F448697
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 461 | 259 | 446 | 342 |
Family's Representative Sequence
| Representative Sequence | 3300005614|Ga0068856_100024839|Ga0068856_1000248393 |
| Length | 345 |
| Sequence | MHMNRKRFLSSFLAPLAIAPVKGLRVFADGHEDDSLAAIRPRYLKPGDTIGITCPAGSITQQEIQPAMLQMIEWGFNIKVGDTVGKKDFTFGGTDEERARDFQQMIDDPKVKAIMCARGGYGFVRIIDKINFTKLVAKPKWIIGFSDITVLHCHLNRNYGMATIHSKMCNSFPDDWNKAEPIQIETILSIKQALIGAEKMKYSAPVNPLNKHGKAEGALVGGNLKTIETLAGTKSDIRTDNKILFVEDTGEYLYSIDRMFWNLKRTGKLEKLAALIVGGFKIKPDDPGEEFGRTVEEIVLEKVKNYHYPVCFDFPVGHQRNNYALKCGLNHKLTVGEDGVILKEV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 4 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 5 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 6 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 7 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 8 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 9 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 10 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 11 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 12 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 13 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 14 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 15 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 16 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 17 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 18 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 21 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 22 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 23 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 24 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 157 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 158 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 159 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 160 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 161 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 162 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 163 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 166 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 167 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 168 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 169 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 170 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 171 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 172 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 173 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 174 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 175 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 176 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 177 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 178 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 179 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 180 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 181 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 182 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 185 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 186 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 187 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 188 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 189 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 190 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 206 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 207 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 208 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 209 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 210 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 211 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 225 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 226 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 227 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 228 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 229 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 230 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 231 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 232 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 233 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 234 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 235 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 236 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 237 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 240 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 241 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 245 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 246 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 250 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 251 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 252 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 253 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 254 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 255 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 256 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 257 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 258 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.96 |
| Metatranscriptomes | 0 |
| Isolates | 3.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.42 |
| Nodule | 0 |
| Rhizoplane | 0.65 |
| Rhizosphere | 88.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2932149 | 2162886007 | Bacteria | 10985 |
| 2 | JGI25152J39213_1000111 | 3300002773 | Bacteria | 57579 |
| 3 | JGI25150J39212_1000009 | 3300002774 | Bacteria | 249509 |
| 4 | JGI25151J46595_10000017 | 3300003187 | Bacteria | 249509 |
| 5 | JGI25153J46596_10000023 | 3300003215 | Bacteria | 249509 |
| 6 | rootH1_10043460 | 3300003316 | Bacteria | 9314 |
| 7 | rootH2_10001202 | 3300003320 | Bacteria | 51390 |
| 8 | rootH2_10037451 | 3300003320 | Bacteria | 28858 |
| 9 | rootH2_10253432 | 3300003320 | Bacteria | 2827 |
| 10 | rootL2_10008147 | 3300003322 | Bacteria | 3398 |
| 11 | rootL2_10024437 | 3300003322 | Bacteria | 3630 |
| 12 | rootL2_10209965 | 3300003322 | Unclassified | 2828 |
| 13 | rootH1_10023435 | 3300003323 | Bacteria | 23065 |
| 14 | Ga0055536_1000003 | 3300003781 | Bacteria | 447744 |
| 15 | Ga0055530_10005502 | 3300003791 | Bacteria | 5994 |
| 16 | Ga0065714_10002765 | 3300005288 | Bacteria | 65513 |
| 17 | Ga0065714_10012852 | 3300005288 | Bacteria | 1752 |
| 18 | Ga0065704_10000288 | 3300005289 | Bacteria | 77379 |
| 19 | Ga0065704_10071650 | 3300005289 | Bacteria | 10385 |
| 20 | Ga0065712_10011070 | 3300005290 | Bacteria | 2638 |
| 21 | Ga0065712_10069521 | 3300005290 | Bacteria | 7132 |
| 22 | Ga0065715_10102809 | 3300005293 | Bacteria | 3083 |
| 23 | Ga0065707_10026134 | 3300005295 | Unclassified | 1180 |
| 24 | Ga0070658_10005285 | 3300005327 | Bacteria | 10487 |
| 25 | Ga0070676_10048328 | 3300005328 | Unclassified | 2487 |
| 26 | Ga0070683_100002310 | 3300005329 | Bacteria | 15119 |
| 27 | Ga0070683_100002782 | 3300005329 | Bacteria | 13982 |
| 28 | Ga0070670_100047428 | 3300005331 | Bacteria | 3697 |
| 29 | Ga0070670_100050817 | 3300005331 | Unclassified | 3562 |
| 30 | Ga0070670_100107630 | 3300005331 | Bacteria | 2402 |
| 31 | Ga0070677_10072266 | 3300005333 | Bacteria | 1454 |
| 32 | Ga0068869_100003774 | 3300005334 | Bacteria | 9330 |
| 33 | Ga0070666_10079539 | 3300005335 | Bacteria | 2239 |
| 34 | Ga0070666_10144205 | 3300005335 | Bacteria | 1659 |
| 35 | Ga0070666_10206089 | 3300005335 | Bacteria | 1384 |
| 36 | Ga0070682_100000005 | 3300005337 | Bacteria | 386439 |
| 37 | Ga0070682_100060512 | 3300005337 | Bacteria | 2395 |
| 38 | Ga0068868_100026419 | 3300005338 | Bacteria | 4424 |
| 39 | Ga0068868_100284621 | 3300005338 | Bacteria | 1400 |
| 40 | Ga0068868_100465104 | 3300005338 | Unclassified | 1102 |
| 41 | Ga0070660_100001218 | 3300005339 | Bacteria | 17473 |
| 42 | Ga0070660_100141677 | 3300005339 | Bacteria | 1929 |
| 43 | Ga0070689_100016954 | 3300005340 | Bacteria | 5341 |
| 44 | Ga0070661_100052921 | 3300005344 | Bacteria | 2971 |
| 45 | Ga0070669_100025766 | 3300005353 | Bacteria | 4225 |
| 46 | Ga0070675_100074762 | 3300005354 | Bacteria | 2815 |
| 47 | Ga0070675_100095353 | 3300005354 | Bacteria | 2498 |
| 48 | Ga0070675_100257361 | 3300005354 | Bacteria | 1529 |
