F448915

General Info

Members Datasets Scaffolds Average Seq Length
462 271 924 226

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10499077|Ga0157370_104990771
Length 253
Sequence MNGAPTAVLFDVDGTLVDSNYLHAVCWWDALIQAGHDVPMARIHRAIGMGSDQLLDALLPPDRDRDADDGIRAAHGALYATYWSRQRPLAGAPELLRACKDQGLRVVLASSADSREFAALRAALNADDAVDDVTSSGDVDRSKPAPDLVQVALEKARVRPEEAVFVGDTVWDVQACNEVGVPCIGLLSGGISREELRDAGAAEVYLGPGDLLETLADSILGTGRLLSARTAGAHVQRAARAQGDPGRDRGVPA

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
166 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
167 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
168 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
179 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
229 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
247 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
248 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
257 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
258 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
259 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
260 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
261 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
264 2501939600 Micromonospora sp. L5 Isolate Unclassified
265 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
266 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
267 2855683550 Micromonospora sp. RP3T Isolate Unclassified
268 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
269 2902582711 Micromonospora sp. AP08 Isolate Unclassified
270 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
271 649633069 Micromonospora sp. L5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.32
Metatranscriptomes 1.95
Isolates 1.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.49
Nodule 0.22
Rhizoplane 8.44
Rhizosphere 78.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10499077 3300013104 Bacteria 1118
2 LJQas_1000242 3300000549 Bacteria 10018
3 JGI24743J22301_10005285 3300001991 Bacteria 2147
4 JGI24744J21845_10004647 3300002077 Bacteria 2840
5 Ga0070676_10067461 3300005328 Bacteria 2139
6 Ga0070683_100004610 3300005329 Bacteria 11384
7 Ga0070683_100028260 3300005329 Bacteria 5067
8 Ga0070683_100067977 3300005329 Bacteria 3319
9 Ga0070670_100059229 3300005331 Bacteria 3287
10 Ga0068869_100011285 3300005334 Bacteria 5853
11 Ga0068869_100076006 3300005334 Bacteria 2496
12 Ga0068869_100162899 3300005334 Bacteria 1737
13 Ga0070680_100106053 3300005336 Bacteria 2336
14 Ga0070682_100038305 3300005337 Bacteria 2941
15 Ga0068868_100026352 3300005338 Bacteria 4430
16 Ga0068868_100094095 3300005338 Bacteria 2417
17 Ga0070660_100132048 3300005339 Bacteria 1999
18 Ga0070691_10033728 3300005341 Bacteria 2409
19 Ga0070687_100122298 3300005343 Bacteria 1490
20 Ga0070661_100176892 3300005344 Bacteria 1622
21 Ga0070692_10175370 3300005345 Bacteria 1239
22 Ga0070692_10294196 3300005345 Bacteria 989
23 Ga0070668_100097208 3300005347 Bacteria 2328
24 Ga0070668_100101280 3300005347 Bacteria 2283
25 Ga0070675_100001139 3300005354 Bacteria 19182
26 Ga0070675_100042619 3300005354 Bacteria 3709
27 Ga0070674_100309285 3300005356 Bacteria 1263
28 Ga0070688_100009269 3300005365 Bacteria 5374
29 Ga0070659_100030685 3300005366 Bacteria 4160
30 Ga0070667_100001249 3300005367 Bacteria 23096
31 Ga0070667_100103663 3300005367 Bacteria 2459
32 Ga0070709_10006672 3300005434 Bacteria 6302
33 Ga0070709_10067613 3300005434 Bacteria 2295
34 Ga0070714_100002351 3300005435 Bacteria 13913
35 Ga0070714_100016845 3300005435 Bacteria 5911
36 Ga0070714_100033298 3300005435 Bacteria 4307
37 Ga0070714_100090818 3300005435 Bacteria 2675
38 Ga0070713_100012915 3300005436 Bacteria 6147
39 Ga0070713_100021690 3300005436 Bacteria 4947
40 Ga0070713_100108928 3300005436 Bacteria 2412
41 Ga0070710_10004201 3300005437 Bacteria 6828
42 Ga0070710_10043945 3300005437 Bacteria 2477
43 Ga0070701_10324140 3300005438 Bacteria 954
44 Ga0070711_100104882 3300005439 Bacteria 2063
45 Ga0070705_100136890 3300005440 Bacteria 1606
46 Ga0070700_100000003 3300005441 Bacteria 261247
47 Ga0070663_100003680 3300005455 Bacteria 8889
48 Ga0070662_100002640 3300005457 Bacteria 11052
49 Ga0070681_10053901 3300005458 Bacteria 4007
50 Ga0070679_100086985 3300005530 Bacteria 3112
51 Ga0070679_100199730 3300005530 Bacteria 1966
52 Ga0070684_100001585 3300005535 Bacteria 16418
53 Ga0070684_100038396 3300005535 Bacteria 4113
54 Ga0070684_100095350 3300005535 Bacteria 2651
55 Ga0070684_100140119 3300005535 Bacteria 2186
56 Ga0068853_100141655 3300005539 Bacteria 2159
57 Ga0070696_100107781 3300005546 Bacteria 2004
58 Ga0070693_100076302 3300005547 Bacteria 1986
59 Ga0070665_100030201 3300005548 Bacteria 5454
60 Ga0070665_100539071 3300005548 Bacteria 1179
61 Ga0068855_100025055 3300005563 Bacteria 7140
62 Ga0070664_100009119 3300005564 Bacteria 8053
63 Ga0070664_100082546 3300005564 Bacteria 2772
64 Ga0068857_100191217 3300005577 Bacteria 1864
