nmdc:mga0rr50_439579_c1
889 nmdc:mga08x19_65721_c1
890 Ga0495601_0166086
891 Ga0500635_0000040
892 Ga0495619_0016423
893 Ga0500578_0000040
894 Ga0500644_0023183
895 Ga0500646_0007132
896 Ga0500651_0056811
897 Ga0500650_0131435
898 Ga0500569_068882
899 Ga0500594_0026733
900 Ga0500628_001374
901 Ga0500642_0017851
902 Ga0500652_000133
903 Ga0500559_0008376
904 Ga0500559_0159595
905 Ga0500568_0037770
906 Ga0500573_0120427
907 Ga0500577_0020770
908 Ga0500577_0068350
909 Ga0500604_0015469
910 Ga0500604_0033475
911 Ga0500604_0075350
912 Ga0500616_0073400
913 Ga0500619_000089
914 Ga0500622_0001741
915 Ga0500622_0036571
916 Ga0500645_078956
917 2919708435
918 2587725821
919 2587735211
920 2588290749
921 2643972168
922 2644141721
923 2644275508
924 2739249727

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

17

214

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2imd-assembly1.cif.gz_A structure of semet 2-hydroxychromene-2-carboxylate isomerase (hcca isomerase) 0.8428 3 196
1r4w-assembly2.cif.gz_D crystal structure of mitochondrial class kappa glutathione transferase 0.8151 2 199
2imd-assembly1.cif.gz_A structure of semet 2-hydroxychromene-2-carboxylate isomerase (hcca isomerase) 0.8043 3 196
3ios-assembly1.cif.gz_A structure of mtb dsbf in its mixed oxidized and reduced forms 0.8002 2 39
3rpn-assembly3.cif.gz_F crystal structure of human kappa class glutathione transferase in complex with s-hexylglutathione 0.7957 2 199
ID Description Score Start End Superfamily
af_Q18973_4_212_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8351 1 190 3.40.30.10
af_Q09652_5_211_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8137 3 190 3.40.30.10
2imdA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8109 5 196 3.40.30.10
3iosA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8002 2 39 3.40.30.10
af_I6XYM2_34_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7987 2 39 3.40.30.10
ID Description Score Start End GO Terms
AF-F3LLQ8-F1-model_v4 deleted 0.9941 1 191
AF-A0A522ZNE7-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase 0.9868 1 168 GO:0004364
GO:0004602
GO:0006749
GO:0018845
GO:1901170
AF-A0A519ZFM6-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase 0.9842 1 94 GO:0004364
GO:0004602
GO:0006749
GO:0016853
AF-A0A4Q3Q6F5-F1-model_v4 deleted 0.9836 1 136
AF-A0A1V3RYU8-F1-model_v4 Disulfide bond formation protein DsbA 0.9776 1 75 GO:0016491

Map