| 49 | Ga0070671_100186222 | 3300005355 | Bacteria | 1759 |
| 50 | Ga0070674_100108089 | 3300005356 | Bacteria | 2038 |
| 51 | Ga0070673_100038472 | 3300005364 | Bacteria | 3653 |
| 52 | Ga0070673_100256410 | 3300005364 | Bacteria | 1526 |
| 53 | Ga0070688_100127284 | 3300005365 | Unclassified | 1714 |
| 54 | Ga0070659_100001755 | 3300005366 | Bacteria | 15575 |
| 55 | Ga0070659_100036370 | 3300005366 | Bacteria | 3839 |
| 56 | Ga0070667_100133605 | 3300005367 | Bacteria | 2168 |
| 57 | Ga0070667_100146045 | 3300005367 | Bacteria | 2074 |
| 58 | Ga0070701_10049685 | 3300005438 | Bacteria | 2169 |
| 59 | Ga0070678_100012996 | 3300005456 | Bacteria | 5200 |
| 60 | Ga0070662_100047997 | 3300005457 | Bacteria | 3074 |
| 61 | Ga0068867_100096403 | 3300005459 | Unclassified | 2252 |
| 62 | Ga0070698_100001279 | 3300005471 | Bacteria | 28081 |
| 63 | Ga0070698_100002592 | 3300005471 | Bacteria | 19910 |
| 64 | Ga0070684_100014118 | 3300005535 | Bacteria | 6459 |
| 65 | Ga0070684_100018210 | 3300005535 | Bacteria | 5782 |
| 66 | Ga0068853_100001810 | 3300005539 | Bacteria | 15718 |
| 67 | Ga0068853_100078283 | 3300005539 | Unclassified | 2889 |
| 68 | Ga0068853_100156744 | 3300005539 | Bacteria | 2052 |
| 69 | Ga0068853_100179005 | 3300005539 | Unclassified | 1922 |
| 70 | Ga0070672_100039139 | 3300005543 | Unclassified | 3630 |
| 71 | Ga0070672_100169287 | 3300005543 | Bacteria | 1816 |
| 72 | Ga0070686_100038249 | 3300005544 | Bacteria | 2981 |
| 73 | Ga0070686_100295105 | 3300005544 | Bacteria | 1200 |
| 74 | Ga0068855_100001432 | 3300005563 | Bacteria | 29672 |
| 75 | Ga0068855_100040018 | 3300005563 | Bacteria | 5564 |
| 76 | Ga0068857_100003231 | 3300005577 | Bacteria | 13531 |
| 77 | Ga0068857_100031441 | 3300005577 | Bacteria | 4691 |
| 78 | Ga0068857_100323658 | 3300005577 | Bacteria | 1424 |
| 79 | Ga0068854_100003818 | 3300005578 | Bacteria | 9429 |
| 80 | Ga0068854_100093646 | 3300005578 | Bacteria | 2240 |
| 81 | Ga0068856_100024839 | 3300005614 | Bacteria | 5837 |
| 82 | Ga0068852_100000424 | 3300005616 | Bacteria | 28108 |
| 83 | Ga0068852_100138386 | 3300005616 | Bacteria | 2250 |
| 84 | Ga0068859_100034496 | 3300005617 | Bacteria | 5078 |
| 85 | Ga0068859_100436054 | 3300005617 | Unclassified | 1406 |
| 86 | Ga0068864_100100086 | 3300005618 | Bacteria | 2569 |
| 87 | Ga0068864_100136915 | 3300005618 | Bacteria | 2206 |
| 88 | Ga0068861_100024539 | 3300005719 | Bacteria | 4361 |
| 89 | Ga0068870_10005475 | 3300005840 | Bacteria | 5549 |
| 90 | Ga0068858_100173690 | 3300005842 | Bacteria | 2033 |
| 91 | Ga0068860_100000252 | 3300005843 | Bacteria | 79891 |
| 92 | Ga0068860_100003398 | 3300005843 | Bacteria | 16371 |
| 93 | Ga0068860_100023111 | 3300005843 | Bacteria | 6012 |
| 94 | Ga0081540_1008958 | 3300005983 | Bacteria | 6928 |
| 95 | Ga0097621_100002450 | 3300006237 | Bacteria | 12708 |
| 96 | Ga0097621_100004097 | 3300006237 | Bacteria | 10111 |
| 97 | Ga0097621_100081296 | 3300006237 | Bacteria | 2696 |
| 98 | Ga0097621_100121208 | 3300006237 | Bacteria | 2218 |
| 99 | Ga0068871_100001412 | 3300006358 | Bacteria | 16072 |
| 100 | Ga0068871_100013603 | 3300006358 | Bacteria | 6043 |
| 101 | Ga0068871_100027554 | 3300006358 | Unclassified | 4446 |
| 102 | Ga0068871_100197388 | 3300006358 | Bacteria | 1736 |
| 103 | Ga0075428_100038235 | 3300006844 | Bacteria | 5280 |
| 104 | Ga0075431_100039382 | 3300006847 | Bacteria | 4868 |
| 105 | Ga0097620_100034496 | 3300006931 | Bacteria | 5078 |
| 106 | Ga0097620_100436033 | 3300006931 | Unclassified | 1406 |
| 107 | Ga0105240_10000431 | 3300009093 | Bacteria | 77497 |
| 108 | Ga0105240_10001434 | 3300009093 | Bacteria | 40792 |
| 109 | Ga0105240_10003449 | 3300009093 | Bacteria | 24537 |
| 110 | Ga0105240_10003572 | 3300009093 | Bacteria | 24125 |
| 111 | Ga0105240_10003829 | 3300009093 | Bacteria | 23261 |
| 112 | Ga0105240_10004355 | 3300009093 | Bacteria | 21610 |
| 113 | Ga0105240_10006516 | 3300009093 | Bacteria | 17139 |
| 114 | Ga0105240_10020767 | 3300009093 | Bacteria | 8749 |
| 115 | Ga0105240_10024925 | 3300009093 | Bacteria | 7874 |
| 116 | Ga0105240_10242760 | 3300009093 | Bacteria | 2087 |
| 117 | Ga0105240_10257180 | 3300009093 | Bacteria | 2016 |
| 118 | Ga0111539_10002057 | 3300009094 | Bacteria | 26904 |
| 119 | Ga0111539_10009272 | 3300009094 | Bacteria | 12434 |
| 120 | Ga0105245_10452338 | 3300009098 | Bacteria | 1293 |
| 121 | Ga0114129_10002037 | 3300009147 | Bacteria | 27713 |
| 122 | Ga0114129_10333505 | 3300009147 | Unclassified | 2013 |
| 123 | Ga0105241_10002146 | 3300009174 | Bacteria | 14869 |
| 124 | Ga0105242_10029348 | 3300009176 | Bacteria | 4386 |
| 125 | Ga0105242_10224019 | 3300009176 | Unclassified | 1682 |
| 126 | Ga0105242_10318496 | 3300009176 | Bacteria | 1426 |
| 127 | Ga0105237_10002049 | 3300009545 | Bacteria | 25638 |
| 128 | Ga0105237_10009667 | 3300009545 | Bacteria | 10322 |
| 129 | Ga0105237_10014339 | 3300009545 | Bacteria | 8296 |
| 130 | Ga0105237_10024976 | 3300009545 | Bacteria | 6113 |
| 131 | Ga0105237_10040303 | 3300009545 | Bacteria | 4711 |
| 132 | Ga0105237_10043497 | 3300009545 | Bacteria | 4523 |
| 133 | Ga0105237_10078911 | 3300009545 | Bacteria | 3282 |
| 134 | Ga0105238_10001088 | 3300009551 | Bacteria | 27427 |
| 135 | Ga0105238_10013492 | 3300009551 | Bacteria | 8249 |
| 136 | Ga0105238_10331505 | 3300009551 | Bacteria | 1509 |
| 137 | Ga0105249_10002214 | 3300009553 | Bacteria | 16849 |
| 138 | Ga0105249_10007217 | 3300009553 | Bacteria | 9695 |
| 139 | Ga0105249_10050324 | 3300009553 | Bacteria | 3798 |
| 140 | Ga0105239_10001881 | 3300010375 | Bacteria | 27435 |
| 141 | Ga0105239_10002232 | 3300010375 | Bacteria | 24792 |
| 142 | Ga0105239_10002512 | 3300010375 | Bacteria | 23336 |
| 143 | Ga0105239_10012133 | 3300010375 | Bacteria | 9608 |
| 144 | Ga0105239_10012220 | 3300010375 | Bacteria | 9571 |
| 145 | Ga0105239_10024455 | 3300010375 | Bacteria | 6655 |
| 146 | Ga0105239_10148225 | 3300010375 | Bacteria | 2618 |
| 147 | Ga0105246_10037839 | 3300011119 | Bacteria | 3240 |
| 148 | Ga0157373_10000043 | 3300013100 | Bacteria | 113422 |
| 149 | Ga0157373_10025384 | 3300013100 | Bacteria | 4286 |
| 150 | Ga0157373_10256164 | 3300013100 | Bacteria | 1238 |
| 151 | Ga0157371_10002166 | 3300013102 | Bacteria | 19115 |
| 152 | Ga0157371_10002575 | 3300013102 | Bacteria | 17198 |
| 153 | Ga0157371_10006167 | 3300013102 | Bacteria | 9949 |
| 154 | Ga0157371_10064551 | 3300013102 | Bacteria | 2594 |
| 155 | Ga0157370_10002625 | 3300013104 | Bacteria | 21610 |
| 156 | Ga0157370_10002741 | 3300013104 | Bacteria | 21072 |
| 157 | Ga0157370_10006838 | 3300013104 | Bacteria | 12497 |
| 158 | Ga0157370_10024877 | 3300013104 | Bacteria | 5928 |
| 159 | Ga0157370_10063883 | 3300013104 | Bacteria | 3486 |
| 160 | Ga0157370_10104367 | 3300013104 | Bacteria | 2653 |
| 161 | Ga0157370_10117732 | 3300013104 | Bacteria | 2482 |
| 162 | Ga0157370_10189139 | 3300013104 | Bacteria | 1911 |
| 163 | Ga0157370_10192217 | 3300013104 | Bacteria | 1895 |
| 164 | Ga0157369_10017716 | 3300013105 | Bacteria | 7999 |
| 165 | Ga0157369_10063484 | 3300013105 | Bacteria | 3979 |
| 166 | Ga0157369_10306246 | 3300013105 | Bacteria | 1652 |
| 167 | Ga0157374_10000025 | 3300013296 | Bacteria | 245131 |
| 168 | Ga0157374_10025814 | 3300013296 | Bacteria | 5281 |
| 169 | Ga0157374_10051285 | 3300013296 | Bacteria | 3839 |
| 170 | Ga0157374_10122966 | 3300013296 | Bacteria | 2506 |
| 171 | Ga0157374_10232423 | 3300013296 | Bacteria | 1811 |
| 172 | Ga0157378_10019172 | 3300013297 | Bacteria | 6012 |
| 173 | Ga0157378_10051569 | 3300013297 | Bacteria | 3661 |
| 174 | Ga0157378_10140148 | 3300013297 | Bacteria | 2245 |
| 175 | Ga0157378_10462901 | 3300013297 | Bacteria | 1260 |
| 176 | Ga0163162_10000124 | 3300013306 | Bacteria | 68603 |
| 177 | Ga0163162_10000410 | 3300013306 | Bacteria | 39376 |
| 178 | Ga0163162_10000994 | 3300013306 | Bacteria | 26396 |
| 179 | Ga0163162_10002190 | 3300013306 | Bacteria | 18338 |
| 180 | Ga0163162_10016117 | 3300013306 | Bacteria | 7306 |
| 181 | Ga0163162_10033988 | 3300013306 | Bacteria | 5071 |
| 182 | Ga0163162_10133741 | 3300013306 | Bacteria | 2590 |
| 183 | Ga0157372_10000294 | 3300013307 | Bacteria | 55599 |
| 184 | Ga0157372_10002269 | 3300013307 | Bacteria | 20833 |
| 185 | Ga0157372_10474616 | 3300013307 | Unclassified | 1458 |
| 186 | Ga0157375_10017191 | 3300013308 | Bacteria | 6520 |
| 187 | Ga0157375_10027858 | 3300013308 | Bacteria | 5286 |
