F448941

General Info

Members Datasets Scaffolds Average Seq Length
462 321 924 100

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_11991547|Ga0307406_119915472
Length 113
Sequence MSQSSAVSSAVDIAGCGAPEQSEPLPASVDIARETVISGTVRSADGPVGGAYIRLLDSSGEFTAEVVSSVAGQFRFFAAPGTWTIRALSRAGNGDLVVAANRGLNDITIEVAA

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
93 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
115 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
179 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
180 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
181 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
182 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
186 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
187 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
201 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
202 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
203 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
204 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
205 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
206 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
207 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
208 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
209 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
210 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
213 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
214 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
215 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
216 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
217 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
218 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
219 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
220 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
224 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
225 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
242 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
258 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
259 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
260 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
261 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
264 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
265 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
266 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
279 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
280 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
281 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
282 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
291 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
292 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
293 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
294 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
295 2547132424 Nocardia nova SH22a Isolate Unclassified
296 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
297 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
298 2643221692 Nocardia sp. Root136 Isolate Unclassified
299 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
300 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
301 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
302 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
303 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
304 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
305 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
306 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
307 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
308 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
309 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
310 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
311 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
312 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
313 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
314 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
315 2922554459 Rhodococcus sp. 66b Isolate Unclassified
316 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
317 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
318 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
319 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
320 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
321 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.77
Metatranscriptomes 2.38
Isolates 5.84