65 Ga0068856_100125412 3300005614 Bacteria 2571
66 Ga0068856_100292399 3300005614 Bacteria 1646
67 Ga0068852_100023315 3300005616 Bacteria 4981
68 Ga0068852_100660153 3300005616 Bacteria 1054
69 Ga0068852_100915941 3300005616 Bacteria 894
70 Ga0068864_100021527 3300005618 Bacteria 5401
71 Ga0068866_10019625 3300005718 Bacteria 3082
72 Ga0068861_100397383 3300005719 Bacteria 1222
73 Ga0068863_100035135 3300005841 Bacteria 4775
74 Ga0068858_100143690 3300005842 Bacteria 2240
75 Ga0068862_100113817 3300005844 Bacteria 2377
76 Ga0068862_100215651 3300005844 Bacteria 1736
77 Ga0070717_10057827 3300006028 Bacteria 3205
78 Ga0070717_10080322 3300006028 Bacteria 2736
79 Ga0075363_100016211 3300006048 Bacteria 3677
80 Ga0075364_10010011 3300006051 Bacteria 5710
81 Ga0075364_10015126 3300006051 Bacteria 4779
82 Ga0070715_10009292 3300006163 Bacteria 3461
83 Ga0070716_100013711 3300006173 Bacteria 4136
84 Ga0070716_100576091 3300006173 Bacteria 843
85 Ga0070712_100038076 3300006175 Bacteria 3283
86 Ga0070712_100068385 3300006175 Bacteria 2531
87 Ga0070712_100214646 3300006175 Bacteria 1519
88 Ga0070712_100365386 3300006175 Bacteria 1184
89 Ga0075362_10092559 3300006177 Bacteria 1405
90 Ga0075367_10039413 3300006178 Bacteria 2755
91 Ga0075369_10000995 3300006186 Bacteria 9450
92 Ga0075369_10233753 3300006186 Bacteria 852
93 Ga0075370_10001825 3300006353 Bacteria 9524
94 Ga0075370_10035229 3300006353 Bacteria 2809
95 Ga0075370_10049200 3300006353 Bacteria 2389
96 Ga0075370_10081187 3300006353 Bacteria 1864
97 Ga0068871_100255678 3300006358 Bacteria 1527
98 Ga0075428_100001450 3300006844 Bacteria 25357
99 Ga0075428_100220897 3300006844 Bacteria 2046
100 Ga0075430_100001524 3300006846 Bacteria 18905
101 Ga0075430_100001791 3300006846 Bacteria 17572
102 Ga0075434_100448258 3300006871 Bacteria 1312
103 Ga0075434_100479962 3300006871 Archaea 1264
104 Ga0075435_100423559 3300007076 Bacteria 1147
105 Ga0099795_10014171 3300007788 Bacteria 2465
106 Ga0105250_10006078 3300009092 Bacteria 5315
107 Ga0105240_10038250 3300009093 Bacteria 6156
108 Ga0111539_10000821 3300009094 Bacteria 40288
109 Ga0105245_10128307 3300009098 Bacteria 2376
110 Ga0114129_10152338 3300009147 Bacteria 3164
111 Ga0105243_10247610 3300009148 Bacteria 1589
112 Ga0105237_10005369 3300009545 Bacteria 14494
113 Ga0105249_10027309 3300009553 Bacteria 5150
114 Ga0105239_10031939 3300010375 Bacteria 5785
115 Ga0105239_10724469 3300010375 Bacteria 1138
116 Ga0105246_10008982 3300011119 Bacteria 6154
117 Ga0105246_10177317 3300011119 Bacteria 1638
118 Ga0157370_10009445 3300013104 Bacteria 10417
119 Ga0157370_10032879 3300013104 Bacteria 5061
120 Ga0157369_10007442 3300013105 Bacteria 12610
121 Ga0157369_10090958 3300013105 Bacteria 3258
122 Ga0157369_10264884 3300013105 Bacteria 1792
123 Ga0157369_10401183 3300013105 Bacteria 1422
124 Ga0157374_10097643 3300013296 Bacteria 2811
125 Ga0163162_10206633 3300013306 Bacteria 2093
126 Ga0163162_10259457 3300013306 Bacteria 1870
127 Ga0157372_10391516 3300013307 Archaea 1619
128 Ga0157375_10064693 3300013308 Bacteria 3642
129 Ga0163163_10475959 3300014325 Bacteria 1310
130 Ga0157380_10192342 3300014326 Bacteria 1803
131 Ga0157377_10025532 3300014745 Bacteria 3152
132 Ga0157379_10168977 3300014968 Bacteria 1974
133 Ga0157376_10258489 3300014969 Bacteria 1630
134 Ga0163161_10280173 3300017792 Bacteria 1307
135 Ga0197907_11334825 3300020069 Bacteria 910
136 Ga0206356_10200614 3300020070 Bacteria 928
137 Ga0206350_11346535 3300020080 Bacteria 1487
138 Ga0206354_11094981 3300020081 Bacteria 2915
139 Ga0206353_10656241 3300020082 Bacteria 3469
140 Ga0206353_11386555 3300020082 Bacteria 1056
141 Ga0213875_10000452 3300021388 Bacteria 35594
142 Ga0213875_10184343 3300021388 Bacteria 981
143 Ga0224712_10024520 3300022467 Bacteria 2108
144 Ga0224712_10190346 3300022467 Bacteria 928
145 Ga0224712_10207589 3300022467 Bacteria 892
146 Ga0207692_10020886 3300025898 Bacteria 2987
147 Ga0207692_10058842 3300025898 Bacteria 1981
148 Ga0207642_10038328 3300025899 Bacteria 2073
149 Ga0207688_10007024 3300025901 Bacteria 6122
150 Ga0207688_10138444 3300025901 Bacteria 1431
151 Ga0207699_10120563 3300025906 Bacteria 1695
152 Ga0207699_10171804 3300025906 Bacteria 1451
153 Ga0207645_10123994 3300025907 Bacteria 1679
154 Ga0207645_10134530 3300025907 Bacteria 1610
155 Ga0207707_10028063 3300025912 Bacteria 4920
156 Ga0207671_10021428 3300025914 Bacteria 4904
157 Ga0207671_10167660 3300025914 Bacteria 1703
158 Ga0207693_10002211 3300025915 Bacteria 16958
159 Ga0207693_10102049 3300025915 Bacteria 2250
160 Ga0207693_10136616 3300025915 Bacteria 1928
161 Ga0207663_10037122 3300025916 Bacteria 2935
162 Ga0207660_10387252 3300025917 Bacteria 1124
163 Ga0207662_10148418 3300025918 Bacteria 1490
164 Ga0207657_10546239 3300025919 Bacteria 906
165 Ga0207652_10045481 3300025921 Bacteria 3743
166 Ga0207652_10159151 3300025921 Bacteria 2024