| 188 | Ga0163163_10059845 | 3300014325 | Bacteria | 3769 |
| 189 | Ga0163163_10168596 | 3300014325 | Unclassified | 2236 |
| 190 | Ga0163163_10324883 | 3300014325 | Bacteria | 1592 |
| 191 | Ga0157380_10009117 | 3300014326 | Bacteria | 7094 |
| 192 | Ga0157380_10014693 | 3300014326 | Bacteria | 5733 |
| 193 | Ga0157380_10142902 | 3300014326 | Bacteria | 2058 |
| 194 | Ga0157380_10295421 | 3300014326 | Bacteria | 1489 |
| 195 | Ga0182008_10000975 | 3300014497 | Bacteria | 19863 |
| 196 | Ga0157377_10001182 | 3300014745 | Bacteria | 11091 |
| 197 | Ga0157377_10106384 | 3300014745 | Bacteria | 1680 |
| 198 | Ga0157379_10014882 | 3300014968 | Bacteria | 6825 |
| 199 | Ga0157379_10019062 | 3300014968 | Bacteria | 6058 |
| 200 | Ga0157376_10000404 | 3300014969 | Bacteria | 28086 |
| 201 | Ga0157376_10016798 | 3300014969 | Bacteria | 5566 |
| 202 | Ga0157376_10078856 | 3300014969 | Bacteria | 2822 |
| 203 | Ga0157376_10281280 | 3300014969 | Bacteria | 1567 |
| 204 | Ga0182006_1000244 | 3300015261 | Bacteria | 50752 |
| 205 | Ga0182006_1000646 | 3300015261 | Bacteria | 24714 |
| 206 | Ga0182006_1005799 | 3300015261 | Bacteria | 5820 |
| 207 | Ga0182006_1007537 | 3300015261 | Bacteria | 4975 |
| 208 | Ga0183373_1010 | 3300015682 | Bacteria | 196982 |
| 209 | Ga0163161_10000468 | 3300017792 | Bacteria | 33545 |
| 210 | Ga0163161_10001705 | 3300017792 | Bacteria | 16126 |
| 211 | Ga0163161_10005954 | 3300017792 | Bacteria | 8455 |
| 212 | Ga0163161_10008720 | 3300017792 | Bacteria | 7013 |
| 213 | Ga0163161_10021017 | 3300017792 | Bacteria | 4587 |
| 214 | Ga0207425_1000007 | 3300025245 | Bacteria | 777411 |
| 215 | Ga0209129_1000006 | 3300025258 | Bacteria | 777761 |
| 216 | Ga0209676_1000001 | 3300025292 | Bacteria | 1852142 |
| 217 | Ga0209025_1000025 | 3300025294 | Bacteria | 524454 |
| 218 | Ga0209758_1000016 | 3300025297 | Bacteria | 778557 |
| 219 | Ga0209050_1000016 | 3300025298 | Bacteria | 729149 |
| 220 | Ga0207682_10072225 | 3300025893 | Bacteria | 1464 |
| 221 | Ga0207688_10003403 | 3300025901 | Bacteria | 8675 |
| 222 | Ga0207680_10080217 | 3300025903 | Bacteria | 2049 |
| 223 | Ga0207680_10134619 | 3300025903 | Bacteria | 1632 |
| 224 | Ga0207647_10000017 | 3300025904 | Bacteria | 129999 |
| 225 | Ga0207647_10078666 | 3300025904 | Bacteria | 1980 |
| 226 | Ga0207645_10001413 | 3300025907 | Bacteria | 19673 |
| 227 | Ga0207643_10003479 | 3300025908 | Bacteria | 8476 |
| 228 | Ga0207643_10005893 | 3300025908 | Bacteria | 6546 |
| 229 | Ga0207705_10028650 | 3300025909 | Bacteria | 3969 |
| 230 | Ga0207654_10040557 | 3300025911 | Bacteria | 2624 |
| 231 | Ga0207695_10000282 | 3300025913 | Bacteria | 126242 |
| 232 | Ga0207695_10001411 | 3300025913 | Bacteria | 40483 |
| 233 | Ga0207695_10001469 | 3300025913 | Bacteria | 39469 |
| 234 | Ga0207695_10003026 | 3300025913 | Bacteria | 24133 |
| 235 | Ga0207695_10012182 | 3300025913 | Bacteria | 10335 |
| 236 | Ga0207695_10051044 | 3300025913 | Bacteria | 4346 |
| 237 | Ga0207695_10054985 | 3300025913 | Bacteria | 4152 |
| 238 | Ga0207695_10070785 | 3300025913 | Unclassified | 3563 |
| 239 | Ga0207695_10091226 | 3300025913 | Bacteria | 3061 |
| 240 | Ga0207695_10262773 | 3300025913 | Bacteria | 1623 |
| 241 | Ga0207671_10004781 | 3300025914 | Bacteria | 12765 |
| 242 | Ga0207671_10017316 | 3300025914 | Bacteria | 5560 |
| 243 | Ga0207671_10039435 | 3300025914 | Bacteria | 3497 |
| 244 | Ga0207671_10065465 | 3300025914 | Bacteria | 2704 |
| 245 | Ga0207671_10070076 | 3300025914 | Bacteria | 2613 |
| 246 | Ga0207671_10200790 | 3300025914 | Bacteria | 1557 |
| 247 | Ga0207657_10054002 | 3300025919 | Bacteria | 3477 |
| 248 | Ga0207649_10153529 | 3300025920 | Bacteria | 1588 |
| 249 | Ga0207681_10139526 | 3300025923 | Unclassified | 1804 |
| 250 | Ga0207694_10015366 | 3300025924 | Bacteria | 5774 |
| 251 | Ga0207694_10271123 | 3300025924 | Bacteria | 1392 |
| 252 | Ga0207650_10081616 | 3300025925 | Bacteria | 2453 |
| 253 | Ga0207659_10027806 | 3300025926 | Bacteria | 3834 |
| 254 | Ga0207659_10028669 | 3300025926 | Bacteria | 3786 |
| 255 | Ga0207659_10067108 | 3300025926 | Bacteria | 2605 |
| 256 | Ga0207659_10137444 | 3300025926 | Unclassified | 1893 |
| 257 | Ga0207706_10011729 | 3300025933 | Bacteria | 7987 |
| 258 | Ga0207686_10000722 | 3300025934 | Bacteria | 20514 |
| 259 | Ga0207686_10160939 | 3300025934 | Bacteria | 1573 |
| 260 | Ga0207670_10142309 | 3300025936 | Bacteria | 1770 |
| 261 | Ga0207691_10010578 | 3300025940 | Bacteria | 8849 |
| 262 | Ga0207691_10017968 | 3300025940 | Bacteria | 6698 |
| 263 | Ga0207691_10018396 | 3300025940 | Bacteria | 6621 |
| 264 | Ga0207691_10198620 | 3300025940 | Bacteria | 1746 |
| 265 | Ga0207711_10046034 | 3300025941 | Bacteria | 3727 |
| 266 | Ga0207689_10004939 | 3300025942 | Bacteria | 12012 |
| 267 | Ga0207689_10180435 | 3300025942 | Bacteria | 1741 |
| 268 | Ga0207661_10002021 | 3300025944 | Bacteria | 13987 |
| 269 | Ga0207661_10109042 | 3300025944 | Bacteria | 2338 |
| 270 | Ga0207667_10000403 | 3300025949 | Bacteria | 58481 |
| 271 | Ga0207667_10001258 | 3300025949 | Bacteria | 31777 |
| 272 | Ga0207667_10022507 | 3300025949 | Bacteria | 6959 |
| 273 | Ga0207667_10125408 | 3300025949 | Bacteria | 2644 |
| 274 | Ga0207651_10015187 | 3300025960 | Bacteria | 4468 |
| 275 | Ga0207651_10136537 | 3300025960 | Bacteria | 1887 |
| 276 | Ga0207712_10029647 | 3300025961 | Bacteria | 3673 |
| 277 | Ga0207712_10279312 | 3300025961 | Bacteria | 1362 |
| 278 | Ga0207668_10243040 | 3300025972 | Unclassified | 1458 |
| 279 | Ga0207640_10066873 | 3300025981 | Bacteria | 2403 |
| 280 | Ga0207658_10040812 | 3300025986 | Bacteria | 3357 |
| 281 | Ga0207658_10129946 | 3300025986 | Bacteria | 2022 |
| 282 | Ga0207658_10189548 | 3300025986 | Bacteria | 1708 |
| 283 | Ga0207677_10319038 | 3300026023 | Bacteria | 1290 |
| 284 | Ga0207703_10142123 | 3300026035 | Bacteria | 2084 |
| 285 | Ga0207639_10018474 | 3300026041 | Bacteria | 4955 |
| 286 | Ga0207639_10051504 | 3300026041 | Unclassified | 3132 |
| 287 | Ga0207639_10411400 | 3300026041 | Unclassified | 1221 |
| 288 | Ga0207702_10211699 | 3300026078 | Bacteria | 1802 |
| 289 | Ga0207641_10000783 | 3300026088 | Bacteria | 33947 |
| 290 | Ga0207648_10026399 | 3300026089 | Bacteria | 5161 |
| 291 | Ga0207648_10051653 | 3300026089 | Bacteria | 3593 |
| 292 | Ga0207676_10108651 | 3300026095 | Bacteria | 2316 |
| 293 | Ga0207674_10000600 | 3300026116 | Bacteria | 47324 |
| 294 | Ga0207674_10059731 | 3300026116 | Bacteria | 3857 |
| 295 | Ga0207674_10106446 | 3300026116 | Bacteria | 2782 |
| 296 | Ga0207675_100005681 | 3300026118 | Bacteria | 11937 |
| 297 | Ga0207675_100039287 | 3300026118 | Bacteria | 4417 |
| 298 | Ga0207683_10015154 | 3300026121 | Bacteria | 6560 |
| 299 | Ga0207683_10128353 | 3300026121 | Bacteria | 2280 |
| 300 | Ga0207698_10003680 | 3300026142 | Bacteria | 9265 |
| 301 | Ga0207698_10011350 | 3300026142 | Bacteria | 5771 |
| 302 | Ga0207698_10014452 | 3300026142 | Bacteria | 5249 |
| 303 | Ga0209974_10051586 | 3300027876 | Bacteria | 1384 |
| 304 | Ga0268266_10101682 | 3300028379 | Bacteria | 2534 |
| 305 | Ga0268265_10190663 | 3300028380 | Bacteria | 1770 |
| 306 | Ga0268264_10000015 | 3300028381 | Bacteria | 508501 |
| 307 | Ga0268264_10000019 | 3300028381 | Bacteria | 488112 |
| 308 | Ga0268264_10000054 | 3300028381 | Bacteria | 317048 |
| 309 | Ga0268264_10002332 | 3300028381 | Bacteria | 16777 |
| 310 | Ga0268264_10028905 | 3300028381 | Bacteria | 4538 |
| 311 | Ga0307517_10001171 | 3300028786 | Bacteria | 44114 |
| 312 | Ga0307517_10144687 | 3300028786 | Bacteria | 1654 |
| 313 | Ga0307513_10138558 | 3300031456 | Bacteria | 2364 |
| 314 | Ga0307509_10104247 | 3300031507 | Bacteria | 2862 |
| 315 | Ga0307509_10155272 | 3300031507 | Bacteria | 2196 |
| 316 | Ga0307508_10000162 | 3300031616 | Bacteria | 80675 |
| 317 | Ga0307516_10054170 | 3300031730 | Bacteria | 3921 |
| 318 | Ga0307406_10287470 | 3300031901 | Bacteria | 1257 |
| 319 | Ga0307407_10000009 | 3300031903 | Bacteria | 188746 |
| 320 | Ga0307412_10000075 | 3300031911 | Bacteria | 97612 |
| 321 | Ga0307416_100000019 | 3300032002 | Bacteria | 199706 |
| 322 | Ga0307414_10001789 | 3300032004 | Bacteria | 11123 |
| 323 | Ga0307414_10136337 | 3300032004 | Bacteria | 1914 |
| 324 | Ga0307510_10010057 | 3300033180 | Bacteria | 11243 |
| 325 | Ga0373936_0047719 | 3300035113 | Bacteria | 1728 |