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 6.06
Nodule 0
Rhizoplane 8.66
Rhizosphere 75.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_11991547 3300031901 Bacteria 519
2 LJQas_1011387 3300000549 Bacteria 1057
3 rootH2_10040040 3300003320 Bacteria 1174
4 Ga0058862_10078475 3300004803 Bacteria 1428
5 Ga0070676_10044390 3300005328 Bacteria 2586
6 Ga0070670_100125402 3300005331 Bacteria 2216
7 Ga0068869_100007101 3300005334 Bacteria 7135
8 Ga0070680_100692990 3300005336 Bacteria 876
9 Ga0070682_100002793 3300005337 Bacteria 9672
10 Ga0068868_100028863 3300005338 Bacteria 4246
11 Ga0070660_100078762 3300005339 Bacteria 2584
12 Ga0070689_100143298 3300005340 Bacteria 1923
13 Ga0070691_10055923 3300005341 Bacteria 1890
14 Ga0070661_100029486 3300005344 Bacteria 3961
15 Ga0070692_10062990 3300005345 Bacteria 1958
16 Ga0070668_100036981 3300005347 Bacteria 3726
17 Ga0070675_100002347 3300005354 Bacteria 14067
18 Ga0070671_100002344 3300005355 Bacteria 14616
19 Ga0070671_101326387 3300005355 Bacteria 635
20 Ga0070673_100152445 3300005364 Bacteria 1958
21 Ga0070688_100482827 3300005365 Bacteria 932
22 Ga0070659_100135913 3300005366 Bacteria 1999
23 Ga0070667_100095542 3300005367 Bacteria 2563
24 Ga0070667_101577063 3300005367 Bacteria 617
25 Ga0070709_10013640 3300005434 Bacteria 4574
26 Ga0070714_100030465 3300005435 Bacteria 4490
27 Ga0070714_100223449 3300005435 Bacteria 1732
28 Ga0070714_100226972 3300005435 Bacteria 1719
29 Ga0070714_100877133 3300005435 Bacteria 871
30 Ga0070714_101214126 3300005435 Bacteria 736
31 Ga0070713_100008381 3300005436 Bacteria 7328
32 Ga0070710_10000178 3300005437 Bacteria 29217
33 Ga0070710_10223201 3300005437 Bacteria 1200
34 Ga0070701_10248031 3300005438 Bacteria 1074
35 Ga0070711_100018523 3300005439 Bacteria 4449
36 Ga0070705_101587619 3300005440 Bacteria 550
37 Ga0070700_100078587 3300005441 Bacteria 2124
38 Ga0070708_100829868 3300005445 Bacteria 869
39 Ga0070663_100104121 3300005455 Bacteria 2122
40 Ga0070663_100170519 3300005455 Bacteria 1682
41 Ga0070678_100024618 3300005456 Bacteria 4035
42 Ga0070678_100131530 3300005456 Bacteria 1989
43 Ga0070678_101493618 3300005456 Bacteria 633
44 Ga0070662_100085703 3300005457 Bacteria 2354
45 Ga0070681_10083692 3300005458 Bacteria 3143
46 Ga0068867_100454705 3300005459 Bacteria 1092
47 Ga0070685_10008284 3300005466 Bacteria 5337
48 Ga0070685_11139557 3300005466 Bacteria 591
49 Ga0070685_11443605 3300005466 Bacteria 529
50 Ga0070706_100008560 3300005467 Bacteria 9535
51 Ga0070706_101112363 3300005467 Bacteria 727
52 Ga0070698_100612273 3300005471 Bacteria 1030
53 Ga0070698_101111842 3300005471 Bacteria 739
54 Ga0070679_100167908 3300005530 Bacteria 2167
55 Ga0070679_102109177 3300005530 Bacteria 513
56 Ga0068853_100004684 3300005539 Bacteria 10609
57 Ga0070693_100017805 3300005547 Bacteria 3701
58 Ga0070665_100048658 3300005548 Bacteria 4256
59 Ga0070665_100300385 3300005548 Bacteria 1608
60 Ga0070704_100432332 3300005549 Bacteria 1129
61 Ga0070664_101637792 3300005564 Bacteria 610
62 Ga0068857_100066021 3300005577 Bacteria 3219
63 Ga0068854_100044663 3300005578 Bacteria 3147
64 Ga0068856_100008389 3300005614 Bacteria 10068
65 Ga0068856_101842026 3300005614 Bacteria 616
66 Ga0070702_100006551 3300005615 Bacteria 5519
67 Ga0068859_100086593 3300005617 Bacteria 3180
68 Ga0068864_100017887 3300005618 Bacteria 5913
69 Ga0068864_100084022 3300005618 Bacteria 2797
70 Ga0068864_100623102 3300005618 Bacteria 1049
71 Ga0068866_10107555 3300005718 Bacteria 1550
72 Ga0068866_10595082 3300005718 Bacteria 746
73 Ga0068861_100573530 3300005719 Bacteria 1032
74 Ga0068851_10009681 3300005834 Bacteria 4487
75 Ga0068870_10046286 3300005840 Bacteria 2280
76 Ga0068870_10312448 3300005840 Bacteria 996
77 Ga0068863_100017488 3300005841 Bacteria 6873
78 Ga0068863_100520762 3300005841 Bacteria 1172
79 Ga0068863_101246834 3300005841 Bacteria 750
80 Ga0068858_101012915 3300005842 Bacteria 814
81 Ga0081455_10043695 3300005937 Bacteria 3916
82 Ga0081455_10135394 3300005937 Bacteria 1920
83 Ga0070717_10260352 3300006028 Bacteria 1535
84 Ga0070717_11030061 3300006028 Bacteria 750
85 Ga0075368_10259374 3300006042 Bacteria 744
86 Ga0075368_10297386 3300006042 Bacteria 696
87 Ga0075363_100014126 3300006048 Bacteria 3892
88 Ga0075363_100164356 3300006048 Bacteria 1258
89 Ga0075363_100224211 3300006048 Bacteria 1078
90 Ga0075364_10292014 3300006051 Bacteria 1109
91 Ga0070712_100023593 3300006175 Bacteria 4067
92 Ga0075362_10401515 3300006177 Bacteria 691
93 Ga0075362_10615422 3300006177 Bacteria 562
94 Ga0075367_10533840 3300006178 Bacteria 745
95 Ga0075369_10043846 3300006186 Bacteria 1921
96 Ga0097621_100150528 3300006237 Bacteria 1995
97 Ga0097621_100756525 3300006237 Bacteria 898
98 Ga0097621_101755609 3300006237 Bacteria 591
99 Ga0075370_10143567 3300006353 Bacteria 1396
100 Ga0075370_10161096 3300006353 Bacteria 1317
101 Ga0075370_10274932 3300006353 Bacteria 1000
102 Ga0068871_100041003 3300006358 Bacteria 3710
103 Ga0068871_100380382 3300006358 Bacteria 1254
104 Ga0075428_100000501 3300006844 Bacteria 39750
105 Ga0075428_100524550 3300006844 Bacteria 1267
106 Ga0075428_100731851 3300006844 Bacteria 1053
107 Ga0075428_100963957 3300006844 Bacteria 903
108 Ga0075428_100979452 3300006844 Bacteria 896
109 Ga0075430_100005439 3300006846 Bacteria 10761
110 Ga0075433_10095188 3300006852 Bacteria 2635
111 Ga0075434_100051707 3300006871 Bacteria 4083