167 Ga0207659_10040719 3300025926 Bacteria 3251
168 Ga0207687_10039911 3300025927 Bacteria 3216
169 Ga0207687_10168984 3300025927 Bacteria 1685
170 Ga0207700_10013005 3300025928 Bacteria 5394
171 Ga0207700_10022733 3300025928 Bacteria 4307
172 Ga0207700_10145772 3300025928 Bacteria 1951
173 Ga0207700_10463383 3300025928 Bacteria 1118
174 Ga0207664_10003636 3300025929 Bacteria 10324
175 Ga0207664_10054008 3300025929 Bacteria 3182
176 Ga0207664_10059724 3300025929 Bacteria 3038
177 Ga0207664_10095846 3300025929 Bacteria 2441
178 Ga0207664_10215448 3300025929 Bacteria 1663
179 Ga0207664_10362937 3300025929 Bacteria 1283
180 Ga0207664_10580407 3300025929 Bacteria 1007
181 Ga0207690_10049749 3300025932 Bacteria 2795
182 Ga0207706_10011306 3300025933 Bacteria 8133
183 Ga0207706_10040413 3300025933 Bacteria 4134
184 Ga0207686_10036330 3300025934 Bacteria 2965
185 Ga0207709_10096721 3300025935 Bacteria 1943
186 Ga0207665_10003320 3300025939 Bacteria 10773
187 Ga0207689_10009427 3300025942 Bacteria 8430
188 Ga0207689_10692850 3300025942 Bacteria 859
189 Ga0207661_10008979 3300025944 Bacteria 7161
190 Ga0207661_10036912 3300025944 Bacteria 3818
191 Ga0207661_10056880 3300025944 Bacteria 3142
192 Ga0207661_10138431 3300025944 Bacteria 2093
193 Ga0207679_10003060 3300025945 Bacteria 10356
194 Ga0207679_10161676 3300025945 Bacteria 1834
195 Ga0207667_10024287 3300025949 Bacteria 6657
196 Ga0207712_10028478 3300025961 Bacteria 3737
197 Ga0207712_10101823 3300025961 Bacteria 2137
198 Ga0207668_10113876 3300025972 Bacteria 2035
199 Ga0207640_10555387 3300025981 Bacteria 965
200 Ga0207658_10061653 3300025986 Bacteria 2803
201 Ga0207658_10101871 3300025986 Bacteria 2251
202 Ga0207658_10364224 3300025986 Bacteria 1262
203 Ga0207677_10069703 3300026023 Bacteria 2474
204 Ga0207703_10155768 3300026035 Bacteria 1996
205 Ga0207678_10011208 3300026067 Bacteria 7875
206 Ga0207678_10092261 3300026067 Bacteria 2589
207 Ga0207678_10415516 3300026067 Archaea 1166
208 Ga0207708_10000002 3300026075 Bacteria 411071
209 Ga0207708_10010483 3300026075 Bacteria 6881
210 Ga0207702_10211965 3300026078 Bacteria 1801
211 Ga0207702_10875503 3300026078 Bacteria 890
212 Ga0207641_10026300 3300026088 Bacteria 4802
213 Ga0207648_10151875 3300026089 Bacteria 2043
214 Ga0207676_10041465 3300026095 Bacteria 3534
215 Ga0207674_10027445 3300026116 Bacteria 6021
216 Ga0207674_10231751 3300026116 Bacteria 1794
217 Ga0207675_100014450 3300026118 Bacteria 7361
218 Ga0207675_100048794 3300026118 Bacteria 3951
219 Ga0207675_100484048 3300026118 Bacteria 1230
220 Ga0207683_10084528 3300026121 Bacteria 2821
221 Ga0207698_10528681 3300026142 Bacteria 1152
222 Ga0207698_10702661 3300026142 Bacteria 1006
223 Ga0207698_10799003 3300026142 Bacteria 945
224 Ga0209813_10039725 3300027866 Bacteria 1427
225 Ga0207428_10265629 3300027907 Bacteria 1277
226 Ga0268266_10017872 3300028379 Bacteria 6042
227 Ga0268266_10521888 3300028379 Bacteria 1136
228 Ga0268265_10196252 3300028380 Bacteria 1747
229 Ga0268265_10206160 3300028380 Bacteria 1709
230 Ga0268264_10225484 3300028381 Bacteria 1727
231 Ga0268264_10546519 3300028381 Bacteria 1135
232 Ga0268264_10981651 3300028381 Bacteria 851
233 Ga0307517_10005122 3300028786 Bacteria 19915
234 Ga0265327_10000604 3300031251 Bacteria 59613
235 Ga0307508_10034686 3300031616 Bacteria 4548
236 Ga0307416_100074387 3300032002 Bacteria 2838
237 Ga0307416_100417903 3300032002 Bacteria 1384
238 Ga0373926_0008257 3300035083 Bacteria 3466
239 Ga0373934_0049339 3300035086 Bacteria 1667
240 Ga0373944_0001639 3300035089 Bacteria 5662
241 Ga0373923_0004964 3300035111 Bacteria 4472
242 Ga0373936_0012273 3300035113 Bacteria 3256
243 Ga0373945_0000022 3300035116 Bacteria 31935
244 Ga0373946_0000356 3300035171 Bacteria 14838
245 Ga0373955_0103712 3300035172 Bacteria 1636
246 Ga0373931_0175285 3300035691 Bacteria 1266
247 Ga0373935_0010476 3300035692 Bacteria 5562
248 Ga0373935_0230573 3300035692 Bacteria 1289
249 Ga0373927_0026616 3300035695 Bacteria 3780
250 Ga0373933_0010045 3300035724 Bacteria 5182
251 Ga0373937_0027835 3300036401 Bacteria 5113
252 Ga0373937_0046502 3300036401 Bacteria 3969
253 Ga0373937_0162278 3300036401 Bacteria 2095
254 Ga0373925_0014916 3300037068 Bacteria 5615
255 Ga0395898_0318572 3300037466 Bacteria 1483
256 Ga0436364_0045299 3300037853 Bacteria 62726
257 Ga0436364_0536219 3300037853 Bacteria 799
258 Ga0436364_1226794 3300037853 Bacteria 1371
259 Ga0395901_0082439 3300038443 Bacteria 3360
260 Ga0242420_005055 3300038996 Archaea 2025
261 Ga0436363_1070021 3300039450 Bacteria 1498
262 Ga0439466_0006873 3300041411 Bacteria 4312
263 Ga0439465_0005629 3300041413 Bacteria 3990
264 Ga0439431_0024114 3300041997 Bacteria 1478
265 Ga0466972_0026319 3300044658 Bacteria 2883
266 Ga0466972_0047241 3300044658 Bacteria 2082
267 Ga0466972_0057566 3300044658 Bacteria 1867
268 Ga0466972_0221282 3300044658 Bacteria 886
269 Ga0466966_0002534 3300044684 Bacteria 11962