| 326 | Ga0373935_0280077 | 3300035692 | Bacteria | 1174 |
| 327 | Ga0395899_0025319 | 3300037312 | Bacteria | 4478 |
| 328 | Ga0395900_0042519 | 3300037418 | Bacteria | 4682 |
| 329 | Ga0395898_0029694 | 3300037466 | Bacteria | 5472 |
| 330 | Ga0395905_0007445 | 3300037471 | Bacteria | 10889 |
| 331 | Ga0395901_0064301 | 3300038443 | Bacteria | 3818 |
| 332 | Ga0439436_0005395 | 3300041404 | Bacteria | 3915 |
| 333 | Ga0451800_1238597 | 3300041459 | Bacteria | 1091 |
| 334 | Ga0439442_003910 | 3300042002 | Bacteria | 2954 |
| 335 | Ga0439449_0008697 | 3300042007 | Bacteria | 3854 |
| 336 | Ga0439462_0005705 | 3300042015 | Bacteria | 3076 |
| 337 | Ga0439434_0021436 | 3300042435 | Bacteria | 1941 |
| 338 | Ga0466969_0000987 | 3300044656 | Bacteria | 15353 |
| 339 | Ga0466972_0000032 | 3300044658 | Bacteria | 159445 |
| 340 | Ga0466972_0000099 | 3300044658 | Bacteria | 76709 |
| 341 | Ga0466972_0077574 | 3300044658 | Bacteria | 1582 |
| 342 | Ga0453683_0073194 | 3300044673 | Bacteria | 2145 |
| 343 | Ga0466966_0000054 | 3300044684 | Bacteria | 82352 |
| 344 | Ga0466961_0115507 | 3300044693 | Unclassified | 1687 |
| 345 | Ga0453684_0072272 | 3300044712 | Bacteria | 4356 |
| 346 | Ga0466970_0034646 | 3300044765 | Bacteria | 2673 |
| 347 | Ga0466957_0000656 | 3300044842 | Bacteria | 17549 |
| 348 | Ga0466960_0070345 | 3300044901 | Bacteria | 1741 |
| 349 | Ga0466959_0000012 | 3300045049 | Bacteria | 168961 |
| 350 | Ga0466959_0000436 | 3300045049 | Bacteria | 24268 |
| 351 | Ga0495638_0044975 | 3300046460 | Bacteria | 2780 |
| 352 | Ga0495606_0003604 | 3300046507 | Bacteria | 16293 |
| 353 | Ga0495610_0012275 | 3300046512 | Bacteria | 5170 |
| 354 | Ga0495630_0053250 | 3300046517 | Bacteria | 3030 |
| 355 | Ga0495630_0073510 | 3300046517 | Bacteria | 2575 |
| 356 | Ga0495648_0001051 | 3300046524 | Bacteria | 28002 |
| 357 | Ga0495621_0014082 | 3300046539 | Bacteria | 2525 |
| 358 | Ga0495668_0003162 | 3300046616 | Bacteria | 12690 |
| 359 | Ga0495634_0041202 | 3300046642 | Bacteria | 3137 |
| 360 | Ga0495611_0002528 | 3300046648 | Bacteria | 8319 |
| 361 | Ga0495625_0089322 | 3300046660 | Bacteria | 2133 |
| 362 | Ga0495658_0005149 | 3300046683 | Bacteria | 6428 |
| 363 | Ga0495670_0025666 | 3300046691 | Bacteria | 2915 |
| 364 | Ga0495649_0058986 | 3300046694 | Bacteria | 2067 |
| 365 | Ga0495672_0022983 | 3300047320 | Unclassified | 4044 |
| 366 | Ga0495672_0026218 | 3300047320 | Bacteria | 3721 |
| 367 | Ga0495676_0100694 | 3300047321 | Bacteria | 2139 |
| 368 | Ga0496104_0343300 | 3300048907 | Bacteria | 1406 |
| 369 | Ga0496115_0064676 | 3300048918 | Bacteria | 2953 |
| 370 | Ga0496122_0000765 | 3300048925 | Bacteria | 62189 |
| 371 | Ga0496123_0005845 | 3300048926 | Bacteria | 12189 |
| 372 | Ga0501290_001589 | 3300049513 | Bacteria | 3062 |
| 373 | Ga0501297_000579 | 3300049520 | Bacteria | 3311 |
| 374 | Ga0501032_0036133 | 3300049569 | Bacteria | 3374 |
| 375 | Ga0501032_0042507 | 3300049569 | Bacteria | 3082 |
| 376 | Ga0501034_0011765 | 3300049571 | Bacteria | 9055 |
| 377 | Ga0501034_0020155 | 3300049571 | Bacteria | 6807 |
| 378 | Ga0501036_0031255 | 3300049572 | Bacteria | 4499 |
| 379 | Ga0501037_0075581 | 3300049573 | Bacteria | 2446 |
| 380 | Ga0501038_0015399 | 3300049574 | Bacteria | 6952 |
| 381 | Ga0501038_0050071 | 3300049574 | Bacteria | 3611 |
| 382 | Ga0501039_0049397 | 3300049575 | Bacteria | 3252 |
| 383 | Ga0501043_0010222 | 3300049579 | Bacteria | 7355 |
| 384 | Ga0501043_0061179 | 3300049579 | Bacteria | 2957 |
| 385 | Ga0501043_0207902 | 3300049579 | Bacteria | 1517 |
| 386 | Ga0501043_0302257 | 3300049579 | Bacteria | 1222 |
| 387 | Ga0501046_0048001 | 3300049580 | Bacteria | 3382 |
| 388 | Ga0501047_0003414 | 3300049581 | Bacteria | 15035 |
| 389 | Ga0501047_0009295 | 3300049581 | Bacteria | 9283 |
| 390 | Ga0501047_0029171 | 3300049581 | Bacteria | 5321 |
| 391 | Ga0501047_0042976 | 3300049581 | Bacteria | 4366 |
| 392 | Ga0501047_0180392 | 3300049581 | Bacteria | 1978 |
| 393 | Ga0501048_0017746 | 3300049582 | Bacteria | 5237 |
| 394 | Ga0501048_0150201 | 3300049582 | Unclassified | 1648 |
| 395 | Ga0501070_0055996 | 3300049586 | Bacteria | 3269 |
| 396 | Ga0501070_0143569 | 3300049586 | Bacteria | 1970 |
| 397 | Ga0501073_0006622 | 3300049589 | Bacteria | 8625 |
| 398 | Ga0501074_0002982 | 3300049590 | Bacteria | 11896 |
| 399 | Ga0501198_002349 | 3300049649 | Bacteria | 2543 |
| 400 | Ga0501202_000356 | 3300049652 | Bacteria | 6369 |
| 401 | Ga0501206_001354 | 3300049653 | Bacteria | 3062 |
| 402 | Ga0501217_000636 | 3300049661 | Bacteria | 5919 |
| 403 | Ga0501217_007302 | 3300049661 | Bacteria | 2365 |
| 404 | Ga0501224_000608 | 3300049664 | Bacteria | 4414 |
| 405 | Ga0501235_000430 | 3300049669 | Bacteria | 8137 |
| 406 | Ga0501235_025022 | 3300049669 | Bacteria | 1335 |
| 407 | Ga0501243_000328 | 3300049675 | Bacteria | 6180 |
| 408 | Ga0501249_033255 | 3300049679 | Viruses | 1155 |
| 409 | Ga0501253_000404 | 3300049683 | Bacteria | 3637 |
| 410 | Ga0501259_000947 | 3300049688 | Bacteria | 4793 |
| 411 | Ga0501261_001046 | 3300049690 | Bacteria | 3398 |
| 412 | Ga0501225_0000892 | 3300049705 | Bacteria | 9288 |
| 413 | Ga0501225_0001221 | 3300049705 | Bacteria | 8004 |
| 414 | Ga0501234_000801 | 3300049707 | Bacteria | 4924 |
| 415 | Ga0501079_0160635 | 3300049741 | Bacteria | 1752 |
| 416 | Ga0501083_0037414 | 3300049744 | Bacteria | 3306 |
| 417 | Ga0501083_0068334 | 3300049744 | Bacteria | 2364 |
| 418 | Ga0501241_007505 | 3300049758 | Bacteria | 1996 |
| 419 | Ga0501241_008381 | 3300049758 | Bacteria | 1889 |
| 420 | Ga0501273_004573 | 3300049770 | Bacteria | 1526 |
| 421 | Ga0501035_0007679 | 3300049822 | Bacteria | 10075 |
| 422 | Ga0501035_0081840 | 3300049822 | Bacteria | 2849 |
| 423 | Ga0501044_0013869 | 3300049823 | Bacteria | 8710 |
| 424 | Ga0501044_0055923 | 3300049823 | Bacteria | 4051 |
| 425 | Ga0501044_0065602 | 3300049823 | Bacteria | 3702 |
| 426 | Ga0501045_0116003 | 3300049824 | Bacteria | 1987 |
| 427 | Ga0501284_00015 | 3300050005 | Bacteria | 104438 |
| 428 | nmdc:mga0k408_21233_c1 | 3300050493 | Bacteria | 3645 |
| 429 | nmdc:mga05p37_1846_c2 | 3300050507 | Bacteria | 21167 |
| 430 | nmdc:mga06r32_144304_c1 | 3300050510 | Bacteria | 2358 |
| 431 | nmdc:mga08y16_199945_c1 | 3300050511 | Bacteria | 2071 |
| 432 | Ga0500578_0000001 | 3300053086 | Bacteria | 317120 |
| 433 | Ga0500578_0061856 | 3300053086 | Bacteria | 2390 |
| 434 | Ga0500583_0000048 | 3300053092 | Bacteria | 78503 |
| 435 | Ga0500583_0000388 | 3300053092 | Bacteria | 14200 |
| 436 | Ga0500583_0013232 | 3300053092 | Bacteria | 3184 |
| 437 | Ga0500651_0002187 | 3300053093 | Bacteria | 10235 |
| 438 | Ga0500555_039834 | 3300053103 | Bacteria | 1311 |
| 439 | Ga0500568_0036638 | 3300053139 | Bacteria | 1995 |
| 440 | Ga0500604_0004170 | 3300053151 | Bacteria | 3851 |
| 441 | Ga0500622_0084532 | 3300053156 | Unclassified | 1584 |
| 442 | Ga0500637_0011158 | 3300053178 | Bacteria | 4633 |
| 443 | Ga0500587_008976 | 3300053739 | Bacteria | 1283 |
| 444 | Ga0501084_0034032 | 3300054114 | Bacteria | 4261 |
| 445 | Ga0501082_0046766 | 3300060353 | Bacteria | 3729 |
| 446 | Ga0501082_0241808 | 3300060353 | Bacteria | 1571 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053103 | Ga0500555_039834 | Ga0500555_039834_108_941 | 277 |
| 2 | 3300005337 | Ga0070682_100000005 | Ga0070682_10000000572 | 300 |
| 3 | 3300014326 | Ga0157380_10142902 | Ga0157380_101429023 | 300 |
| 4 | 3300047320 | Ga0495672_0026218 | Ga0495672_0026218_1734_2639 | 300 |
| 5 | 3300003322 | rootL2_10024437 | rootL2_100244372 | 309 |
| 6 | 3300013297 | Ga0157378_10051569 | Ga0157378_100515693 | 318 |
| 7 | 3300025972 | Ga0207668_10243040 | Ga0207668_102430401 | 318 |
| 8 | 3300005339 | Ga0070660_100001218 | Ga0070660_10000121815 | 319 |
| 9 | 3300025919 | Ga0207657_10054002 | Ga0207657_100540024 | 319 |
| 10 | 3300049741 | Ga0501079_0160635 | Ga0501079_0160635_12_971 | 319 |
| 11 | 3300009094 | Ga0111539_10002057 | Ga0111539_1000205716 | 321 |
| 12 | 3300014745 | Ga0157377_10106384 | Ga0157377_101063842 | 321 |
| 13 | 3300026118 | Ga0207675_100039287 | Ga0207675_1000392873 | 321 |
| 14 | 3300025903 | Ga0207680_10080217 | Ga0207680_100802171 | 322 |
| 15 | 3300031901 | Ga0307406_10287470 | Ga0307406_102874701 | 324 |
| 16 | 3300046517 | Ga0495630_0053250 | Ga0495630_0053250_585_1619 | 325 |
| 17 | 3300046642 | Ga0495634_0041202 | Ga0495634_0041202_123_1157 | 325 |