112 Ga0075429_100169801 3300006880 Bacteria 1911
113 Ga0097620_100086593 3300006931 Bacteria 3180
114 Ga0075435_100545678 3300007076 Bacteria 1004
115 Ga0105251_10026073 3300009011 Bacteria 2980
116 Ga0105251_10242273 3300009011 Bacteria 812
117 Ga0105244_10261425 3300009036 Bacteria 805
118 Ga0105250_10283506 3300009092 Bacteria 713
119 Ga0105240_11428841 3300009093 Bacteria 727
120 Ga0111539_10194303 3300009094 Bacteria 2367
121 Ga0105245_10301988 3300009098 Bacteria 1571
122 Ga0105245_10334586 3300009098 Bacteria 1496
123 Ga0105245_10757949 3300009098 Bacteria 1007
124 Ga0105247_10031511 3300009101 Bacteria 3218
125 Ga0105247_11068910 3300009101 Bacteria 635
126 Ga0105247_11169682 3300009101 Bacteria 611
127 Ga0114129_10018920 3300009147 Bacteria 9813
128 Ga0114129_10517490 3300009147 Bacteria 1556
129 Ga0105243_10001026 3300009148 Bacteria 25748
130 Ga0105243_10535148 3300009148 Bacteria 1116
131 Ga0105243_10706252 3300009148 Bacteria 983
132 Ga0105243_12486342 3300009148 Bacteria 557
133 Ga0105241_10038401 3300009174 Bacteria 3609
134 Ga0105241_10718162 3300009174 Bacteria 914
135 Ga0105242_10106878 3300009176 Bacteria 2379
136 Ga0105242_12100564 3300009176 Bacteria 609
137 Ga0105248_10023686 3300009177 Bacteria 6823
138 Ga0105237_10106153 3300009545 Bacteria 2800
139 Ga0105237_11156530 3300009545 Bacteria 780
140 Ga0105238_10230665 3300009551 Bacteria 1828
141 Ga0105238_10715602 3300009551 Bacteria 1014
142 Ga0105249_11066571 3300009553 Bacteria 878
143 Ga0105032_105842 3300009979 Bacteria 1034
144 Ga0105035_113237 3300009988 Bacteria 744
145 Ga0105239_10190311 3300010375 Bacteria 2297
146 Ga0105246_10187065 3300011119 Bacteria 1600
147 Ga0105246_10797287 3300011119 Bacteria 838
148 Ga0154012_135170 3300013059 Bacteria 520
149 Ga0157373_10028556 3300013100 Bacteria 4024
150 Ga0157371_10116560 3300013102 Bacteria 1898
151 Ga0157370_10029061 3300013104 Bacteria 5431
152 Ga0157369_10633249 3300013105 Bacteria 1103
153 Ga0157374_10524611 3300013296 Bacteria 1190
154 Ga0157378_11509748 3300013297 Bacteria 717
155 Ga0163162_10254163 3300013306 Bacteria 1889
156 Ga0163162_10398840 3300013306 Bacteria 1508
157 Ga0157372_10074760 3300013307 Bacteria 3821
158 Ga0157372_12954799 3300013307 Bacteria 544
159 Ga0157375_10048459 3300013308 Bacteria 4156
160 Ga0157375_10254504 3300013308 Bacteria 1917
161 Ga0157375_12465724 3300013308 Bacteria 621
162 Ga0163163_10103238 3300014325 Bacteria 2875
163 Ga0163163_10811239 3300014325 Bacteria 999
164 Ga0163163_10870539 3300014325 Bacteria 964
165 Ga0163163_11232112 3300014325 Bacteria 811
166 Ga0163163_11635362 3300014325 Bacteria 705
167 Ga0163163_11713719 3300014325 Bacteria 689
168 Ga0163163_12189002 3300014325 Bacteria 612
169 Ga0163163_12968028 3300014325 Bacteria 529
170 Ga0182008_10029398 3300014497 Bacteria 2777
171 Ga0157377_10048191 3300014745 Bacteria 2389
172 Ga0157377_10750357 3300014745 Bacteria 714
173 Ga0157379_10019799 3300014968 Bacteria 5948
174 Ga0157379_11371781 3300014968 Bacteria 684
175 Ga0157376_10207301 3300014969 Bacteria 1807
176 Ga0163161_10299215 3300017792 Bacteria 1267
177 Ga0197907_10218777 3300020069 Bacteria 1113
178 Ga0206356_10474123 3300020070 Bacteria 2049
179 Ga0206355_1005808 3300020076 Bacteria 970
180 Ga0206351_10060737 3300020077 Bacteria 1098
181 Ga0206354_10616106 3300020081 Bacteria 1007
182 Ga0206354_10616760 3300020081 Bacteria 714
183 Ga0206353_10627393 3300020082 Bacteria 909
184 Ga0213876_10211700 3300021384 Bacteria 1030
185 Ga0213875_10000723 3300021388 Bacteria 25222
186 Ga0224712_10031639 3300022467 Bacteria 1921
187 Ga0224712_10637331 3300022467 Bacteria 522
188 Ga0207692_10017014 3300025898 Bacteria 3234
189 Ga0207710_10150752 3300025900 Bacteria 1128
190 Ga0207710_10491766 3300025900 Bacteria 636
191 Ga0207688_10002304 3300025901 Bacteria 10271
192 Ga0207688_10120272 3300025901 Bacteria 1532
193 Ga0207688_10123335 3300025901 Bacteria 1513
194 Ga0207688_10913942 3300025901 Bacteria 556
195 Ga0207647_10129500 3300025904 Bacteria 1484
196 Ga0207685_10581299 3300025905 Bacteria 599
197 Ga0207699_10125433 3300025906 Bacteria 1666
198 Ga0207645_10023712 3300025907 Bacteria 3985
199 Ga0207643_10000039 3300025908 Bacteria 86154
200 Ga0207643_10319814 3300025908 Bacteria 969
201 Ga0207705_10134948 3300025909 Bacteria 1839
202 Ga0207684_10023134 3300025910 Bacteria 5306
203 Ga0207654_10056877 3300025911 Bacteria 2271
204 Ga0207654_10096662 3300025911 Bacteria 1812
205 Ga0207707_10712117 3300025912 Bacteria 842
206 Ga0207695_10663429 3300025913 Bacteria 924
207 Ga0207693_10103240 3300025915 Bacteria 2236
208 Ga0207663_10017833 3300025916 Bacteria 3965
209 Ga0207660_10041430 3300025917 Bacteria 3227
210 Ga0207657_10004984 3300025919 Bacteria 13967
211 Ga0207649_10014521 3300025920 Bacteria 4412
212 Ga0207652_10067224 3300025921 Bacteria 3107
213 Ga0207694_10080193 3300025924 Bacteria 2561
214 Ga0207650_10000470 3300025925 Bacteria 33897
215 Ga0207659_10072760 3300025926 Bacteria 2514
216 Ga0207687_10062810 3300025927 Bacteria 2628
217 Ga0207687_10079277 3300025927 Bacteria 2367
218 Ga0207664_10199142 3300025929 Bacteria 1728
219 Ga0207664_10668080 3300025929 Bacteria 934
220 Ga0207664_11748170 3300025929 Bacteria 544
221 Ga0207644_10066533 3300025931 Bacteria 2624
222 Ga0207690_10482859 3300025932 Bacteria 1000
223 Ga0207706_10214226 3300025933 Bacteria 1688
224 Ga0207709_10001922 3300025935 Bacteria 13650