270 Ga0466961_0184782 3300044693 Bacteria 1293
271 Ga0466961_0262271 3300044693 Bacteria 1059
272 Ga0466963_0282615 3300044694 Bacteria 1166
273 Ga0466971_0040031 3300044719 Bacteria 2105
274 Ga0466957_0159339 3300044842 Bacteria 1465
275 Ga0466957_0564285 3300044842 Bacteria 794
276 Ga0466960_0029807 3300044901 Bacteria 2507
277 Ga0466959_0008960 3300045049 Bacteria 7100
278 Ga0466959_0026760 3300045049 Bacteria 4277
279 Ga0466959_0048369 3300045049 Bacteria 3125
280 Ga0466959_0107205 3300045049 Bacteria 1997
281 Ga0466958_0078573 3300045836 Bacteria 2028
282 Ga0466958_0089217 3300045836 Bacteria 1906
283 Ga0466958_0354486 3300045836 Bacteria 945
284 Ga0466958_0401614 3300045836 Bacteria 885
285 Ga0466967_0062610 3300045976 Bacteria 3303
286 Ga0495592_0095934 3300046454 Bacteria 2120
287 Ga0495641_0027889 3300046461 Bacteria 2738
288 Ga0495651_0013786 3300046462 Bacteria 6251
289 Ga0495651_0015357 3300046462 Bacteria 5921
290 Ga0495651_0053162 3300046462 Bacteria 3119
291 Ga0495653_0015865 3300046463 Bacteria 6139
292 Ga0495653_0037801 3300046463 Bacteria 3790
293 Ga0495653_0117376 3300046463 Bacteria 1901
294 Ga0495582_0097771 3300046473 Bacteria 1642
295 Ga0495664_0001507 3300046477 Bacteria 12335
296 Ga0495664_0004566 3300046477 Bacteria 7574
297 Ga0495664_0025444 3300046477 Bacteria 3446
298 Ga0495608_0024746 3300046511 Bacteria 4102
299 Ga0495608_0051607 3300046511 Bacteria 2725
300 Ga0495608_0075279 3300046511 Bacteria 2200
301 Ga0495608_0456004 3300046511 Bacteria 777
302 Ga0495618_0006962 3300046514 Bacteria 6850
303 Ga0495618_0021020 3300046514 Bacteria 4021
304 Ga0495618_0077703 3300046514 Bacteria 2115
305 Ga0495618_0103644 3300046514 Bacteria 1821
306 Ga0495628_0031077 3300046516 Bacteria 4320
307 Ga0495628_0273340 3300046516 Bacteria 1256
308 Ga0495630_0045234 3300046517 Bacteria 3289
309 Ga0495630_0246731 3300046517 Bacteria 1364
310 Ga0495652_0007955 3300046529 Bacteria 9733
311 Ga0495652_0024865 3300046529 Bacteria 5299
312 Ga0495652_0049011 3300046529 Bacteria 3617
313 Ga0495665_0006115 3300046531 Bacteria 6498
314 Ga0495640_0158045 3300046533 Bacteria 1454
315 Ga0495640_0233776 3300046533 Bacteria 1155
316 Ga0495587_0028244 3300046536 Bacteria 3412
317 Ga0495667_0001024 3300046559 Bacteria 18088
318 Ga0495667_0038440 3300046559 Bacteria 3186
319 Ga0495667_0058386 3300046559 Bacteria 2535
320 Ga0495667_0112022 3300046559 Bacteria 1763
321 Ga0495634_0005893 3300046642 Bacteria 9360
322 Ga0495634_0148292 3300046642 Bacteria 1485
323 Ga0495634_0191779 3300046642 Bacteria 1274
324 Ga0495635_0000199 3300046663 Bacteria 37937
325 Ga0495635_0149655 3300046663 Bacteria 1589
326 Ga0495657_0039921 3300046675 Bacteria 3223
327 Ga0495657_0044132 3300046675 Bacteria 3035
328 Ga0495599_0009374 3300046678 Bacteria 5981
329 Ga0495599_0263259 3300046678 Bacteria 1047
330 Ga0495646_0079175 3300046680 Bacteria 1919
331 Ga0495624_0001602 3300046690 Bacteria 17361
332 Ga0495600_0032400 3300046809 Bacteria 3391
333 Ga0495600_0137619 3300046809 Bacteria 1585
334 Ga0495600_0170930 3300046809 Bacteria 1403
335 Ga0495600_0189927 3300046809 Bacteria 1321
336 Ga0495604_0229447 3300047317 Bacteria 1274
337 Ga0495674_0000328 3300047319 Bacteria 41808
338 Ga0495674_0162146 3300047319 Bacteria 1870
339 Ga0495674_0174676 3300047319 Bacteria 1791
340 Ga0495676_0009612 3300047321 Bacteria 8802
341 Ga0495680_0006297 3300047322 Bacteria 11052
342 Ga0495680_0013475 3300047322 Bacteria 7132
343 Ga0495680_0018780 3300047322 Bacteria 5859
344 Ga0495680_0047252 3300047322 Bacteria 3387
345 Ga0495675_0402293 3300047444 Bacteria 798
346 Ga0495684_0001085 3300047471 Bacteria 21968
347 Ga0495684_0028401 3300047471 Bacteria 4295
348 Ga0495684_0052564 3300047471 Bacteria 3109
349 Ga0495684_0164238 3300047471 Bacteria 1655
350 Ga0495686_0001464 3300047472 Bacteria 25716
351 Ga0495593_0022505 3300047673 Bacteria 3511
352 Ga0495602_0032442 3300048088 Bacteria 4917
353 Ga0495602_0201632 3300048088 Bacteria 1517
354 Ga0495602_0365232 3300048088 Bacteria 1038
355 Ga0496100_0000145 3300048903 Bacteria 39148
356 Ga0496101_0000118 3300048904 Bacteria 77684
357 Ga0496102_0011754 3300048905 Bacteria 7555
358 Ga0496102_0019653 3300048905 Bacteria 5952
359 Ga0496102_0072905 3300048905 Bacteria 3156
360 Ga0496102_0088023 3300048905 Bacteria 2870
361 Ga0496102_0378859 3300048905 Bacteria 1331
362 Ga0496102_0397227 3300048905 Bacteria 1296
363 Ga0496103_0001331 3300048906 Bacteria 16740
364 Ga0496103_0018162 3300048906 Bacteria 4217
365 Ga0496103_0062062 3300048906 Bacteria 2326
366 Ga0496103_0269663 3300048906 Bacteria 1095
367 Ga0496106_0003374 3300048909 Bacteria 11909
368 Ga0496106_0003401 3300048909 Bacteria 11852
369 Ga0496106_0022110 3300048909 Bacteria 4724
370 Ga0496107_0004035 3300048910 Bacteria 9887
371 Ga0496107_0040257 3300048910 Bacteria 3354
372 Ga0496107_0221536 3300048910 Bacteria 1407
373 Ga0496108_0000628 3300048911 Bacteria 27558
374 Ga0496108_0001232 3300048911 Bacteria 20073