| 18 | 3300046683 | Ga0495658_0005149 | Ga0495658_0005149_4680_5714 | 325 |
| 19 | 3300046694 | Ga0495649_0058986 | Ga0495649_0058986_233_1303 | 325 |
| 20 | 3300047321 | Ga0495676_0100694 | Ga0495676_0100694_56_1090 | 325 |
| 21 | 3300049679 | Ga0501249_033255 | Ga0501249_033255_128_1108 | 325 |
| 22 | iso_pu_bacteria | 2738541278 | 2738728862 | 326 |
| 23 | 3300031730 | Ga0307516_10054170 | Ga0307516_100541703 | 328 |
| 24 | 3300003322 | rootL2_10209965 | rootL2_102099652 | 329 |
| 25 | 3300049569 | Ga0501032_0036133 | Ga0501032_0036133_349_1356 | 329 |
| 26 | 3300049571 | Ga0501034_0011765 | Ga0501034_0011765_60_1067 | 329 |
| 27 | 3300049573 | Ga0501037_0075581 | Ga0501037_0075581_688_1695 | 329 |
| 28 | 3300049574 | Ga0501038_0015399 | Ga0501038_0015399_1764_2771 | 329 |
| 29 | 3300049581 | Ga0501047_0003414 | Ga0501047_0003414_2955_3962 | 329 |
| 30 | 3300049822 | Ga0501035_0081840 | Ga0501035_0081840_601_1608 | 329 |
| 31 | 3300049823 | Ga0501044_0065602 | Ga0501044_0065602_2210_3217 | 329 |
| 32 | 3300005356 | Ga0070674_100108089 | Ga0070674_1001080892 | 330 |
| 33 | 3300044693 | Ga0466961_0115507 | Ga0466961_0115507_604_1662 | 330 |
| 34 | 3300045049 | Ga0466959_0000436 | Ga0466959_0000436_12256_13314 | 330 |
| 35 | 3300046648 | Ga0495611_0002528 | Ga0495611_0002528_3702_4760 | 330 |
| 36 | 3300005329 | Ga0070683_100002782 | Ga0070683_10000278211 | 333 |
| 37 | 3300005338 | Ga0068868_100465104 | Ga0068868_1004651041 | 333 |
| 38 | 3300005459 | Ga0068867_100096403 | Ga0068867_1000964032 | 333 |
| 39 | 3300005535 | Ga0070684_100014118 | Ga0070684_1000141185 | 333 |
| 40 | 3300005539 | Ga0068853_100001810 | Ga0068853_1000018108 | 333 |
| 41 | 3300005563 | Ga0068855_100001432 | Ga0068855_10000143221 | 333 |
| 42 | 3300005578 | Ga0068854_100093646 | Ga0068854_1000936462 | 333 |
| 43 | 3300009093 | Ga0105240_10003829 | Ga0105240_1000382917 | 333 |
| 44 | 3300009093 | Ga0105240_10006516 | Ga0105240_1000651613 | 333 |
| 45 | 3300009176 | Ga0105242_10224019 | Ga0105242_102240191 | 333 |
| 46 | 3300010375 | Ga0105239_10012133 | Ga0105239_100121335 | 333 |
| 47 | 3300010375 | Ga0105239_10024455 | Ga0105239_100244553 | 333 |
| 48 | 3300013104 | Ga0157370_10104367 | Ga0157370_101043672 | 333 |
| 49 | 3300013105 | Ga0157369_10063484 | Ga0157369_100634842 | 333 |
| 50 | 3300025913 | Ga0207695_10000282 | Ga0207695_1000028290 | 333 |
| 51 | 3300025913 | Ga0207695_10051044 | Ga0207695_100510442 | 333 |
| 52 | 3300025942 | Ga0207689_10180435 | Ga0207689_101804352 | 333 |
| 53 | 3300025944 | Ga0207661_10002021 | Ga0207661_100020213 | 333 |
| 54 | 3300025949 | Ga0207667_10001258 | Ga0207667_1000125813 | 333 |
| 55 | 3300026041 | Ga0207639_10018474 | Ga0207639_100184743 | 333 |
| 56 | 3300026089 | Ga0207648_10026399 | Ga0207648_100263993 | 333 |
| 57 | 3300049579 | Ga0501043_0061179 | Ga0501043_0061179_1849_2868 | 333 |
| 58 | 3300003320 | rootH2_10037451 | rootH2_100374516 | 334 |
| 59 | 3300005328 | Ga0070676_10048328 | Ga0070676_100483284 | 334 |
| 60 | 3300005334 | Ga0068869_100003774 | Ga0068869_1000037747 | 334 |
| 61 | 3300005338 | Ga0068868_100026419 | Ga0068868_1000264192 | 334 |
| 62 | 3300005543 | Ga0070672_100039139 | Ga0070672_1000391395 | 334 |
| 63 | 3300005617 | Ga0068859_100034496 | Ga0068859_1000344966 | 334 |
| 64 | 3300005840 | Ga0068870_10005475 | Ga0068870_100054757 | 334 |
| 65 | 3300006237 | Ga0097621_100081296 | Ga0097621_1000812963 | 334 |
| 66 | 3300006358 | Ga0068871_100027554 | Ga0068871_1000275543 | 334 |
| 67 | 3300006931 | Ga0097620_100034496 | Ga0097620_1000344966 | 334 |
| 68 | 3300009098 | Ga0105245_10452338 | Ga0105245_104523381 | 334 |
| 69 | 3300025901 | Ga0207688_10003403 | Ga0207688_100034033 | 334 |
| 70 | 3300025907 | Ga0207645_10001413 | Ga0207645_100014134 | 334 |
| 71 | 3300025908 | Ga0207643_10005893 | Ga0207643_100058937 | 334 |
| 72 | 3300025926 | Ga0207659_10067108 | Ga0207659_100671083 | 334 |
| 73 | 3300025934 | Ga0207686_10160939 | Ga0207686_101609392 | 334 |
| 74 | 3300025940 | Ga0207691_10017968 | Ga0207691_100179684 | 334 |
| 75 | 3300025942 | Ga0207689_10004939 | Ga0207689_100049392 | 334 |
| 76 | 3300025960 | Ga0207651_10136537 | Ga0207651_101365372 | 334 |
| 77 | 3300025986 | Ga0207658_10189548 | Ga0207658_101895483 | 334 |
| 78 | 3300026041 | Ga0207639_10051504 | Ga0207639_100515044 | 334 |
| 79 | 3300026089 | Ga0207648_10051653 | Ga0207648_100516533 | 334 |
| 80 | 3300028379 | Ga0268266_10101682 | Ga0268266_101016821 | 334 |
| 81 | 3300028380 | Ga0268265_10190663 | Ga0268265_101906631 | 334 |
| 82 | 3300035692 | Ga0373935_0280077 | Ga0373935_0280077_55_1098 | 334 |
| 83 | 3300049579 | Ga0501043_0302257 | Ga0501043_0302257_202_1206 | 334 |
| 84 | 3300049581 | Ga0501047_0180392 | Ga0501047_0180392_912_1916 | 334 |
| 85 | iso_pu_bacteria | 2904445276 | 2904445766 | 334 |
| 86 | 3300005293 | Ga0065715_10102809 | Ga0065715_101028091 | 335 |
| 87 | 3300006847 | Ga0075431_100039382 | Ga0075431_1000393822 | 335 |
| 88 | 3300014326 | Ga0157380_10009117 | Ga0157380_100091176 | 335 |
| 89 | 3300025926 | Ga0207659_10028669 | Ga0207659_100286694 | 335 |
| 90 | 3300025940 | Ga0207691_10010578 | Ga0207691_100105787 | 335 |
| 91 | 3300026121 | Ga0207683_10128353 | Ga0207683_101283532 | 335 |
| 92 | 3300050510 | nmdc:mga06r32_144304_c1 | nmdc:mga06r32_144304_c1_827_1837 | 335 |
| 93 | 3300053156 | Ga0500622_0084532 | Ga0500622_0084532_242_1249 | 335 |
| 94 | iso_pu_bacteria | 2852627209 | 2852631672 | 335 |
| 95 | iso_pu_bacteria | 2919186247 | 2919187016 | 335 |
| 96 | iso_pu_bacteria | 2939664404 | 2939665715 | 335 |
| 97 | 3300003322 | rootL2_10008147 | rootL2_100081474 | 336 |
| 98 | 3300014325 | Ga0163163_10059845 | Ga0163163_100598453 | 336 |
| 99 | 3300033180 | Ga0307510_10010057 | Ga0307510_100100574 | 336 |
| 100 | 3300046507 | Ga0495606_0003604 | Ga0495606_0003604_6064_7104 | 336 |
| 101 | iso_pu_bacteria | 2738541302 | 2738853903 | 336 |
| 102 | iso_pu_bacteria | 2739367651 | 2739588480 | 336 |
| 103 | iso_pu_bacteria | 2739367656 | 2739617955 | 336 |
| 104 | iso_pu_bacteria | 2739367663 | 2739645169 | 336 |
| 105 | iso_pu_bacteria | 2849281842 | 2849284369 | 336 |
| 106 | iso_pu_bacteria | 2857627736 | 2857631023 | 336 |
| 107 | 3300005335 | Ga0070666_10206089 | Ga0070666_102060892 | 337 |
| 108 | 3300005843 | Ga0068860_100003398 | Ga0068860_1000033989 | 337 |
| 109 | 3300006237 | Ga0097621_100121208 | Ga0097621_1001212082 | 337 |
| 110 | 3300006358 | Ga0068871_100197388 | Ga0068871_1001973883 | 337 |
| 111 | 3300009093 | Ga0105240_10003449 | Ga0105240_1000344910 | 337 |
| 112 | 3300009093 | Ga0105240_10003572 | Ga0105240_1000357210 | 337 |
| 113 | 3300009551 | Ga0105238_10331505 | Ga0105238_103315052 | 337 |
| 114 | 3300010375 | Ga0105239_10002232 | Ga0105239_1000223213 | 337 |
| 115 | 3300013296 | Ga0157374_10000025 | Ga0157374_1000002539 | 337 |
| 116 | 3300013306 | Ga0163162_10000124 | Ga0163162_100001242 | 337 |
| 117 | 3300014969 | Ga0157376_10016798 | Ga0157376_100167985 | 337 |
| 118 | 3300025913 | Ga0207695_10001469 | Ga0207695_1000146910 | 337 |
| 119 | 3300025913 | Ga0207695_10003026 | Ga0207695_1000302614 | 337 |
| 120 | 3300025913 | Ga0207695_10262773 | Ga0207695_102627732 | 337 |
| 121 | 3300025924 | Ga0207694_10271123 | Ga0207694_102711232 | 337 |
| 122 | 3300028381 | Ga0268264_10002332 | Ga0268264_100023326 | 337 |
| 123 | 3300031507 | Ga0307509_10104247 | Ga0307509_101042472 | 337 |
| 124 | 3300037312 | Ga0395899_0025319 | Ga0395899_0025319_149_1165 | 337 |
| 125 | 3300037418 | Ga0395900_0042519 | Ga0395900_0042519_156_1172 | 337 |
| 126 | 3300037466 | Ga0395898_0029694 | Ga0395898_0029694_149_1165 | 337 |
| 127 | 3300037471 | Ga0395905_0007445 | Ga0395905_0007445_9341_10357 | 337 |
| 128 | 3300038443 | Ga0395901_0064301 | Ga0395901_0064301_1584_2600 | 337 |
| 129 | 3300044658 | Ga0466972_0000099 | Ga0466972_0000099_6862_8004 | 337 |
| 130 | 3300044765 | Ga0466970_0034646 | Ga0466970_0034646_1498_2646 | 337 |
| 131 | 3300044901 | Ga0466960_0070345 | Ga0466960_0070345_353_1381 | 337 |
| 132 | 3300053092 | Ga0500583_0013232 | Ga0500583_0013232_896_1948 | 337 |
| 133 | 3300005290 | Ga0065712_10011070 | Ga0065712_100110703 | 338 |
| 134 | 3300005335 | Ga0070666_10144205 | Ga0070666_101442052 | 338 |
| 135 | 3300005367 | Ga0070667_100133605 | Ga0070667_1001336052 | 338 |
| 136 | 3300005471 | Ga0070698_100001279 | Ga0070698_10000127914 | 338 |
| 137 | 3300005471 | Ga0070698_100002592 | Ga0070698_10000259213 | 338 |