225 Ga0207670_10045701 3300025936 Bacteria 2904
226 Ga0207669_10240424 3300025937 Bacteria 1342
227 Ga0207669_11781153 3300025937 Bacteria 526
228 Ga0207704_10451738 3300025938 Bacteria 1026
229 Ga0207711_10749557 3300025941 Bacteria 910
230 Ga0207689_10001021 3300025942 Bacteria 26898
231 Ga0207661_10053287 3300025944 Bacteria 3236
232 Ga0207661_10091346 3300025944 Bacteria 2536
233 Ga0207679_10037347 3300025945 Bacteria 3452
234 Ga0207667_11198069 3300025949 Bacteria 739
235 Ga0207651_10258065 3300025960 Bacteria 1429
236 Ga0207712_10776721 3300025961 Bacteria 841
237 Ga0207668_10477463 3300025972 Bacteria 1069
238 Ga0207668_12021137 3300025972 Bacteria 519
239 Ga0207640_10430407 3300025981 Bacteria 1082
240 Ga0207658_10847154 3300025986 Bacteria 831
241 Ga0207658_11452872 3300025986 Bacteria 627
242 Ga0207677_10049746 3300026023 Bacteria 2830
243 Ga0207677_10823069 3300026023 Bacteria 832
244 Ga0207703_10822005 3300026035 Bacteria 888
245 Ga0207703_10921175 3300026035 Bacteria 837
246 Ga0207639_11143966 3300026041 Bacteria 730
247 Ga0207678_10000435 3300026067 Bacteria 37869
248 Ga0207678_10134036 3300026067 Bacteria 2113
249 Ga0207708_10033383 3300026075 Bacteria 3910
250 Ga0207702_10002465 3300026078 Bacteria 17518
251 Ga0207702_10003149 3300026078 Bacteria 15277
252 Ga0207641_10791459 3300026088 Bacteria 938
253 Ga0207641_10968829 3300026088 Bacteria 846
254 Ga0207641_12095976 3300026088 Bacteria 566
255 Ga0207648_10444912 3300026089 Bacteria 1179
256 Ga0207676_10079429 3300026095 Bacteria 2660
257 Ga0207676_10162671 3300026095 Bacteria 1935
258 Ga0207676_10441240 3300026095 Bacteria 1225
259 Ga0207674_10056074 3300026116 Bacteria 4003
260 Ga0207674_10060181 3300026116 Bacteria 3841
261 Ga0207675_100491082 3300026118 Bacteria 1221
262 Ga0207683_10000214 3300026121 Bacteria 50433
263 Ga0207683_10063046 3300026121 Bacteria 3265
264 Ga0209813_10192640 3300027866 Bacteria 751
265 Ga0209813_10201100 3300027866 Bacteria 737
266 Ga0207428_10046619 3300027907 Bacteria 3486
267 Ga0268266_11118757 3300028379 Bacteria 762
268 Ga0268264_10042713 3300028381 Bacteria 3753
269 Ga0307512_10050977 3300030522 Bacteria 3318
270 Ga0316177_1038488 3300030731 Bacteria 758
271 Ga0316176_1068546 3300030732 Bacteria 793
272 Ga0314311_1056515 3300030733 Bacteria 2259
273 Ga0316180_1177274 3300030736 Bacteria 2002
274 Ga0265325_10062284 3300031241 Bacteria 1890
275 Ga0265325_10218958 3300031241 Bacteria 872
276 Ga0265340_10034345 3300031247 Bacteria 2523
277 Ga0265327_10000001 3300031251 Bacteria 894475
278 Ga0265313_10108811 3300031595 Bacteria 1221
279 Ga0307508_10474258 3300031616 Bacteria 845
280 Ga0307413_10005806 3300031824 Bacteria 5559
281 Ga0307413_10016088 3300031824 Bacteria 3853
282 Ga0307406_10108057 3300031901 Bacteria 1909
283 Ga0307406_11146373 3300031901 Bacteria 673
284 Ga0307412_10798666 3300031911 Bacteria 819
285 Ga0307416_100431018 3300032002 Bacteria 1366
286 Ga0307416_101513191 3300032002 Bacteria 777
287 Ga0307416_101907664 3300032002 Bacteria 697
288 Ga0307414_11648794 3300032004 Bacteria 598
289 Ga0307411_11447343 3300032005 Bacteria 630
290 Ga0307415_100063396 3300032126 Bacteria 2568
291 Ga0307415_100864701 3300032126 Bacteria 831
292 Ga0307510_10246341 3300033180 Bacteria 1278
293 Ga0373943_0776114 3300035170 Bacteria 570
294 Ga0373931_0346309 3300035691 Bacteria 929
295 Ga0373947_0554206 3300035725 Bacteria 783
296 Ga0373947_0688723 3300035725 Bacteria 697
297 Ga0436364_0026322 3300037853 Bacteria 25266
298 Ga0436364_0039922 3300037853 Bacteria 1456
299 Ga0436364_0121745 3300037853 Bacteria 509
300 Ga0436365_0057395 3300039437 Bacteria 2449
301 Ga0451789_0473891 3300041443 Bacteria 1279
302 Ga0451791_1820860 3300041451 Bacteria 1142
303 Ga0451793_0456360 3300041452 Bacteria 9447
304 Ga0451793_1327422 3300041452 Bacteria 582
305 Ga0451797_0342866 3300041453 Bacteria 565
306 Ga0451797_1575051 3300041453 Bacteria 3022
307 Ga0451798_1166537 3300041458 Bacteria 599
308 Ga0451800_0840105 3300041459 Bacteria 1847
309 Ga0451802_0459278 3300041460 Bacteria 2424
310 Ga0451839_1232171 3300041496 Bacteria 1173
311 Ga0451841_0523849 3300041498 Bacteria 4358
312 Ga0451849_1443823 3300041505 Bacteria 560
313 Ga0451843_0523087 3300041509 Bacteria 665
314 Ga0451843_0954255 3300041509 Bacteria 1414
315 Ga0451853_3232017 3300041512 Bacteria 861
316 Ga0439448_0007237 3300042005 Bacteria 3210
317 Ga0439455_0007984 3300042012 Bacteria 2257
318 Ga0439463_018473 3300042016 Bacteria 1735
319 Ga0439463_128913 3300042016 Bacteria 654
320 Ga0450914_001878 3300042118 Bacteria 1412
321 Ga0439458_0137316 3300042157 Bacteria 650
322 Ga0439459_0002532 3300042438 Bacteria 2827
323 Ga0439464_0020133 3300042439 Bacteria 1826
324 Ga0439440_0024199 3300042993 Bacteria 1391
325 Ga0466965_0000322 3300044683 Bacteria 16033
326 Ga0466961_0099101 3300044693 Bacteria 1837
327 Ga0466963_0569171 3300044694 Bacteria 800
328 Ga0466964_0853074 3300044706 Bacteria 518
329 Ga0466971_0061583 3300044719 Bacteria 1697
330 Ga0466971_0197217 3300044719 Bacteria 950
331 Ga0466970_0223175 3300044765 Bacteria 1052
332 Ga0466970_0378718 3300044765 Bacteria 805
333 Ga0466957_0673827 3300044842 Bacteria 728
334 Ga0466960_0000698 3300044901 Bacteria 11721
335 Ga0466960_0207372 3300044901 Bacteria 1073
336 Ga0466959_0097407 3300045049 Bacteria 2108
337 Ga0466959_0652039 3300045049 Bacteria 707
338 Ga0466967_0006591 3300045976 Bacteria 8246
339 Ga0466967_0351419 3300045976 Bacteria 1427