375 Ga0496109_0000401 3300048912 Bacteria 39175
376 Ga0496109_0007586 3300048912 Bacteria 9198
377 Ga0496109_0055532 3300048912 Bacteria 3613
378 Ga0496109_0094217 3300048912 Bacteria 2771
379 Ga0496110_0020280 3300048913 Bacteria 5612
380 Ga0496110_0135117 3300048913 Bacteria 2228
381 Ga0496110_0164847 3300048913 Bacteria 2009
382 Ga0496110_0554573 3300048913 Bacteria 1044
383 Ga0496111_0008965 3300048914 Bacteria 6654
384 Ga0496111_0149798 3300048914 Archaea 1730
385 Ga0496111_0406441 3300048914 Bacteria 1006
386 Ga0496112_0079919 3300048915 Bacteria 3234
387 Ga0496112_0320946 3300048915 Bacteria 1493
388 Ga0496113_0063626 3300048916 Bacteria 2788
389 Ga0496113_0075969 3300048916 Bacteria 2565
390 Ga0496113_0127350 3300048916 Archaea 1995
391 Ga0496113_0188305 3300048916 Bacteria 1638
392 Ga0496114_0007889 3300048917 Bacteria 8423
393 Ga0496115_0022280 3300048918 Bacteria 4906
394 Ga0496116_0022778 3300048919 Bacteria 4683
395 Ga0496117_0016614 3300048920 Bacteria 6198
396 Ga0496117_0033007 3300048920 Bacteria 3920
397 Ga0496118_0000295 3300048921 Bacteria 86668
398 Ga0496118_0039607 3300048921 Bacteria 3757
399 Ga0496119_0010262 3300048922 Bacteria 7894
400 Ga0496121_0000002 3300048924 Bacteria 1494588
401 Ga0496121_0010290 3300048924 Bacteria 10583
402 Ga0496122_0000141 3300048925 Bacteria 168707
403 Ga0496123_0052293 3300048926 Bacteria 2712
404 Ga0496124_0000002 3300048927 Bacteria 1494588
405 Ga0496125_0000002 3300048928 Bacteria 1480920
406 Ga0496126_0000011 3300048929 Bacteria 744275
407 Ga0496126_0000235 3300048929 Bacteria 119657
408 Ga0496126_0000586 3300048929 Bacteria 68837
409 Ga0496126_0001416 3300048929 Bacteria 37926
410 Ga0496126_0078077 3300048929 Bacteria 2934
411 Ga0501033_0119504 3300049570 Bacteria 1913
412 Ga0501034_0061558 3300049571 Bacteria 3769
413 Ga0501043_0560883 3300049579 Bacteria 847
414 Ga0501047_0005341 3300049581 Bacteria 12076
415 Ga0501067_0009612 3300049583 Bacteria 5355
416 Ga0501067_0110744 3300049583 Bacteria 1526
417 Ga0501067_0325282 3300049583 Bacteria 856
418 Ga0501068_0005947 3300049584 Bacteria 6696
419 Ga0501069_0020897 3300049585 Bacteria 3550
420 Ga0501069_0135500 3300049585 Bacteria 1411
421 Ga0501072_0119038 3300049588 Bacteria 2104
422 Ga0501035_0000729 3300049822 Bacteria 35689
423 Ga0501035_0684962 3300049822 Bacteria 828
424 Ga0501044_0000150 3300049823 Bacteria 85886
425 nmdc:mga03n38_35048_c1 3300050490 Bacteria 2147
426 nmdc:mga03n38_50155_c1 3300050490 Bacteria 1859
427 nmdc:mga00v17_19011_c1 3300050491 Bacteria 3914
428 nmdc:mga00v17_308703_c1 3300050491 Bacteria 1028
429 nmdc:mga00v17_575462_c1 3300050491 Bacteria 727
430 nmdc:mga0yw44_127519_c1 3300050492 Bacteria 1644
431 nmdc:mga0yw44_259779_c1 3300050492 Bacteria 1157
432 nmdc:mga06z11_35081_c1 3300050494 Bacteria 2466
433 nmdc:mga04h51_21358_c1 3300050495 Bacteria 1946
434 nmdc:mga07m45_11706_c1 3300050496 Bacteria 2263
435 nmdc:mga07m45_14582_c1 3300050496 Bacteria 4190
436 nmdc:mga07m45_5496_c1 3300050496 Bacteria 6312
437 nmdc:mga05p37_30180_c1 3300050507 Bacteria 6614
438 nmdc:mga0qj67_223_c1 3300050509 Bacteria 38690
439 nmdc:mga0qj67_4017_c1 3300050509 Bacteria 10653
440 nmdc:mga06r32_187041_c1 3300050510 Bacteria 2058
441 nmdc:mga0n895_417287_c1 3300050512 Bacteria 1357
442 nmdc:mga0a205_762465_c1 3300050515 Bacteria 816
443 nmdc:mga0sz30_23211_c2 3300050516 Bacteria 2082
444 Ga0495601_0087171 3300053077 Bacteria 2007
445 Ga0495601_0432384 3300053077 Bacteria 852
446 Ga0495655_0005344 3300053083 Bacteria 2265
447 Ga0495595_0150699 3300053084 Bacteria 1144
448 Ga0495595_0310983 3300053084 Bacteria 793
449 Ga0500578_0139059 3300053086 Bacteria 1519
450 Ga0500560_063255 3300053107 Bacteria 1210
451 Ga0500614_022260 3300053123 Bacteria 1478
452 Ga0500600_0040487 3300053149 Bacteria 2691
453 Ga0500616_0150536 3300053153 Bacteria 1077
454 Ga0466962_0023973 3300061719 Bacteria 2933
455 2501940975 2501939600 Bacteria 6907073
456 2623587844 2622736626 Bacteria 7181580
457 2842139861 2842134933 Bacteria 5847019
458 2855687131 2855683550 Bacteria 7134265
459 2856861876 2856858025 Bacteria 7255264
460 2902586841 2902582711 Bacteria 6187705
461 3003008304 3002998708 Bacteria 11715108
462 649812476 649633069 Bacteria 6962533
463 Ga0157370_10499077
464 LJQas_1000242
465 JGI24743J22301_10005285
466 JGI24744J21845_10004647
467 Ga0070676_10067461
468 Ga0070683_100004610
469 Ga0070683_100028260
470 Ga0070683_100067977
471 Ga0070670_100059229
472 Ga0068869_100011285
473 Ga0068869_100076006
474 Ga0068869_100162899
475 Ga0070680_100106053
476 Ga0070682_100038305
477 Ga0068868_100026352
478 Ga0068868_100094095
479 Ga0070660_100132048
480 Ga0070691_10033728
481 Ga0070687_100122298
482 Ga0070661_100176892
483 Ga0070692_10175370
484 Ga0070692_10294196
485 Ga0070668_100097208
486 Ga0070668_100101280
487 Ga0070675_100001139
488 Ga0070675_100042619
489 Ga0070674_100309285
490 Ga0070688_100009269
491 Ga0070659_100030685