| 138 | 3300005618 | Ga0068864_100136915 | Ga0068864_1001369152 | 338 |
| 139 | 3300006237 | Ga0097621_100004097 | Ga0097621_1000040976 | 338 |
| 140 | 3300006844 | Ga0075428_100038235 | Ga0075428_1000382352 | 338 |
| 141 | 3300009147 | Ga0114129_10333505 | Ga0114129_103335052 | 338 |
| 142 | 3300009176 | Ga0105242_10029348 | Ga0105242_100293482 | 338 |
| 143 | 3300009176 | Ga0105242_10318496 | Ga0105242_103184962 | 338 |
| 144 | 3300011119 | Ga0105246_10037839 | Ga0105246_100378393 | 338 |
| 145 | 3300013100 | Ga0157373_10025384 | Ga0157373_100253844 | 338 |
| 146 | 3300013104 | Ga0157370_10063883 | Ga0157370_100638834 | 338 |
| 147 | 3300013306 | Ga0163162_10016117 | Ga0163162_100161176 | 338 |
| 148 | 3300013307 | Ga0157372_10474616 | Ga0157372_104746162 | 338 |
| 149 | 3300014325 | Ga0163163_10324883 | Ga0163163_103248831 | 338 |
| 150 | 3300014497 | Ga0182008_10000975 | Ga0182008_1000097517 | 338 |
| 151 | 3300015261 | Ga0182006_1000244 | Ga0182006_100024425 | 338 |
| 152 | 3300025903 | Ga0207680_10134619 | Ga0207680_101346192 | 338 |
| 153 | 3300025934 | Ga0207686_10000722 | Ga0207686_1000072213 | 338 |
| 154 | 3300025961 | Ga0207712_10279312 | Ga0207712_102793122 | 338 |
| 155 | 3300025986 | Ga0207658_10129946 | Ga0207658_101299462 | 338 |
| 156 | 3300026088 | Ga0207641_10000783 | Ga0207641_1000078315 | 338 |
| 157 | 3300026095 | Ga0207676_10108651 | Ga0207676_101086512 | 338 |
| 158 | 3300027876 | Ga0209974_10051586 | Ga0209974_100515862 | 338 |
| 159 | 3300028786 | Ga0307517_10001171 | Ga0307517_100011717 | 338 |
| 160 | 3300028786 | Ga0307517_10144687 | Ga0307517_101446872 | 338 |
| 161 | 3300044673 | Ga0453683_0073194 | Ga0453683_0073194_916_1938 | 338 |
| 162 | 3300046539 | Ga0495621_0014082 | Ga0495621_0014082_646_1668 | 338 |
| 163 | 3300047320 | Ga0495672_0022983 | Ga0495672_0022983_2577_3593 | 338 |
| 164 | 3300048918 | Ga0496115_0064676 | Ga0496115_0064676_1542_2564 | 338 |
| 165 | 3300003320 | rootH2_10001202 | rootH2_1000120224 | 339 |
| 166 | 3300005290 | Ga0065712_10069521 | Ga0065712_100695213 | 339 |
| 167 | 3300005327 | Ga0070658_10005285 | Ga0070658_100052853 | 339 |
| 168 | 3300005329 | Ga0070683_100002310 | Ga0070683_10000231013 | 339 |
| 169 | 3300005331 | Ga0070670_100050817 | Ga0070670_1000508173 | 339 |
| 170 | 3300005331 | Ga0070670_100107630 | Ga0070670_1001076302 | 339 |
| 171 | 3300005333 | Ga0070677_10072266 | Ga0070677_100722661 | 339 |
| 172 | 3300005335 | Ga0070666_10079539 | Ga0070666_100795392 | 339 |
| 173 | 3300005337 | Ga0070682_100060512 | Ga0070682_1000605123 | 339 |
| 174 | 3300005338 | Ga0068868_100284621 | Ga0068868_1002846212 | 339 |
| 175 | 3300005339 | Ga0070660_100141677 | Ga0070660_1001416772 | 339 |
| 176 | 3300005344 | Ga0070661_100052921 | Ga0070661_1000529213 | 339 |
| 177 | 3300005353 | Ga0070669_100025766 | Ga0070669_1000257662 | 339 |
| 178 | 3300005354 | Ga0070675_100074762 | Ga0070675_1000747621 | 339 |
| 179 | 3300005354 | Ga0070675_100095353 | Ga0070675_1000953533 | 339 |
| 180 | 3300005355 | Ga0070671_100186222 | Ga0070671_1001862222 | 339 |
| 181 | 3300005364 | Ga0070673_100038472 | Ga0070673_1000384721 | 339 |
| 182 | 3300005364 | Ga0070673_100256410 | Ga0070673_1002564102 | 339 |
| 183 | 3300005366 | Ga0070659_100001755 | Ga0070659_1000017558 | 339 |
| 184 | 3300005366 | Ga0070659_100036370 | Ga0070659_1000363701 | 339 |
| 185 | 3300005438 | Ga0070701_10049685 | Ga0070701_100496851 | 339 |
| 186 | 3300005535 | Ga0070684_100018210 | Ga0070684_1000182103 | 339 |
| 187 | 3300005539 | Ga0068853_100078283 | Ga0068853_1000782831 | 339 |
| 188 | 3300005539 | Ga0068853_100156744 | Ga0068853_1001567442 | 339 |
| 189 | 3300005539 | Ga0068853_100179005 | Ga0068853_1001790052 | 339 |
| 190 | 3300005543 | Ga0070672_100169287 | Ga0070672_1001692872 | 339 |
| 191 | 3300005544 | Ga0070686_100038249 | Ga0070686_1000382492 | 339 |
| 192 | 3300005577 | Ga0068857_100031441 | Ga0068857_1000314415 | 339 |
| 193 | 3300005616 | Ga0068852_100000424 | Ga0068852_1000004243 | 339 |
| 194 | 3300005616 | Ga0068852_100138386 | Ga0068852_1001383862 | 339 |
| 195 | 3300005843 | Ga0068860_100000252 | Ga0068860_10000025242 | 339 |
| 196 | 3300005843 | Ga0068860_100023111 | Ga0068860_1000231114 | 339 |
| 197 | 3300009093 | Ga0105240_10000431 | Ga0105240_1000043118 | 339 |
| 198 | 3300009093 | Ga0105240_10004355 | Ga0105240_1000435514 | 339 |
| 199 | 3300009094 | Ga0111539_10009272 | Ga0111539_100092729 | 339 |
| 200 | 3300009174 | Ga0105241_10002146 | Ga0105241_100021465 | 339 |
| 201 | 3300009545 | Ga0105237_10009667 | Ga0105237_100096673 | 339 |
| 202 | 3300009545 | Ga0105237_10040303 | Ga0105237_100403032 | 339 |
| 203 | 3300009545 | Ga0105237_10043497 | Ga0105237_100434973 | 339 |
| 204 | 3300009551 | Ga0105238_10001088 | Ga0105238_1000108812 | 339 |
| 205 | 3300010375 | Ga0105239_10002512 | Ga0105239_1000251212 | 339 |
| 206 | 3300010375 | Ga0105239_10148225 | Ga0105239_101482253 | 339 |
| 207 | 3300013100 | Ga0157373_10256164 | Ga0157373_102561641 | 339 |
| 208 | 3300013102 | Ga0157371_10002575 | Ga0157371_1000257514 | 339 |
| 209 | 3300013104 | Ga0157370_10002741 | Ga0157370_100027415 | 339 |
| 210 | 3300013105 | Ga0157369_10306246 | Ga0157369_103062462 | 339 |
| 211 | 3300013296 | Ga0157374_10025814 | Ga0157374_100258143 | 339 |
| 212 | 3300013296 | Ga0157374_10051285 | Ga0157374_100512852 | 339 |
| 213 | 3300013296 | Ga0157374_10232423 | Ga0157374_102324232 | 339 |
| 214 | 3300013297 | Ga0157378_10140148 | Ga0157378_101401482 | 339 |
| 215 | 3300013306 | Ga0163162_10000410 | Ga0163162_100004102 | 339 |
| 216 | 3300014326 | Ga0157380_10014693 | Ga0157380_100146932 | 339 |
| 217 | 3300025893 | Ga0207682_10072225 | Ga0207682_100722252 | 339 |
| 218 | 3300025904 | Ga0207647_10000017 | Ga0207647_1000001772 | 339 |
| 219 | 3300025909 | Ga0207705_10028650 | Ga0207705_100286503 | 339 |
| 220 | 3300025913 | Ga0207695_10001411 | Ga0207695_1000141113 | 339 |
| 221 | 3300025913 | Ga0207695_10012182 | Ga0207695_100121823 | 339 |
| 222 | 3300025914 | Ga0207671_10004781 | Ga0207671_100047818 | 339 |
| 223 | 3300025914 | Ga0207671_10065465 | Ga0207671_100654652 | 339 |
| 224 | 3300025914 | Ga0207671_10200790 | Ga0207671_102007902 | 339 |
| 225 | 3300025920 | Ga0207649_10153529 | Ga0207649_101535292 | 339 |
| 226 | 3300025923 | Ga0207681_10139526 | Ga0207681_101395262 | 339 |
| 227 | 3300025925 | Ga0207650_10081616 | Ga0207650_100816162 | 339 |
| 228 | 3300025926 | Ga0207659_10027806 | Ga0207659_100278062 | 339 |
| 229 | 3300025936 | Ga0207670_10142309 | Ga0207670_101423091 | 339 |
| 230 | 3300025940 | Ga0207691_10018396 | Ga0207691_100183962 | 339 |
| 231 | 3300025940 | Ga0207691_10198620 | Ga0207691_101986202 | 339 |
| 232 | 3300025944 | Ga0207661_10109042 | Ga0207661_101090422 | 339 |
| 233 | 3300026023 | Ga0207677_10319038 | Ga0207677_103190381 | 339 |
| 234 | 3300026116 | Ga0207674_10059731 | Ga0207674_100597312 | 339 |
| 235 | 3300026142 | Ga0207698_10011350 | Ga0207698_100113505 | 339 |
| 236 | 3300026142 | Ga0207698_10014452 | Ga0207698_100144522 | 339 |
| 237 | 3300028381 | Ga0268264_10000015 | Ga0268264_10000015158 | 339 |
| 238 | 3300028381 | Ga0268264_10000019 | Ga0268264_10000019256 | 339 |
| 239 | 3300028381 | Ga0268264_10000054 | Ga0268264_10000054116 | 339 |
| 240 | 3300028381 | Ga0268264_10028905 | Ga0268264_100289053 | 339 |
| 241 | 3300031616 | Ga0307508_10000162 | Ga0307508_1000016214 | 339 |
| 242 | 3300031903 | Ga0307407_10000009 | Ga0307407_1000000969 | 339 |
| 243 | 3300032002 | Ga0307416_100000019 | Ga0307416_100000019126 | 339 |
| 244 | 3300032004 | Ga0307414_10136337 | Ga0307414_101363372 | 339 |
| 245 | 3300035113 | Ga0373936_0047719 | Ga0373936_0047719_290_1348 | 339 |
| 246 | 3300044712 | Ga0453684_0072272 | Ga0453684_0072272_510_1538 | 339 |
| 247 | 3300046460 | Ga0495638_0044975 | Ga0495638_0044975_1018_2043 | 339 |
| 248 | 3300046524 | Ga0495648_0001051 | Ga0495648_0001051_11978_13003 | 339 |
| 249 | 3300046616 | Ga0495668_0003162 | Ga0495668_0003162_8108_9139 | 339 |
| 250 | 3300049513 | Ga0501290_001589 | Ga0501290_001589_928_1959 | 339 |
| 251 | 3300049520 | Ga0501297_000579 | Ga0501297_000579_670_1701 | 339 |
| 252 | 3300049579 | Ga0501043_0207902 | Ga0501043_0207902_451_1479 | 339 |
| 253 | 3300049649 | Ga0501198_002349 | Ga0501198_002349_1479_2510 | 339 |
| 254 | 3300049652 | Ga0501202_000356 | Ga0501202_000356_2307_3338 | 339 |