340 Ga0466967_0565943 3300045976 Bacteria 1119
341 Ga0495639_0187819 3300046475 Bacteria 1008
342 Ga0495664_0555283 3300046477 Bacteria 684
343 Ga0495607_0022718 3300046501 Bacteria 3935
344 Ga0495665_0061656 3300046531 Bacteria 1980
345 Ga0495645_0053786 3300046543 Bacteria 2926
346 Ga0495645_0436968 3300046543 Bacteria 828
347 Ga0495667_0284745 3300046559 Bacteria 1049
348 Ga0495656_0051885 3300046615 Bacteria 1757
349 Ga0495668_0003371 3300046616 Bacteria 12026
350 Ga0495588_0083862 3300046674 Bacteria 1665
351 Ga0495581_0349192 3300047315 Bacteria 863
352 Ga0495674_0152936 3300047319 Bacteria 1934
353 Ga0495683_0000245 3300047323 Bacteria 48819
354 Ga0495687_056684 3300047443 Bacteria 1633
355 Ga0496100_0002972 3300048903 Bacteria 8725
356 Ga0496101_0010173 3300048904 Bacteria 6207
357 Ga0496101_0081963 3300048904 Bacteria 2387
358 Ga0496102_0000187 3300048905 Bacteria 84207
359 Ga0496102_0004926 3300048905 Bacteria 11313
360 Ga0496102_0245798 3300048905 Bacteria 1687
361 Ga0496103_0000126 3300048906 Bacteria 82291
362 Ga0496103_0149280 3300048906 Bacteria 1497
363 Ga0496104_0001372 3300048907 Bacteria 21066
364 Ga0496104_0037302 3300048907 Bacteria 4546
365 Ga0496105_0001555 3300048908 Bacteria 16243
366 Ga0496105_0035917 3300048908 Bacteria 4082
367 Ga0496106_0026045 3300048909 Bacteria 4352
368 Ga0496108_0002366 3300048911 Bacteria 15097
369 Ga0496108_0196988 3300048911 Bacteria 1747
370 Ga0496108_0548785 3300048911 Bacteria 1008
371 Ga0496109_0027760 3300048912 Bacteria 5057
372 Ga0496109_0075829 3300048912 Bacteria 3092
373 Ga0496110_0081901 3300048913 Bacteria 2877
374 Ga0496110_0148961 3300048913 Bacteria 2118
375 Ga0496111_0066186 3300048914 Bacteria 2623
376 Ga0496111_0339737 3300048914 Bacteria 1112
377 Ga0496111_1173071 3300048914 Bacteria 545
378 Ga0496112_0004779 3300048915 Bacteria 11551
379 Ga0496112_0513968 3300048915 Bacteria 1132
380 Ga0496113_0536192 3300048916 Bacteria 939
381 Ga0496113_0768419 3300048916 Bacteria 767
382 Ga0496114_0017446 3300048917 Bacteria 5794
383 Ga0496114_0272199 3300048917 Bacteria 1492
384 Ga0496114_0693016 3300048917 Bacteria 894
385 Ga0496114_1202154 3300048917 Bacteria 644
386 Ga0496116_0000306 3300048919 Bacteria 82349
387 Ga0496117_0000343 3300048920 Bacteria 82294
388 Ga0496117_0368187 3300048920 Bacteria 736
389 Ga0496118_0000192 3300048921 Bacteria 107736
390 Ga0496119_0004864 3300048922 Bacteria 13159
391 Ga0496120_0006706 3300048923 Bacteria 8762
392 Ga0496121_0028292 3300048924 Bacteria 5221
393 Ga0496124_0019042 3300048927 Bacteria 6406
394 Ga0496125_0021099 3300048928 Bacteria 6087
395 Ga0496125_0465096 3300048928 Bacteria 720
396 Ga0496126_0000433 3300048929 Bacteria 84020
397 Ga0496126_0395488 3300048929 Bacteria 1122
398 Ga0501031_0476315 3300049568 Bacteria 806
399 Ga0501037_0008850 3300049573 Bacteria 7373
400 Ga0501038_0236844 3300049574 Bacteria 1450
401 Ga0501038_0883037 3300049574 Bacteria 661
402 Ga0501039_0449056 3300049575 Bacteria 1012
403 Ga0501043_0138744 3300049579 Bacteria 1904
404 Ga0501043_0380851 3300049579 Bacteria 1068
405 Ga0501046_0021164 3300049580 Bacteria 5370
406 Ga0501047_0028498 3300049581 Bacteria 5385
407 Ga0501047_0351486 3300049581 Bacteria 1311
408 Ga0501047_1200992 3300049581 Bacteria 572
409 Ga0501048_0157701 3300049582 Bacteria 1605
410 Ga0501069_0085183 3300049585 Bacteria 1783
411 Ga0501070_0653300 3300049586 Bacteria 835
412 Ga0501074_0027119 3300049590 Bacteria 4152
413 Ga0501044_0455950 3300049823 Bacteria 1184
414 nmdc:mga03683_465968_c1 3300050489 Bacteria 609
415 nmdc:mga03n38_16340_c1 3300050490 Bacteria 2885
416 nmdc:mga03n38_43659_c1 3300050490 Bacteria 1965
417 nmdc:mga00v17_83061_c1 3300050491 Bacteria 2003
418 nmdc:mga04h51_230076_c1 3300050495 Bacteria 737
419 nmdc:mga04h51_247125_c1 3300050495 Bacteria 714
420 nmdc:mga07m45_105717_c1 3300050496 Bacteria 1619
421 nmdc:mga07m45_287958_c1 3300050496 Bacteria 955
422 nmdc:mga07m45_516179_c1 3300050496 Bacteria 692
423 nmdc:mga05p37_830174_c1 3300050507 Bacteria 1007
424 nmdc:mga09592_461085_c1 3300050508 Bacteria 1096
425 nmdc:mga0qj67_3416_c1 3300050509 Bacteria 11457
426 nmdc:mga06r32_1141117_c1 3300050510 Bacteria 727
427 nmdc:mga0n895_9011_c1 3300050512 Bacteria 8702
428 nmdc:mga0rr50_156018_c1 3300050513 Bacteria 1849
429 nmdc:mga0rr50_182605_c1 3300050513 Bacteria 1716
430 nmdc:mga0a205_4767_c1 3300050515 Bacteria 12185
431 nmdc:mga0sz30_2838_c1 3300050516 Bacteria 2728
432 Ga0500560_098028 3300053107 Bacteria 981
433 Ga0500573_0050716 3300053140 Bacteria 2387
434 Ga0500636_0204710 3300053177 Bacteria 1041
435 Ga0466962_0465075 3300061719 Bacteria 638
436 2548692880 2547132424 Bacteria 8348532
437 2552105576 2551306166 Bacteria 9731570
438 2566995819 2565956761 Bacteria 6601618
439 2644515579 2643221692 Bacteria 7282860
440 2738888687 2738541308 Bacteria 7020677
441 2739237919 2738543011 Bacteria 5731169
442 2739364551 2738543034 Bacteria 6084756
443 2744955180 2744054611 Bacteria 5611514
444 2753039029 2751185725 Bacteria 5740550
445 2753327390 2751185792 Bacteria 5739090
446 2816509956 2816332139 Bacteria 9138787
447 2889303566 2889300758 Bacteria 5690814
448 2904537610 2904535858 Bacteria 6308016
449 2904775237 2904770941 Bacteria 5580202
450 2908814445 2908811453 Bacteria 5478616
451 2915361789 2915358134 Bacteria 6050864
452 2917743981 2917736166 Bacteria 9690793
453 2919420813 2919420072 Bacteria 5390363