492 Ga0070667_100001249
493 Ga0070667_100103663
494 Ga0070709_10006672
495 Ga0070709_10067613
496 Ga0070714_100002351
497 Ga0070714_100016845
498 Ga0070714_100033298
499 Ga0070714_100090818
500 Ga0070713_100012915
501 Ga0070713_100021690
502 Ga0070713_100108928
503 Ga0070710_10004201
504 Ga0070710_10043945
505 Ga0070701_10324140
506 Ga0070711_100104882
507 Ga0070705_100136890
508 Ga0070700_100000003
509 Ga0070663_100003680
510 Ga0070662_100002640
511 Ga0070681_10053901
512 Ga0070679_100086985
513 Ga0070679_100199730
514 Ga0070684_100001585
515 Ga0070684_100038396
516 Ga0070684_100095350
517 Ga0070684_100140119
518 Ga0068853_100141655
519 Ga0070696_100107781
520 Ga0070693_100076302
521 Ga0070665_100030201
522 Ga0070665_100539071
523 Ga0068855_100025055
524 Ga0070664_100009119
525 Ga0070664_100082546
526 Ga0068857_100191217
527 Ga0068856_100125412
528 Ga0068856_100292399
529 Ga0068852_100023315
530 Ga0068852_100660153
531 Ga0068852_100915941
532 Ga0068864_100021527
533 Ga0068866_10019625
534 Ga0068861_100397383
535 Ga0068863_100035135
536 Ga0068858_100143690
537 Ga0068862_100113817
538 Ga0068862_100215651
539 Ga0070717_10057827
540 Ga0070717_10080322
541 Ga0075363_100016211
542 Ga0075364_10010011
543 Ga0075364_10015126
544 Ga0070715_10009292
545 Ga0070716_100013711
546 Ga0070716_100576091
547 Ga0070712_100038076
548 Ga0070712_100068385
549 Ga0070712_100214646
550 Ga0070712_100365386
551 Ga0075362_10092559
552 Ga0075367_10039413
553 Ga0075369_10000995
554 Ga0075369_10233753
555 Ga0075370_10001825
556 Ga0075370_10035229
557 Ga0075370_10049200
558 Ga0075370_10081187
559 Ga0068871_100255678
560 Ga0075428_100001450
561 Ga0075428_100220897
562 Ga0075430_100001524
563 Ga0075430_100001791
564 Ga0075434_100448258
565 Ga0075434_100479962
566 Ga0075435_100423559
567 Ga0099795_10014171
568 Ga0105250_10006078
569 Ga0105240_10038250
570 Ga0111539_10000821
571 Ga0105245_10128307
572 Ga0114129_10152338
573 Ga0105243_10247610
574 Ga0105237_10005369
575 Ga0105249_10027309
576 Ga0105239_10031939
577 Ga0105239_10724469
578 Ga0105246_10008982
579 Ga0105246_10177317
580 Ga0157370_10009445
581 Ga0157370_10032879
582 Ga0157369_10007442
583 Ga0157369_10090958
584 Ga0157369_10264884
585 Ga0157369_10401183
586 Ga0157374_10097643
587 Ga0163162_10206633
588 Ga0163162_10259457
589 Ga0157372_10391516
590 Ga0157375_10064693
591 Ga0163163_10475959
592 Ga0157380_10192342
593 Ga0157377_10025532
594 Ga0157379_10168977
595 Ga0157376_10258489
596 Ga0163161_10280173
597 Ga0197907_11334825
598 Ga0206356_10200614
599 Ga0206350_11346535
600 Ga0206354_11094981
601 Ga0206353_10656241
602 Ga0206353_11386555
603 Ga0213875_10000452
604 Ga0213875_10184343
605 Ga0224712_10024520
606 Ga0224712_10190346
607 Ga0224712_10207589
608 Ga0207692_10020886
609 Ga0207692_10058842
610 Ga0207642_10038328
611 Ga0207688_10007024
612 Ga0207688_10138444
613 Ga0207699_10120563
614 Ga0207699_10171804
615 Ga0207645_10123994
616 Ga0207645_10134530
617 Ga0207707_10028063
618 Ga0207671_10021428
619 Ga0207671_10167660
620 Ga0207693_10002211
621 Ga0207693_10102049
622 Ga0207693_10136616
623 Ga0207663_10037122
624 Ga0207660_10387252
625 Ga0207662_10148418
626 Ga0207657_10546239
627 Ga0207652_10045481
628 Ga0207652_10159151
629 Ga0207659_10040719
630 Ga0207687_10039911
631 Ga0207687_10168984
632 Ga0207700_10013005
633 Ga0207700_10022733
634 Ga0207700_10145772
635 Ga0207700_10463383
636 Ga0207664_10003636
637 Ga0207664_10054008
638 Ga0207664_10059724
639 Ga0207664_10095846
640 Ga0207664_10215448
641 Ga0207664_10362937
642 Ga0207664_10580407
643 Ga0207690_10049749
644 Ga0207706_10011306
645 Ga0207706_10040413
646 Ga0207686_10036330
647 Ga0207709_10096721
648 Ga0207665_10003320
649 Ga0207689_10009427
650 Ga0207689_10692850
651 Ga0207661_10008979
652 Ga0207661_10036912
653 Ga0207661_10056880
654 Ga0207661_10138431
655 Ga0207679_10003060
656 Ga0207679_10161676
657 Ga0207667_10024287
658 Ga0207712_10028478
659 Ga0207712_10101823
660 Ga0207668_10113876
661 Ga0207640_10555387
662 Ga0207658_10061653
663 Ga0207658_10101871
664 Ga0207658_10364224
665 Ga0207677_10069703
666 Ga0207703_10155768
667 Ga0207678_10011208
668 Ga0207678_10092261
669 Ga0207678_10415516
670 Ga0207708_10000002
671 Ga0207708_10010483
672 Ga0207702_10211965
673 Ga0207702_10875503
674 Ga0207641_10026300
675 Ga0207648_10151875
676 Ga0207676_10041465
677 Ga0207674_10027445
678 Ga0207674_10231751
679 Ga0207675_100014450
680 Ga0207675_100048794
681 Ga0207675_100484048
682 Ga0207683_10084528
683 Ga0207698_10528681
684 Ga0207698_10702661
685 Ga0207698_10799003
686 Ga0209813_10039725
687 Ga0207428_10265629
688 Ga0268266_10017872
689 Ga0268266_10521888
690 Ga0268265_10196252
691 Ga0268265_10206160
692 Ga0268264_10225484
693 Ga0268264_10546519
694 Ga0268264_10981651
695 Ga0307517_10005122
696 Ga0265327_10000604
697 Ga0307508_10034686
698 Ga0307416_100074387
699 Ga0307416_100417903
700 Ga0373926_0008257
701 Ga0373934_0049339
702 Ga0373944_0001639