| 255 | 3300049653 | Ga0501206_001354 | Ga0501206_001354_1094_2125 | 339 |
| 256 | 3300049661 | Ga0501217_000636 | Ga0501217_000636_3583_4614 | 339 |
| 257 | 3300049661 | Ga0501217_007302 | Ga0501217_007302_578_1603 | 339 |
| 258 | 3300049664 | Ga0501224_000608 | Ga0501224_000608_1989_3020 | 339 |
| 259 | 3300049669 | Ga0501235_000430 | Ga0501235_000430_4333_5364 | 339 |
| 260 | 3300049675 | Ga0501243_000328 | Ga0501243_000328_4023_5054 | 339 |
| 261 | 3300049683 | Ga0501253_000404 | Ga0501253_000404_1098_2129 | 339 |
| 262 | 3300049688 | Ga0501259_000947 | Ga0501259_000947_2620_3651 | 339 |
| 263 | 3300049690 | Ga0501261_001046 | Ga0501261_001046_1080_2111 | 339 |
| 264 | 3300049705 | Ga0501225_0000892 | Ga0501225_0000892_3835_4866 | 339 |
| 265 | 3300049707 | Ga0501234_000801 | Ga0501234_000801_3113_4144 | 339 |
| 266 | 3300049770 | Ga0501273_004573 | Ga0501273_004573_241_1272 | 339 |
| 267 | 3300050511 | nmdc:mga08y16_199945_c1 | nmdc:mga08y16_199945_c1_957_1979 | 339 |
| 268 | 3300053139 | Ga0500568_0036638 | Ga0500568_0036638_904_1929 | 339 |
| 269 | 3300053151 | Ga0500604_0004170 | Ga0500604_0004170_2385_3416 | 339 |
| 270 | iso_pu_bacteria | 2738543023 | 2739305194 | 339 |
| 271 | 3300002773 | JGI25152J39213_1000111 | JGI25152J39213_100011145 | 340 |
| 272 | 3300002774 | JGI25150J39212_1000009 | JGI25150J39212_1000009147 | 340 |
| 273 | 3300003187 | JGI25151J46595_10000017 | JGI25151J46595_10000017147 | 340 |
| 274 | 3300003215 | JGI25153J46596_10000023 | JGI25153J46596_1000002392 | 340 |
| 275 | 3300003316 | rootH1_10043460 | rootH1_100434606 | 340 |
| 276 | 3300003320 | rootH2_10253432 | rootH2_102534322 | 340 |
| 277 | 3300003323 | rootH1_10023435 | rootH1_100234355 | 340 |
| 278 | 3300003781 | Ga0055536_1000003 | Ga0055536_1000003352 | 340 |
| 279 | 3300003791 | Ga0055530_10005502 | Ga0055530_100055027 | 340 |
| 280 | 3300005288 | Ga0065714_10012852 | Ga0065714_100128521 | 340 |
| 281 | 3300005295 | Ga0065707_10026134 | Ga0065707_100261341 | 340 |
| 282 | 3300005340 | Ga0070689_100016954 | Ga0070689_1000169542 | 340 |
| 283 | 3300005354 | Ga0070675_100257361 | Ga0070675_1002573611 | 340 |
| 284 | 3300005365 | Ga0070688_100127284 | Ga0070688_1001272842 | 340 |
| 285 | 3300005457 | Ga0070662_100047997 | Ga0070662_1000479972 | 340 |
| 286 | 3300005563 | Ga0068855_100040018 | Ga0068855_1000400182 | 340 |
| 287 | 3300005614 | Ga0068856_100024839 | Ga0068856_1000248393 | 340 |
| 288 | 3300005617 | Ga0068859_100436054 | Ga0068859_1004360542 | 340 |
| 289 | 3300005618 | Ga0068864_100100086 | Ga0068864_1001000863 | 340 |
| 290 | 3300005719 | Ga0068861_100024539 | Ga0068861_1000245393 | 340 |
| 291 | 3300005983 | Ga0081540_1008958 | Ga0081540_10089583 | 340 |
| 292 | 3300006931 | Ga0097620_100436033 | Ga0097620_1004360332 | 340 |
| 293 | 3300009093 | Ga0105240_10024925 | Ga0105240_100249256 | 340 |
| 294 | 3300009093 | Ga0105240_10242760 | Ga0105240_102427602 | 340 |
| 295 | 3300009147 | Ga0114129_10002037 | Ga0114129_1000203716 | 340 |
| 296 | 3300009545 | Ga0105237_10014339 | Ga0105237_100143395 | 340 |
| 297 | 3300009545 | Ga0105237_10078911 | Ga0105237_100789113 | 340 |
| 298 | 3300009553 | Ga0105249_10050324 | Ga0105249_100503242 | 340 |
| 299 | 3300010375 | Ga0105239_10001881 | Ga0105239_1000188114 | 340 |
| 300 | 3300010375 | Ga0105239_10012220 | Ga0105239_100122203 | 340 |
| 301 | 3300013104 | Ga0157370_10189139 | Ga0157370_101891392 | 340 |
| 302 | 3300013104 | Ga0157370_10192217 | Ga0157370_101922172 | 340 |
| 303 | 3300013296 | Ga0157374_10122966 | Ga0157374_101229662 | 340 |
| 304 | 3300013307 | Ga0157372_10002269 | Ga0157372_100022692 | 340 |
| 305 | 3300014326 | Ga0157380_10295421 | Ga0157380_102954212 | 340 |
| 306 | 3300014745 | Ga0157377_10001182 | Ga0157377_100011823 | 340 |
| 307 | 3300015261 | Ga0182006_1000646 | Ga0182006_10006469 | 340 |
| 308 | 3300015682 | Ga0183373_1010 | Ga0183373_101028 | 340 |
| 309 | 3300017792 | Ga0163161_10000468 | Ga0163161_1000046810 | 340 |
| 310 | 3300017792 | Ga0163161_10001705 | Ga0163161_100017056 | 340 |
| 311 | 3300025245 | Ga0207425_1000007 | Ga0207425_1000007409 | 340 |
| 312 | 3300025258 | Ga0209129_1000006 | Ga0209129_1000006409 | 340 |
| 313 | 3300025292 | Ga0209676_1000001 | Ga0209676_1000001686 | 340 |
| 314 | 3300025294 | Ga0209025_1000025 | Ga0209025_1000025239 | 340 |
| 315 | 3300025297 | Ga0209758_1000016 | Ga0209758_1000016409 | 340 |
| 316 | 3300025298 | Ga0209050_1000016 | Ga0209050_1000016351 | 340 |
| 317 | 3300025908 | Ga0207643_10003479 | Ga0207643_100034796 | 340 |
| 318 | 3300025913 | Ga0207695_10070785 | Ga0207695_100707853 | 340 |
| 319 | 3300025913 | Ga0207695_10091226 | Ga0207695_100912262 | 340 |
| 320 | 3300025914 | Ga0207671_10017316 | Ga0207671_100173164 | 340 |
| 321 | 3300025914 | Ga0207671_10070076 | Ga0207671_100700763 | 340 |
| 322 | 3300025926 | Ga0207659_10137444 | Ga0207659_101374442 | 340 |
| 323 | 3300025933 | Ga0207706_10011729 | Ga0207706_100117293 | 340 |
| 324 | 3300025949 | Ga0207667_10022507 | Ga0207667_100225075 | 340 |
| 325 | 3300025960 | Ga0207651_10015187 | Ga0207651_100151872 | 340 |
| 326 | 3300025981 | Ga0207640_10066873 | Ga0207640_100668732 | 340 |
| 327 | 3300026078 | Ga0207702_10211699 | Ga0207702_102116992 | 340 |
| 328 | 3300026118 | Ga0207675_100005681 | Ga0207675_1000056818 | 340 |
| 329 | 3300031456 | Ga0307513_10138558 | Ga0307513_101385582 | 340 |
| 330 | 3300041404 | Ga0439436_0005395 | Ga0439436_0005395_1710_2732 | 340 |
| 331 | 3300041459 | Ga0451800_1238597 | Ga0451800_1238597_48_1070 | 340 |
| 332 | 3300042002 | Ga0439442_003910 | Ga0439442_003910_733_1779 | 340 |
| 333 | 3300042007 | Ga0439449_0008697 | Ga0439449_0008697_2364_3386 | 340 |
| 334 | 3300042015 | Ga0439462_0005705 | Ga0439462_0005705_1202_2224 | 340 |
| 335 | 3300042435 | Ga0439434_0021436 | Ga0439434_0021436_859_1905 | 340 |
| 336 | 3300044658 | Ga0466972_0000032 | Ga0466972_0000032_143781_144803 | 340 |
| 337 | 3300044658 | Ga0466972_0077574 | Ga0466972_0077574_327_1349 | 340 |
| 338 | 3300046512 | Ga0495610_0012275 | Ga0495610_0012275_2733_3758 | 340 |
| 339 | 3300049569 | Ga0501032_0042507 | Ga0501032_0042507_913_1941 | 340 |
| 340 | 3300049571 | Ga0501034_0020155 | Ga0501034_0020155_218_1246 | 340 |
| 341 | 3300049572 | Ga0501036_0031255 | Ga0501036_0031255_1215_2243 | 340 |
| 342 | 3300049574 | Ga0501038_0050071 | Ga0501038_0050071_1777_2805 | 340 |
| 343 | 3300049575 | Ga0501039_0049397 | Ga0501039_0049397_1940_2968 | 340 |
| 344 | 3300049579 | Ga0501043_0010222 | Ga0501043_0010222_588_1616 | 340 |
| 345 | 3300049580 | Ga0501046_0048001 | Ga0501046_0048001_634_1662 | 340 |
| 346 | 3300049581 | Ga0501047_0009295 | Ga0501047_0009295_6740_7768 | 340 |
| 347 | 3300049581 | Ga0501047_0029171 | Ga0501047_0029171_610_1632 | 340 |
| 348 | 3300049581 | Ga0501047_0042976 | Ga0501047_0042976_1130_2152 | 340 |
| 349 | 3300049582 | Ga0501048_0017746 | Ga0501048_0017746_1098_2126 | 340 |
| 350 | 3300049586 | Ga0501070_0055996 | Ga0501070_0055996_1354_2382 | 340 |
| 351 | 3300049589 | Ga0501073_0006622 | Ga0501073_0006622_346_1374 | 340 |
| 352 | 3300049590 | Ga0501074_0002982 | Ga0501074_0002982_7218_8246 | 340 |
| 353 | 3300049669 | Ga0501235_025022 | Ga0501235_025022_170_1192 | 340 |
| 354 | 3300049705 | Ga0501225_0001221 | Ga0501225_0001221_2682_3704 | 340 |
| 355 | 3300049744 | Ga0501083_0037414 | Ga0501083_0037414_1794_2822 | 340 |
| 356 | 3300049758 | Ga0501241_007505 | Ga0501241_007505_151_1197 | 340 |
| 357 | 3300049822 | Ga0501035_0007679 | Ga0501035_0007679_2585_3613 | 340 |
| 358 | 3300049823 | Ga0501044_0013869 | Ga0501044_0013869_2324_3346 | 340 |
| 359 | 3300049823 | Ga0501044_0055923 | Ga0501044_0055923_978_2006 | 340 |
| 360 | 3300049824 | Ga0501045_0116003 | Ga0501045_0116003_205_1233 | 340 |
| 361 | 3300050005 | Ga0501284_00015 | Ga0501284_00015_89630_90676 | 340 |
| 362 | 3300050493 | nmdc:mga0k408_21233_c1 | nmdc:mga0k408_21233_c1_2038_3060 | 340 |
| 363 | 3300050507 | nmdc:mga05p37_1846_c2 | nmdc:mga05p37_1846_c2_14748_15770 | 340 |
| 364 | 3300053086 | Ga0500578_0000001 | Ga0500578_0000001_298324_299346 | 340 |
| 365 | 3300053086 | Ga0500578_0061856 | Ga0500578_0061856_557_1579 | 340 |
| 366 | 3300053092 | Ga0500583_0000048 | Ga0500583_0000048_50359_51381 | 340 |
| 367 | 3300053092 | Ga0500583_0000388 | Ga0500583_0000388_5826_6848 | 340 |
| 368 | 3300053178 | Ga0500637_0011158 | Ga0500637_0011158_214_1254 | 340 |