454 2919433429 2919432681 Bacteria 5390474
455 2919717884 2919713450 Bacteria 7431245
456 2922558745 2922554459 Bacteria 6683962
457 2939747351 2939743619 Bacteria 5762299
458 2956942070 2956939328 Bacteria 3474458
459 2974318729 2974315732 Bacteria 4602776
460 2984527004 2984523437 Bacteria 4508481
461 3001119426 3001119090 Bacteria 3449530
462 8054477752 8054472261 Bacteria 7464355
463 Ga0307406_11991547
464 LJQas_1011387
465 rootH2_10040040
466 Ga0058862_10078475
467 Ga0070676_10044390
468 Ga0070670_100125402
469 Ga0068869_100007101
470 Ga0070680_100692990
471 Ga0070682_100002793
472 Ga0068868_100028863
473 Ga0070660_100078762
474 Ga0070689_100143298
475 Ga0070691_10055923
476 Ga0070661_100029486
477 Ga0070692_10062990
478 Ga0070668_100036981
479 Ga0070675_100002347
480 Ga0070671_100002344
481 Ga0070671_101326387
482 Ga0070673_100152445
483 Ga0070688_100482827
484 Ga0070659_100135913
485 Ga0070667_100095542
486 Ga0070667_101577063
487 Ga0070709_10013640
488 Ga0070714_100030465
489 Ga0070714_100223449
490 Ga0070714_100226972
491 Ga0070714_100877133
492 Ga0070714_101214126
493 Ga0070713_100008381
494 Ga0070710_10000178
495 Ga0070710_10223201
496 Ga0070701_10248031
497 Ga0070711_100018523
498 Ga0070705_101587619
499 Ga0070700_100078587
500 Ga0070708_100829868
501 Ga0070663_100104121
502 Ga0070663_100170519
503 Ga0070678_100024618
504 Ga0070678_100131530
505 Ga0070678_101493618
506 Ga0070662_100085703
507 Ga0070681_10083692
508 Ga0068867_100454705
509 Ga0070685_10008284
510 Ga0070685_11139557
511 Ga0070685_11443605
512 Ga0070706_100008560
513 Ga0070706_101112363
514 Ga0070698_100612273
515 Ga0070698_101111842
516 Ga0070679_100167908
517 Ga0070679_102109177
518 Ga0068853_100004684
519 Ga0070693_100017805
520 Ga0070665_100048658
521 Ga0070665_100300385
522 Ga0070704_100432332
523 Ga0070664_101637792
524 Ga0068857_100066021
525 Ga0068854_100044663
526 Ga0068856_100008389
527 Ga0068856_101842026
528 Ga0070702_100006551
529 Ga0068859_100086593
530 Ga0068864_100017887
531 Ga0068864_100084022
532 Ga0068864_100623102
533 Ga0068866_10107555
534 Ga0068866_10595082
535 Ga0068861_100573530
536 Ga0068851_10009681
537 Ga0068870_10046286
538 Ga0068870_10312448
539 Ga0068863_100017488
540 Ga0068863_100520762
541 Ga0068863_101246834
542 Ga0068858_101012915
543 Ga0081455_10043695
544 Ga0081455_10135394
545 Ga0070717_10260352
546 Ga0070717_11030061
547 Ga0075368_10259374
548 Ga0075368_10297386
549 Ga0075363_100014126
550 Ga0075363_100164356
551 Ga0075363_100224211
552 Ga0075364_10292014
553 Ga0070712_100023593
554 Ga0075362_10401515
555 Ga0075362_10615422
556 Ga0075367_10533840
557 Ga0075369_10043846
558 Ga0097621_100150528
559 Ga0097621_100756525
560 Ga0097621_101755609
561 Ga0075370_10143567
562 Ga0075370_10161096
563 Ga0075370_10274932
564 Ga0068871_100041003
565 Ga0068871_100380382
566 Ga0075428_100000501
567 Ga0075428_100524550
568 Ga0075428_100731851
569 Ga0075428_100963957
570 Ga0075428_100979452
571 Ga0075430_100005439
572 Ga0075433_10095188
573 Ga0075434_100051707
574 Ga0075429_100169801
575 Ga0097620_100086593
576 Ga0075435_100545678
577 Ga0105251_10026073
578 Ga0105251_10242273
579 Ga0105244_10261425
580 Ga0105250_10283506
581 Ga0105240_11428841
582 Ga0111539_10194303
583 Ga0105245_10301988
584 Ga0105245_10334586
585 Ga0105245_10757949
586 Ga0105247_10031511
587 Ga0105247_11068910
588 Ga0105247_11169682
589 Ga0114129_10018920
590 Ga0114129_10517490
591 Ga0105243_10001026
592 Ga0105243_10535148
593 Ga0105243_10706252
594 Ga0105243_12486342
595 Ga0105241_10038401
596 Ga0105241_10718162
597 Ga0105242_10106878
598 Ga0105242_12100564
599 Ga0105248_10023686
600 Ga0105237_10106153
601 Ga0105237_11156530
602 Ga0105238_10230665
603 Ga0105238_10715602
604 Ga0105249_11066571
605 Ga0105032_105842
606 Ga0105035_113237
607 Ga0105239_10190311
608 Ga0105246_10187065
609 Ga0105246_10797287
610 Ga0154012_135170
611 Ga0157373_10028556
612 Ga0157371_10116560
613 Ga0157370_10029061
614 Ga0157369_10633249
615 Ga0157374_10524611
616 Ga0157378_11509748
617 Ga0163162_10254163
618 Ga0163162_10398840
619 Ga0157372_10074760
620 Ga0157372_12954799
621 Ga0157375_10048459
622 Ga0157375_10254504
623 Ga0157375_12465724
624 Ga0163163_10103238
625 Ga0163163_10811239
626 Ga0163163_10870539
627 Ga0163163_11232112
628 Ga0163163_11635362
629 Ga0163163_11713719
630 Ga0163163_12189002
631 Ga0163163_12968028
632 Ga0182008_10029398
633 Ga0157377_10048191
634 Ga0157377_10750357
635 Ga0157379_10019799
636 Ga0157379_11371781
637 Ga0157376_10207301
638 Ga0163161_10299215
639 Ga0197907_10218777
640 Ga0206356_10474123
641 Ga0206355_1005808
642 Ga0206351_10060737
643 Ga0206354_10616106
644 Ga0206354_10616760
645 Ga0206353_10627393
646 Ga0213876_10211700
647 Ga0213875_10000723
648 Ga0224712_10031639
649 Ga0224712_10637331
650 Ga0207692_10017014
651 Ga0207710_10150752
652 Ga0207710_10491766
653 Ga0207688_10002304
654 Ga0207688_10120272
655 Ga0207688_10123335
656 Ga0207688_10913942
657 Ga0207647_10129500
658 Ga0207685_10581299
659 Ga0207699_10125433
660 Ga0207645_10023712
661 Ga0207643_10000039
662 Ga0207643_10319814
663 Ga0207705_10134948
664 Ga0207684_10023134
665 Ga0207654_10056877
666 Ga0207654_10096662
667 Ga0207707_10712117
668 Ga0207695_10663429
669 Ga0207693_10103240
670 Ga0207663_10017833
671 Ga0207660_10041430
672 Ga0207657_10004984
673 Ga0207649_10014521
674 Ga0207652_10067224
675 Ga0207694_10080193
676 Ga0207650_10000470
677 Ga0207659_10072760
678 Ga0207687_10062810
679 Ga0207687_10079277
680 Ga0207664_10199142
681 Ga0207664_10668080
682 Ga0207664_11748170
683 Ga0207644_10066533
684 Ga0207690_10482859
685 Ga0207706_10214226
686 Ga0207709_10001922
687 Ga0207670_10045701
688 Ga0207669_10240424
689 Ga0207669_11781153
690 Ga0207704_10451738
691 Ga0207711_10749557
692 Ga0207689_10001021
693 Ga0207661_10053287
694 Ga0207661_10091346
695 Ga0207679_10037347
696 Ga0207667_11198069
697 Ga0207651_10258065
698 Ga0207712_10776721
699 Ga0207668_10477463
700 Ga0207668_12021137
701 Ga0207640_10430407
702 Ga0207658_10847154
703 Ga0207658_11452872
704 Ga0207677_10049746
705 Ga0207677_10823069
706 Ga0207703_10822005
707 Ga0207703_10921175
708 Ga0207639_11143966
709 Ga0207678_10000435
710 Ga0207678_10134036
711 Ga0207708_10033383
712 Ga0207702_10002465
713 Ga0207702_10003149
714 Ga0207641_10791459
715 Ga0207641_10968829
716 Ga0207641_12095976
717 Ga0207648_10444912
718 Ga0207676_10079429
719 Ga0207676_10162671
720 Ga0207676_10441240
721 Ga0207674_10056074
722 Ga0207674_10060181
723 Ga0207675_100491082
724 Ga0207683_10000214
725 Ga0207683_10063046
726 Ga0209813_10192640
727 Ga0209813_10201100
728 Ga0207428_10046619
729 Ga0268266_11118757
730 Ga0268264_10042713
731 Ga0307512_10050977
732 Ga0316177_1038488
733 Ga0316176_1068546
734 Ga0314311_1056515
735 Ga0316180_1177274
736 Ga0265325_10062284
737 Ga0265325_10218958
738 Ga0265340_10034345
739 Ga0265327_10000001
740 Ga0265313_10108811
741 Ga0307508_10474258
742 Ga0307413_10005806
743 Ga0307413_10016088
744 Ga0307406_10108057
745 Ga0307406_11146373
746 Ga0307412_10798666
747 Ga0307416_100431018
748 Ga0307416_101513191
749 Ga0307416_101907664
750 Ga0307414_11648794
751 Ga0307411_11447343
752 Ga0307415_100063396
753 Ga0307415_100864701
754 Ga0307510_10246341
755 Ga0373943_0776114
756 Ga0373931_0346309
757 Ga0373947_0554206
758 Ga0373947_0688723
759 Ga0436364_0026322
760 Ga0436364_0039922
761 Ga0436364_0121745
762 Ga0436365_0057395
763 Ga0451789_0473891
764 Ga0451791_1820860
765 Ga0451793_0456360
766 Ga0451793_1327422
767 Ga0451797_0342866
768 Ga0451797_1575051
769 Ga0451798_1166537
770 Ga0451800_0840105
771 Ga0451802_0459278
772 Ga0451839_1232171
773 Ga0451841_0523849
774 Ga0451849_1443823
775 Ga0451843_0523087
776 Ga0451843_0954255
777 Ga0451853_3232017
778 Ga0439448_0007237
779 Ga0439455_0007984
780 Ga0439463_018473
781 Ga0439463_128913
782 Ga0450914_001878
783 Ga0439458_0137316
784 Ga0439459_0002532
785 Ga0439464_0020133
786 Ga0439440_0024199
787 Ga0466965_0000322
788 Ga0466961_0099101
789 Ga0466963_0569171
790 Ga0466964_0853074
791 Ga0466971_0061583
792 Ga0466971_0197217
793 Ga0466970_0223175
794 Ga0466970_0378718
795 Ga0466957_0673827
796 Ga0466960_0000698
797 Ga0466960_0207372
798 Ga0466959_0097407
799 Ga0466959_0652039
800 Ga0466967_0006591
801 Ga0466967_0351419
802 Ga0466967_0565943
803 Ga0495639_0187819
804 Ga0495664_0555283
805 Ga0495607_0022718
806 Ga0495665_0061656
807 Ga0495645_0053786
808 Ga0495645_0436968
809 Ga0495667_0284745
810 Ga0495656_0051885
811 Ga0495668_0003371
812 Ga0495588_0083862
813 Ga0495581_0349192
814 Ga0495674_0152936
815 Ga0495683_0000245
816 Ga0495687_056684
817 Ga0496100_0002972
818 Ga0496101_0010173
819 Ga0496101_0081963
820 Ga0496102_0000187
821 Ga0496102_0004926
822 Ga0496102_0245798
823 Ga0496103_0000126
824 Ga0496103_0149280
825 Ga0496104_0001372
826 Ga0496104_0037302
827 Ga0496105_0001555
828 Ga0496105_0035917
829 Ga0496106_0026045
830 Ga0496108_0002366
831 Ga0496108_0196988
832 Ga0496108_0548785
833 Ga0496109_0027760
834 Ga0496109_0075829
835 Ga0496110_0081901
836 Ga0496110_0148961
837 Ga0496111_0066186
838 Ga0496111_0339737
839 Ga0496111_1173071
840 Ga0496112_0004779
841 Ga0496112_0513968
842 Ga0496113_0536192
843 Ga0496113_0768419
844 Ga0496114_0017446
845 Ga0496114_0272199
846 Ga0496114_0693016
847 Ga0496114_1202154
848 Ga0496116_0000306
849 Ga0496117_0000343
850 Ga0496117_0368187
851 Ga0496118_0000192
852 Ga0496119_0004864
853 Ga0496120_0006706
854 Ga0496121_0028292
855 Ga0496124_0019042
856 Ga0496125_0021099
857 Ga0496125_0465096
858 Ga0496126_0000433
859 Ga0496126_0395488
860 Ga0501031_0476315
861 Ga0501037_0008850
862 Ga0501038_0236844
863 Ga0501038_0883037
864 Ga0501039_0449056
865 Ga0501043_0138744
866 Ga0501043_0380851
867 Ga0501046_0021164
868 Ga0501047_0028498
869 Ga0501047_0351486
870 Ga0501047_1200992
871 Ga0501048_0157701
872 Ga0501069_0085183
873 Ga0501070_0653300
874 Ga0501074_0027119
875 Ga0501044_0455950
876 nmdc:mga03683_465968_c1
877 nmdc:mga03n38_16340_c1
878 nmdc:mga03n38_43659_c1
879 nmdc:mga00v17_83061_c1
880 nmdc:mga04h51_230076_c1
881 nmdc:mga04h51_247125_c1
882 nmdc:mga07m45_105717_c1
883 nmdc:mga07m45_287958_c1
884 nmdc:mga07m45_516179_c1
885 nmdc:mga05p37_830174_c1
886 nmdc:mga09592_461085_c1
887 nmdc:mga0qj67_3416_c1
888 nmdc:mga06r32_1141117_c1
889 nmdc:mga0n895_9011_c1
890 nmdc:mga0rr50_156018_c1
891 nmdc:mga0rr50_182605_c1
892 nmdc:mga0a205_4767_c1
893 nmdc:mga0sz30_2838_c1
894 Ga0500560_098028
895 Ga0500573_0050716
896 Ga0500636_0204710
897 Ga0466962_0465075
898 2548692880
899 2552105576
900 2566995819
901 2644515579
902 2738888687
903 2739237919
904 2739364551
905 2744955180
906 2753039029
907 2753327390
908 2816509956
909 2889303566
910 2904537610
911 2904775237
912 2908814445
913 2915361789
914 2917743981
915 2919420813
916 2919433429
917 2919717884
918 2922558745
919 2939747351
920 2956942070
921 2974318729
922 2984527004
923 3001119426
924 8054477752

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07210

DUF1416

Protein of unknown function (DUF1416)

16

111

0.97

PF13620

CarboxypepD_reg

Carboxypeptidase regulatory-like domain

36

112

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hif-assembly1.cif.gz_Y kuenenia stuttgartiensis hydrazine dehydrogenase complex 0.8723 18 98
4v4c-assembly3.cif.gz_F crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici 0.8706 19 98
5ag9-assembly2.cif.gz_B crystal structure of a mutant (665sxa) c-terminal domain of rgpb 0.8291 32 86
4zjh-assembly1.cif.gz_A crystal structure of native alpha-2-macroglobulin from escherichia coli spanning domains nie-mg1. 0.823 31 84
3irp-assembly1.cif.gz_X crystal structure of functional region of uafa from staphylococcus saprophyticus at 1.50 angstrom resolution 0.8176 18 97
ID Description Score Start End Superfamily
af_P0CG96_23_100_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.9999 24 99 2.60.40.1120
af_P0CG96_23_100_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.962 24 99 2.60.40.1120
af_Q9JHW1_795_903_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8161 23 99 2.60.40.1120
1ti2B03 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.813 19 94 2.60.40.10
3irpX03 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8106 17 97 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7I7X584-F1-model_v4 DUF1416 domain-containing protein 1 23 99
AF-E3J5V1-F1-model_v4 DUF1416 domain-containing protein 0.9751 19 99
AF-A0A1H3LPK5-F1-model_v4 DUF1416 domain-containing protein 0.9749 34 99
AF-A0A810KTV9-F1-model_v4 DUF1416 domain-containing protein 0.9748 1 99 GO:0005975
AF-A0A1X0D9I5-F1-model_v4 Uncharacterized protein 0.9726 8 99

Map