703 Ga0373923_0004964
704 Ga0373936_0012273
705 Ga0373945_0000022
706 Ga0373946_0000356
707 Ga0373955_0103712
708 Ga0373931_0175285
709 Ga0373935_0010476
710 Ga0373935_0230573
711 Ga0373927_0026616
712 Ga0373933_0010045
713 Ga0373937_0027835
714 Ga0373937_0046502
715 Ga0373937_0162278
716 Ga0373925_0014916
717 Ga0395898_0318572
718 Ga0436364_0045299
719 Ga0436364_0536219
720 Ga0436364_1226794
721 Ga0395901_0082439
722 Ga0242420_005055
723 Ga0436363_1070021
724 Ga0439466_0006873
725 Ga0439465_0005629
726 Ga0439431_0024114
727 Ga0466972_0026319
728 Ga0466972_0047241
729 Ga0466972_0057566
730 Ga0466972_0221282
731 Ga0466966_0002534
732 Ga0466961_0184782
733 Ga0466961_0262271
734 Ga0466963_0282615
735 Ga0466971_0040031
736 Ga0466957_0159339
737 Ga0466957_0564285
738 Ga0466960_0029807
739 Ga0466959_0008960
740 Ga0466959_0026760
741 Ga0466959_0048369
742 Ga0466959_0107205
743 Ga0466958_0078573
744 Ga0466958_0089217
745 Ga0466958_0354486
746 Ga0466958_0401614
747 Ga0466967_0062610
748 Ga0495592_0095934
749 Ga0495641_0027889
750 Ga0495651_0013786
751 Ga0495651_0015357
752 Ga0495651_0053162
753 Ga0495653_0015865
754 Ga0495653_0037801
755 Ga0495653_0117376
756 Ga0495582_0097771
757 Ga0495664_0001507
758 Ga0495664_0004566
759 Ga0495664_0025444
760 Ga0495608_0024746
761 Ga0495608_0051607
762 Ga0495608_0075279
763 Ga0495608_0456004
764 Ga0495618_0006962
765 Ga0495618_0021020
766 Ga0495618_0077703
767 Ga0495618_0103644
768 Ga0495628_0031077
769 Ga0495628_0273340
770 Ga0495630_0045234
771 Ga0495630_0246731
772 Ga0495652_0007955
773 Ga0495652_0024865
774 Ga0495652_0049011
775 Ga0495665_0006115
776 Ga0495640_0158045
777 Ga0495640_0233776
778 Ga0495587_0028244
779 Ga0495667_0001024
780 Ga0495667_0038440
781 Ga0495667_0058386
782 Ga0495667_0112022
783 Ga0495634_0005893
784 Ga0495634_0148292
785 Ga0495634_0191779
786 Ga0495635_0000199
787 Ga0495635_0149655
788 Ga0495657_0039921
789 Ga0495657_0044132
790 Ga0495599_0009374
791 Ga0495599_0263259
792 Ga0495646_0079175
793 Ga0495624_0001602
794 Ga0495600_0032400
795 Ga0495600_0137619
796 Ga0495600_0170930
797 Ga0495600_0189927
798 Ga0495604_0229447
799 Ga0495674_0000328
800 Ga0495674_0162146
801 Ga0495674_0174676
802 Ga0495676_0009612
803 Ga0495680_0006297
804 Ga0495680_0013475
805 Ga0495680_0018780
806 Ga0495680_0047252
807 Ga0495675_0402293
808 Ga0495684_0001085
809 Ga0495684_0028401
810 Ga0495684_0052564
811 Ga0495684_0164238
812 Ga0495686_0001464
813 Ga0495593_0022505
814 Ga0495602_0032442
815 Ga0495602_0201632
816 Ga0495602_0365232
817 Ga0496100_0000145
818 Ga0496101_0000118
819 Ga0496102_0011754
820 Ga0496102_0019653
821 Ga0496102_0072905
822 Ga0496102_0088023
823 Ga0496102_0378859
824 Ga0496102_0397227
825 Ga0496103_0001331
826 Ga0496103_0018162
827 Ga0496103_0062062
828 Ga0496103_0269663
829 Ga0496106_0003374
830 Ga0496106_0003401
831 Ga0496106_0022110
832 Ga0496107_0004035
833 Ga0496107_0040257
834 Ga0496107_0221536
835 Ga0496108_0000628
836 Ga0496108_0001232
837 Ga0496109_0000401
838 Ga0496109_0007586
839 Ga0496109_0055532
840 Ga0496109_0094217
841 Ga0496110_0020280
842 Ga0496110_0135117
843 Ga0496110_0164847
844 Ga0496110_0554573
845 Ga0496111_0008965
846 Ga0496111_0149798
847 Ga0496111_0406441
848 Ga0496112_0079919
849 Ga0496112_0320946
850 Ga0496113_0063626
851 Ga0496113_0075969
852 Ga0496113_0127350
853 Ga0496113_0188305
854 Ga0496114_0007889
855 Ga0496115_0022280
856 Ga0496116_0022778
857 Ga0496117_0016614
858 Ga0496117_0033007
859 Ga0496118_0000295
860 Ga0496118_0039607
861 Ga0496119_0010262
862 Ga0496121_0000002
863 Ga0496121_0010290
864 Ga0496122_0000141
865 Ga0496123_0052293
866 Ga0496124_0000002
867 Ga0496125_0000002
868 Ga0496126_0000011
869 Ga0496126_0000235
870 Ga0496126_0000586
871 Ga0496126_0001416
872 Ga0496126_0078077
873 Ga0501033_0119504
874 Ga0501034_0061558
875 Ga0501043_0560883
876 Ga0501047_0005341
877 Ga0501067_0009612
878 Ga0501067_0110744
879 Ga0501067_0325282
880 Ga0501068_0005947
881 Ga0501069_0020897
882 Ga0501069_0135500
883 Ga0501072_0119038
884 Ga0501035_0000729
885 Ga0501035_0684962
886 Ga0501044_0000150
887 nmdc:mga03n38_35048_c1
888 nmdc:mga03n38_50155_c1
889 nmdc:mga00v17_19011_c1
890 nmdc:mga00v17_308703_c1
891 nmdc:mga00v17_575462_c1
892 nmdc:mga0yw44_127519_c1
893 nmdc:mga0yw44_259779_c1
894 nmdc:mga06z11_35081_c1
895 nmdc:mga04h51_21358_c1
896 nmdc:mga07m45_11706_c1
897 nmdc:mga07m45_14582_c1
898 nmdc:mga07m45_5496_c1
899 nmdc:mga05p37_30180_c1
900 nmdc:mga0qj67_223_c1
901 nmdc:mga0qj67_4017_c1
902 nmdc:mga06r32_187041_c1
903 nmdc:mga0n895_417287_c1
904 nmdc:mga0a205_762465_c1
905 nmdc:mga0sz30_23211_c2
906 Ga0495601_0087171
907 Ga0495601_0432384
908 Ga0495655_0005344
909 Ga0495595_0150699
910 Ga0495595_0310983
911 Ga0500578_0139059
912 Ga0500560_063255
913 Ga0500614_022260
914 Ga0500600_0040487
915 Ga0500616_0150536
916 Ga0466962_0023973
917 2501940975
918 2623587844
919 2842139861
920 2855687131
921 2856861876
922 2902586841
923 3003008304
924 649812476

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

5

180

0.95

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

8

186

0.93

PF13242

Hydrolase_like

HAD-hyrolase-like

140

217

0.9

PF12710

HAD

haloacid dehalogenase-like hydrolase

8

176

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s6j-assembly3.cif.gz_D the crystal structure of a hydrolase from pseudomonas syringae 0.9544 13 227
3s6j-assembly1.cif.gz_A the crystal structure of a hydrolase from pseudomonas syringae 0.9522 12 225
3s6j-assembly3.cif.gz_C the crystal structure of a hydrolase from pseudomonas syringae 0.9463 15 227
3s6j-assembly3.cif.gz_D the crystal structure of a hydrolase from pseudomonas syringae 0.9458 13 227
3s6j-assembly2.cif.gz_B the crystal structure of a hydrolase from pseudomonas syringae 0.9434 13 227
ID Description Score Start End Superfamily
3s6jB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9257 13 227 3.40.50.1000
af_Q652P6_229_339_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9178 112 215 3.40.50.1000
3s6jB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9138 13 227 3.40.50.1000
3kbbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9071 98 225 3.40.50.1000
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9049 102 209 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A0J1BXU9-F1-model_v4 HAD family hydrolase 0.9968 18 233 GO:0005829
GO:0006281
GO:0008967
AF-A0A1H5PSN1-F1-model_v4 Haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED/haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E 0.9866 12 228 GO:0005829
GO:0006281
GO:0008967
AF-A0A124I0W5-F1-model_v4 HAD family hydrolase 0.9865 12 229 GO:0005829
GO:0006281
GO:0008967
AF-A0A3R9UDY3-F1-model_v4 HAD family hydrolase 0.9863 12 228 GO:0005829
GO:0006281
GO:0008967
AF-A0A1Q5KSS7-F1-model_v4 HAD family hydrolase 0.9856 12 228 GO:0005829
GO:0006281
GO:0008967

Map