| 369 | 3300053739 | Ga0500587_008976 | Ga0500587_008976_52_1074 | 340 |
| 370 | 3300060353 | Ga0501082_0241808 | Ga0501082_0241808_239_1267 | 340 |
| 371 | iso_pu_bacteria | 2738541283 | 2738759708 | 340 |
| 372 | 3300005331 | Ga0070670_100047428 | Ga0070670_1000474282 | 341 |
| 373 | 3300005367 | Ga0070667_100146045 | Ga0070667_1001460452 | 341 |
| 374 | 3300005456 | Ga0070678_100012996 | Ga0070678_1000129962 | 341 |
| 375 | 3300005577 | Ga0068857_100323658 | Ga0068857_1003236582 | 341 |
| 376 | 3300005842 | Ga0068858_100173690 | Ga0068858_1001736902 | 341 |
| 377 | 3300006237 | Ga0097621_100002450 | Ga0097621_1000024504 | 341 |
| 378 | 3300006358 | Ga0068871_100001412 | Ga0068871_1000014123 | 341 |
| 379 | 3300006358 | Ga0068871_100013603 | Ga0068871_1000136034 | 341 |
| 380 | 3300009093 | Ga0105240_10001434 | Ga0105240_1000143429 | 341 |
| 381 | 3300009553 | Ga0105249_10002214 | Ga0105249_100022141 | 341 |
| 382 | 3300009553 | Ga0105249_10007217 | Ga0105249_100072177 | 341 |
| 383 | 3300013102 | Ga0157371_10064551 | Ga0157371_100645513 | 341 |
| 384 | 3300013104 | Ga0157370_10006838 | Ga0157370_100068389 | 341 |
| 385 | 3300013297 | Ga0157378_10019172 | Ga0157378_100191724 | 341 |
| 386 | 3300013306 | Ga0163162_10000994 | Ga0163162_1000099413 | 341 |
| 387 | 3300013306 | Ga0163162_10002190 | Ga0163162_100021903 | 341 |
| 388 | 3300013306 | Ga0163162_10033988 | Ga0163162_100339881 | 341 |
| 389 | 3300013306 | Ga0163162_10133741 | Ga0163162_101337412 | 341 |
| 390 | 3300013308 | Ga0157375_10017191 | Ga0157375_100171913 | 341 |
| 391 | 3300013308 | Ga0157375_10027858 | Ga0157375_100278581 | 341 |
| 392 | 3300014325 | Ga0163163_10168596 | Ga0163163_101685961 | 341 |
| 393 | 3300014968 | Ga0157379_10014882 | Ga0157379_100148823 | 341 |
| 394 | 3300014968 | Ga0157379_10019062 | Ga0157379_100190623 | 341 |
| 395 | 3300014969 | Ga0157376_10000404 | Ga0157376_1000040413 | 341 |
| 396 | 3300014969 | Ga0157376_10078856 | Ga0157376_100788561 | 341 |
| 397 | 3300014969 | Ga0157376_10281280 | Ga0157376_102812802 | 341 |
| 398 | 3300017792 | Ga0163161_10005954 | Ga0163161_100059548 | 341 |
| 399 | 3300017792 | Ga0163161_10021017 | Ga0163161_100210172 | 341 |
| 400 | 3300025911 | Ga0207654_10040557 | Ga0207654_100405572 | 341 |
| 401 | 3300025941 | Ga0207711_10046034 | Ga0207711_100460342 | 341 |
| 402 | 3300025949 | Ga0207667_10125408 | Ga0207667_101254082 | 341 |
| 403 | 3300025961 | Ga0207712_10029647 | Ga0207712_100296472 | 341 |
| 404 | 3300025986 | Ga0207658_10040812 | Ga0207658_100408123 | 341 |
| 405 | 3300026035 | Ga0207703_10142123 | Ga0207703_101421232 | 341 |
| 406 | 3300026116 | Ga0207674_10106446 | Ga0207674_101064463 | 341 |
| 407 | 3300026121 | Ga0207683_10015154 | Ga0207683_100151545 | 341 |
| 408 | 3300044656 | Ga0466969_0000987 | Ga0466969_0000987_1400_2437 | 341 |
| 409 | 3300044684 | Ga0466966_0000054 | Ga0466966_0000054_35163_36200 | 341 |
| 410 | 3300045049 | Ga0466959_0000012 | Ga0466959_0000012_106014_107051 | 341 |
| 411 | 3300046517 | Ga0495630_0073510 | Ga0495630_0073510_636_1667 | 341 |
| 412 | 3300046691 | Ga0495670_0025666 | Ga0495670_0025666_1197_2228 | 341 |
| 413 | 3300048907 | Ga0496104_0343300 | Ga0496104_0343300_259_1344 | 341 |
| 414 | 3300049582 | Ga0501048_0150201 | Ga0501048_0150201_118_1152 | 341 |
| 415 | 3300049586 | Ga0501070_0143569 | Ga0501070_0143569_53_1087 | 341 |
| 416 | 3300049744 | Ga0501083_0068334 | Ga0501083_0068334_1183_2217 | 341 |
| 417 | 3300054114 | Ga0501084_0034032 | Ga0501084_0034032_1424_2458 | 341 |
| 418 | 3300060353 | Ga0501082_0046766 | Ga0501082_0046766_1634_2668 | 341 |
| 419 | 3300031507 | Ga0307509_10155272 | Ga0307509_101552722 | 342 |
| 420 | iso_pu_bacteria | 2775506987 | 2776613354 | 342 |
| 421 | 3300005337 | Ga0070682_100000005 | Ga0070682_10000000574 | 343 |
| 422 | 3300005544 | Ga0070686_100295105 | Ga0070686_1002951051 | 343 |
| 423 | 3300013297 | Ga0157378_10462901 | Ga0157378_104629011 | 343 |
| 424 | 3300044842 | Ga0466957_0000656 | Ga0466957_0000656_1972_3003 | 343 |
| 425 | 3300046660 | Ga0495625_0089322 | Ga0495625_0089322_225_1292 | 343 |
| 426 | 3300009545 | Ga0105237_10024976 | Ga0105237_100249765 | 344 |
| 427 | 3300013104 | Ga0157370_10002625 | Ga0157370_100026259 | 344 |
| 428 | 3300015261 | Ga0182006_1005799 | Ga0182006_10057993 | 344 |
| 429 | 3300017792 | Ga0163161_10008720 | Ga0163161_100087206 | 344 |
| 430 | 3300025914 | Ga0207671_10039435 | Ga0207671_100394351 | 344 |
| 431 | 3300048925 | Ga0496122_0000765 | Ga0496122_0000765_45354_46394 | 344 |
| 432 | 3300048926 | Ga0496123_0005845 | Ga0496123_0005845_2579_3619 | 344 |
| 433 | 3300005577 | Ga0068857_100003231 | Ga0068857_1000032313 | 345 |
| 434 | 3300005578 | Ga0068854_100003818 | Ga0068854_1000038188 | 345 |
| 435 | 3300009093 | Ga0105240_10020767 | Ga0105240_100207674 | 345 |
| 436 | 3300009093 | Ga0105240_10257180 | Ga0105240_102571801 | 345 |
| 437 | 3300009545 | Ga0105237_10002049 | Ga0105237_1000204911 | 345 |
| 438 | 3300009551 | Ga0105238_10013492 | Ga0105238_100134925 | 345 |
| 439 | 3300013104 | Ga0157370_10024877 | Ga0157370_100248773 | 345 |
| 440 | 3300013105 | Ga0157369_10017716 | Ga0157369_100177166 | 345 |
| 441 | 3300013307 | Ga0157372_10000294 | Ga0157372_100002942 | 345 |
| 442 | 3300025904 | Ga0207647_10078666 | Ga0207647_100786662 | 345 |
| 443 | 3300025913 | Ga0207695_10054985 | Ga0207695_100549852 | 345 |
| 444 | 3300025924 | Ga0207694_10015366 | Ga0207694_100153664 | 345 |
| 445 | 3300025949 | Ga0207667_10000403 | Ga0207667_1000040340 | 345 |
| 446 | 3300026041 | Ga0207639_10411400 | Ga0207639_104114001 | 345 |
| 447 | 3300026116 | Ga0207674_10000600 | Ga0207674_100006008 | 345 |
| 448 | 3300026142 | Ga0207698_10003680 | Ga0207698_100036807 | 345 |
| 449 | 2162886007 | SwRhRL2b_contig_2932149 | SwRhRL2b_0311.00002390 | 346 |
| 450 | 3300005288 | Ga0065714_10002765 | Ga0065714_1000276546 | 346 |
| 451 | 3300005289 | Ga0065704_10000288 | Ga0065704_1000028858 | 346 |
| 452 | 3300005289 | Ga0065704_10071650 | Ga0065704_100716506 | 346 |
| 453 | 3300013100 | Ga0157373_10000043 | Ga0157373_1000004328 | 346 |
| 454 | 3300013102 | Ga0157371_10002166 | Ga0157371_100021667 | 346 |
| 455 | 3300013102 | Ga0157371_10006167 | Ga0157371_100061676 | 346 |
| 456 | 3300013104 | Ga0157370_10117732 | Ga0157370_101177321 | 346 |
| 457 | 3300015261 | Ga0182006_1007537 | Ga0182006_10075374 | 346 |
| 458 | 3300031911 | Ga0307412_10000075 | Ga0307412_1000007556 | 346 |
| 459 | 3300032004 | Ga0307414_10001789 | Ga0307414_100017897 | 346 |
| 460 | 3300049758 | Ga0501241_008381 | Ga0501241_008381_298_1338 | 346 |
| 461 | 3300053093 | Ga0500651_0002187 | Ga0500651_0002187_8917_9957 | 346 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6uuk-assembly1.cif.gz_B | crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes | 0.9216 | 51 | 345 |
| 6uuk-assembly1.cif.gz_B | crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes | 0.9005 | 51 | 345 |
| 6uuk-assembly1.cif.gz_A | crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes | 0.8993 | 53 | 345 |
| 6uuk-assembly1.cif.gz_A | crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes | 0.8814 | 53 | 345 |
| 5z01-assembly1.cif.gz_A-2 | native escherichia coli l,d-carboxypeptidase a (ldca) | 0.8813 | 49 | 345 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76008_161_291_3.50.30.60 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like | 0.9234 | 211 | 335 | 3.50.30.60 |
| 4h1hB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain | 0.8962 | 41 | 196 | 3.40.50.10740 |
| 1zrsA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain | 0.8832 | 35 | 201 | 3.40.50.10740 |
| af_P76008_161_291_3.50.30.60 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like | 0.8704 | 211 | 335 | 3.50.30.60 |
| 1zl0A02 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like | 0.8686 | 211 | 343 | 3.50.30.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1T835-F1-model_v4 | LD-carboxypeptidase | 0.9955 | 40 | 346 |
GO:0004180
GO:0006508 GO:0008236 |
| AF-A0A519YKH2-F1-model_v4 | LD-carboxypeptidase N-terminal domain-containing protein | 0.9942 | 43 | 144 |
|
| AF-A0A4Q3TJZ9-F1-model_v4 | deleted | 0.9934 | 86 | 346 |
|
| AF-A0A4Q3ATW3-F1-model_v4 | LD-carboxypeptidase | 0.9912 | 206 | 346 |
GO:0004180
GO:0006508 GO:0008236 |
| AF-A0A3C1NNW9-F1-model_v4 | LD-carboxypeptidase | 0.991 | 165 | 346 |
GO:0004180
GO:0006508 GO:0008236 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar