F448697

General Info

Members Datasets Scaffolds Average Seq Length
461 259 446 342

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100024839|Ga0068856_1000248393
Length 345
Sequence MHMNRKRFLSSFLAPLAIAPVKGLRVFADGHEDDSLAAIRPRYLKPGDTIGITCPAGSITQQEIQPAMLQMIEWGFNIKVGDTVGKKDFTFGGTDEERARDFQQMIDDPKVKAIMCARGGYGFVRIIDKINFTKLVAKPKWIIGFSDITVLHCHLNRNYGMATIHSKMCNSFPDDWNKAEPIQIETILSIKQALIGAEKMKYSAPVNPLNKHGKAEGALVGGNLKTIETLAGTKSDIRTDNKILFVEDTGEYLYSIDRMFWNLKRTGKLEKLAALIVGGFKIKPDDPGEEFGRTVEEIVLEKVKNYHYPVCFDFPVGHQRNNYALKCGLNHKLTVGEDGVILKEV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2738541283 Pedobacter sp. OK701 Isolate Unclassified
4 2738541302 Pedobacter sp. CF074 Isolate Unclassified
5 2738543023 Pedobacter sp. OK628 Isolate Unclassified
6 2739367651 Pedobacter sp. OK291 Isolate Unclassified
7 2739367656 Pedobacter sp. CF523 Isolate Unclassified
8 2739367663 Pedobacter sp. YR510 Isolate Unclassified
9 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
10 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
11 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
12 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
13 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
14 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
15 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
16 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
17 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
18 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
104 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
107 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
108 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
167 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
175 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
176 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
177 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
178 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
179 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
202 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
210 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
225 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
226 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
227 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
228 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
229 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
230 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
231 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
232 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
233 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
234 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
235 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
236 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
240 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
250 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
251 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
252 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
253 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
254 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
255 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
256 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
257 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.96
Metatranscriptomes 0
Isolates 3.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.42
Nodule 0
Rhizoplane 0.65
Rhizosphere 88.07
Stem 0
Stem Tuber 0
Unclassified 5.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2932149 2162886007 Bacteria 10985
2 JGI25152J39213_1000111 3300002773 Bacteria 57579
3 JGI25150J39212_1000009 3300002774 Bacteria 249509
4 JGI25151J46595_10000017 3300003187 Bacteria 249509
5 JGI25153J46596_10000023 3300003215 Bacteria 249509
6 rootH1_10043460 3300003316 Bacteria 9314
7 rootH2_10001202 3300003320 Bacteria 51390
8 rootH2_10037451 3300003320 Bacteria 28858
9 rootH2_10253432 3300003320 Bacteria 2827
10 rootL2_10008147 3300003322 Bacteria 3398
11 rootL2_10024437 3300003322 Bacteria 3630
12 rootL2_10209965 3300003322 Unclassified 2828
13 rootH1_10023435 3300003323 Bacteria 23065
14 Ga0055536_1000003 3300003781 Bacteria 447744
15 Ga0055530_10005502 3300003791 Bacteria 5994
16 Ga0065714_10002765 3300005288 Bacteria 65513
17 Ga0065714_10012852 3300005288 Bacteria 1752
18 Ga0065704_10000288 3300005289 Bacteria 77379
19 Ga0065704_10071650 3300005289 Bacteria 10385
20 Ga0065712_10011070 3300005290 Bacteria 2638
21 Ga0065712_10069521 3300005290 Bacteria 7132
22 Ga0065715_10102809 3300005293 Bacteria 3083
23 Ga0065707_10026134 3300005295 Unclassified 1180
24 Ga0070658_10005285 3300005327 Bacteria 10487
25 Ga0070676_10048328 3300005328 Unclassified 2487
26 Ga0070683_100002310 3300005329 Bacteria 15119
27 Ga0070683_100002782 3300005329 Bacteria 13982
28 Ga0070670_100047428 3300005331 Bacteria 3697
29 Ga0070670_100050817 3300005331 Unclassified 3562
30 Ga0070670_100107630 3300005331 Bacteria 2402
31 Ga0070677_10072266 3300005333 Bacteria 1454
32 Ga0068869_100003774 3300005334 Bacteria 9330
33 Ga0070666_10079539 3300005335 Bacteria 2239
34 Ga0070666_10144205 3300005335 Bacteria 1659
35 Ga0070666_10206089 3300005335 Bacteria 1384
36 Ga0070682_100000005 3300005337 Bacteria 386439
37 Ga0070682_100060512 3300005337 Bacteria 2395
38 Ga0068868_100026419 3300005338 Bacteria 4424
39 Ga0068868_100284621 3300005338 Bacteria 1400
40 Ga0068868_100465104 3300005338 Unclassified 1102
41 Ga0070660_100001218 3300005339 Bacteria 17473
42 Ga0070660_100141677 3300005339 Bacteria 1929
43 Ga0070689_100016954 3300005340 Bacteria 5341
44 Ga0070661_100052921 3300005344 Bacteria 2971
45 Ga0070669_100025766 3300005353 Bacteria 4225
46 Ga0070675_100074762 3300005354 Bacteria 2815
47 Ga0070675_100095353 3300005354 Bacteria 2498
48 Ga0070675_100257361 3300005354 Bacteria 1529
49 Ga0070671_100186222 3300005355 Bacteria 1759
50 Ga0070674_100108089 3300005356 Bacteria 2038
51 Ga0070673_100038472 3300005364 Bacteria 3653
52 Ga0070673_100256410 3300005364 Bacteria 1526
53 Ga0070688_100127284 3300005365 Unclassified 1714
54 Ga0070659_100001755 3300005366 Bacteria 15575
55 Ga0070659_100036370 3300005366 Bacteria 3839
56 Ga0070667_100133605 3300005367 Bacteria 2168
57 Ga0070667_100146045 3300005367 Bacteria 2074
58 Ga0070701_10049685 3300005438 Bacteria 2169
59 Ga0070678_100012996 3300005456 Bacteria 5200
60 Ga0070662_100047997 3300005457 Bacteria 3074
61 Ga0068867_100096403 3300005459 Unclassified 2252
62 Ga0070698_100001279 3300005471 Bacteria 28081
63 Ga0070698_100002592 3300005471 Bacteria 19910
64 Ga0070684_100014118 3300005535 Bacteria 6459
65 Ga0070684_100018210 3300005535 Bacteria 5782
66 Ga0068853_100001810 3300005539 Bacteria 15718
67 Ga0068853_100078283 3300005539 Unclassified 2889
68 Ga0068853_100156744 3300005539 Bacteria 2052
69 Ga0068853_100179005 3300005539 Unclassified 1922
70 Ga0070672_100039139 3300005543 Unclassified 3630
71 Ga0070672_100169287 3300005543 Bacteria 1816
72 Ga0070686_100038249 3300005544 Bacteria 2981
73 Ga0070686_100295105 3300005544 Bacteria 1200
74 Ga0068855_100001432 3300005563 Bacteria 29672
75 Ga0068855_100040018 3300005563 Bacteria 5564
76 Ga0068857_100003231 3300005577 Bacteria 13531
77 Ga0068857_100031441 3300005577 Bacteria 4691
78 Ga0068857_100323658 3300005577 Bacteria 1424
79 Ga0068854_100003818 3300005578 Bacteria 9429
80 Ga0068854_100093646 3300005578 Bacteria 2240
81 Ga0068856_100024839 3300005614 Bacteria 5837
82 Ga0068852_100000424 3300005616 Bacteria 28108
83 Ga0068852_100138386 3300005616 Bacteria 2250
84 Ga0068859_100034496 3300005617 Bacteria 5078
85 Ga0068859_100436054 3300005617 Unclassified 1406
86 Ga0068864_100100086 3300005618 Bacteria 2569
87 Ga0068864_100136915 3300005618 Bacteria 2206
88 Ga0068861_100024539 3300005719 Bacteria 4361
89 Ga0068870_10005475 3300005840 Bacteria 5549
90 Ga0068858_100173690 3300005842 Bacteria 2033
91 Ga0068860_100000252 3300005843 Bacteria 79891
92 Ga0068860_100003398 3300005843 Bacteria 16371
93 Ga0068860_100023111 3300005843 Bacteria 6012
94 Ga0081540_1008958 3300005983 Bacteria 6928
95 Ga0097621_100002450 3300006237 Bacteria 12708
96 Ga0097621_100004097 3300006237 Bacteria 10111
97 Ga0097621_100081296 3300006237 Bacteria 2696
98 Ga0097621_100121208 3300006237 Bacteria 2218
99 Ga0068871_100001412 3300006358 Bacteria 16072
100 Ga0068871_100013603 3300006358 Bacteria 6043
101 Ga0068871_100027554 3300006358 Unclassified 4446
102 Ga0068871_100197388 3300006358 Bacteria 1736
103 Ga0075428_100038235 3300006844 Bacteria 5280
104 Ga0075431_100039382 3300006847 Bacteria 4868
105 Ga0097620_100034496 3300006931 Bacteria 5078
106 Ga0097620_100436033 3300006931 Unclassified 1406
107 Ga0105240_10000431 3300009093 Bacteria 77497
108 Ga0105240_10001434 3300009093 Bacteria 40792
109 Ga0105240_10003449 3300009093 Bacteria 24537
110 Ga0105240_10003572 3300009093 Bacteria 24125
111 Ga0105240_10003829 3300009093 Bacteria 23261
112 Ga0105240_10004355 3300009093 Bacteria 21610
113 Ga0105240_10006516 3300009093 Bacteria 17139
114 Ga0105240_10020767 3300009093 Bacteria 8749
115 Ga0105240_10024925 3300009093 Bacteria 7874
116 Ga0105240_10242760 3300009093 Bacteria 2087
117 Ga0105240_10257180 3300009093 Bacteria 2016
118 Ga0111539_10002057 3300009094 Bacteria 26904
119 Ga0111539_10009272 3300009094 Bacteria 12434
120 Ga0105245_10452338 3300009098 Bacteria 1293
121 Ga0114129_10002037 3300009147 Bacteria 27713
122 Ga0114129_10333505 3300009147 Unclassified 2013
123 Ga0105241_10002146 3300009174 Bacteria 14869
124 Ga0105242_10029348 3300009176 Bacteria 4386
125 Ga0105242_10224019 3300009176 Unclassified 1682
126 Ga0105242_10318496 3300009176 Bacteria 1426
127 Ga0105237_10002049 3300009545 Bacteria 25638
128 Ga0105237_10009667 3300009545 Bacteria 10322
129 Ga0105237_10014339 3300009545 Bacteria 8296
130 Ga0105237_10024976 3300009545 Bacteria 6113
131 Ga0105237_10040303 3300009545 Bacteria 4711
132 Ga0105237_10043497 3300009545 Bacteria 4523
133 Ga0105237_10078911 3300009545 Bacteria 3282
134 Ga0105238_10001088 3300009551 Bacteria 27427
135 Ga0105238_10013492 3300009551 Bacteria 8249
136 Ga0105238_10331505 3300009551 Bacteria 1509
137 Ga0105249_10002214 3300009553 Bacteria 16849
138 Ga0105249_10007217 3300009553 Bacteria 9695
139 Ga0105249_10050324 3300009553 Bacteria 3798
140 Ga0105239_10001881 3300010375 Bacteria 27435
141 Ga0105239_10002232 3300010375 Bacteria 24792
142 Ga0105239_10002512 3300010375 Bacteria 23336
143 Ga0105239_10012133 3300010375 Bacteria 9608
144 Ga0105239_10012220 3300010375 Bacteria 9571
145 Ga0105239_10024455 3300010375 Bacteria 6655
146 Ga0105239_10148225 3300010375 Bacteria 2618
147 Ga0105246_10037839 3300011119 Bacteria 3240
148 Ga0157373_10000043 3300013100 Bacteria 113422
149 Ga0157373_10025384 3300013100 Bacteria 4286
150 Ga0157373_10256164 3300013100 Bacteria 1238
151 Ga0157371_10002166 3300013102 Bacteria 19115
152 Ga0157371_10002575 3300013102 Bacteria 17198
153 Ga0157371_10006167 3300013102 Bacteria 9949
154 Ga0157371_10064551 3300013102 Bacteria 2594
155 Ga0157370_10002625 3300013104 Bacteria 21610
156 Ga0157370_10002741 3300013104 Bacteria 21072
157 Ga0157370_10006838 3300013104 Bacteria 12497
158 Ga0157370_10024877 3300013104 Bacteria 5928
159 Ga0157370_10063883 3300013104 Bacteria 3486
160 Ga0157370_10104367 3300013104 Bacteria 2653
161 Ga0157370_10117732 3300013104 Bacteria 2482
162 Ga0157370_10189139 3300013104 Bacteria 1911
163 Ga0157370_10192217 3300013104 Bacteria 1895
164 Ga0157369_10017716 3300013105 Bacteria 7999
165 Ga0157369_10063484 3300013105 Bacteria 3979
166 Ga0157369_10306246 3300013105 Bacteria 1652
167 Ga0157374_10000025 3300013296 Bacteria 245131
168 Ga0157374_10025814 3300013296 Bacteria 5281
169 Ga0157374_10051285 3300013296 Bacteria 3839
170 Ga0157374_10122966 3300013296 Bacteria 2506
171 Ga0157374_10232423 3300013296 Bacteria 1811
172 Ga0157378_10019172 3300013297 Bacteria 6012
173 Ga0157378_10051569 3300013297 Bacteria 3661
174 Ga0157378_10140148 3300013297 Bacteria 2245
175 Ga0157378_10462901 3300013297 Bacteria 1260
176 Ga0163162_10000124 3300013306 Bacteria 68603
177 Ga0163162_10000410 3300013306 Bacteria 39376
178 Ga0163162_10000994 3300013306 Bacteria 26396
179 Ga0163162_10002190 3300013306 Bacteria 18338
180 Ga0163162_10016117 3300013306 Bacteria 7306
181 Ga0163162_10033988 3300013306 Bacteria 5071
182 Ga0163162_10133741 3300013306 Bacteria 2590
183 Ga0157372_10000294 3300013307 Bacteria 55599
184 Ga0157372_10002269 3300013307 Bacteria 20833
185 Ga0157372_10474616 3300013307 Unclassified 1458
186 Ga0157375_10017191 3300013308 Bacteria 6520
187 Ga0157375_10027858 3300013308 Bacteria 5286
188 Ga0163163_10059845 3300014325 Bacteria 3769
189 Ga0163163_10168596 3300014325 Unclassified 2236
190 Ga0163163_10324883 3300014325 Bacteria 1592
191 Ga0157380_10009117 3300014326 Bacteria 7094
192 Ga0157380_10014693 3300014326 Bacteria 5733
193 Ga0157380_10142902 3300014326 Bacteria 2058
194 Ga0157380_10295421 3300014326 Bacteria 1489
195 Ga0182008_10000975 3300014497 Bacteria 19863
196 Ga0157377_10001182 3300014745 Bacteria 11091
197 Ga0157377_10106384 3300014745 Bacteria 1680
198 Ga0157379_10014882 3300014968 Bacteria 6825
199 Ga0157379_10019062 3300014968 Bacteria 6058
200 Ga0157376_10000404 3300014969 Bacteria 28086
201 Ga0157376_10016798 3300014969 Bacteria 5566
202 Ga0157376_10078856 3300014969 Bacteria 2822
203 Ga0157376_10281280 3300014969 Bacteria 1567
204 Ga0182006_1000244 3300015261 Bacteria 50752
205 Ga0182006_1000646 3300015261 Bacteria 24714
206 Ga0182006_1005799 3300015261 Bacteria 5820
207 Ga0182006_1007537 3300015261 Bacteria 4975
208 Ga0183373_1010 3300015682 Bacteria 196982
209 Ga0163161_10000468 3300017792 Bacteria 33545
210 Ga0163161_10001705 3300017792 Bacteria 16126
211 Ga0163161_10005954 3300017792 Bacteria 8455
212 Ga0163161_10008720 3300017792 Bacteria 7013
213 Ga0163161_10021017 3300017792 Bacteria 4587
214 Ga0207425_1000007 3300025245 Bacteria 777411
215 Ga0209129_1000006 3300025258 Bacteria 777761
216 Ga0209676_1000001 3300025292 Bacteria 1852142
217 Ga0209025_1000025 3300025294 Bacteria 524454
218 Ga0209758_1000016 3300025297 Bacteria 778557
219 Ga0209050_1000016 3300025298 Bacteria 729149
220 Ga0207682_10072225 3300025893 Bacteria 1464
221 Ga0207688_10003403 3300025901 Bacteria 8675
222 Ga0207680_10080217 3300025903 Bacteria 2049
223 Ga0207680_10134619 3300025903 Bacteria 1632
224 Ga0207647_10000017 3300025904 Bacteria 129999
225 Ga0207647_10078666 3300025904 Bacteria 1980
226 Ga0207645_10001413 3300025907 Bacteria 19673
227 Ga0207643_10003479 3300025908 Bacteria 8476
228 Ga0207643_10005893 3300025908 Bacteria 6546
229 Ga0207705_10028650 3300025909 Bacteria 3969
230 Ga0207654_10040557 3300025911 Bacteria 2624
231 Ga0207695_10000282 3300025913 Bacteria 126242
232 Ga0207695_10001411 3300025913 Bacteria 40483
233 Ga0207695_10001469 3300025913 Bacteria 39469
234 Ga0207695_10003026 3300025913 Bacteria 24133
235 Ga0207695_10012182 3300025913 Bacteria 10335
236 Ga0207695_10051044 3300025913 Bacteria 4346
237 Ga0207695_10054985 3300025913 Bacteria 4152
238 Ga0207695_10070785 3300025913 Unclassified 3563
239 Ga0207695_10091226 3300025913 Bacteria 3061
240 Ga0207695_10262773 3300025913 Bacteria 1623
241 Ga0207671_10004781 3300025914 Bacteria 12765
242 Ga0207671_10017316 3300025914 Bacteria 5560
243 Ga0207671_10039435 3300025914 Bacteria 3497
244 Ga0207671_10065465 3300025914 Bacteria 2704
245 Ga0207671_10070076 3300025914 Bacteria 2613
246 Ga0207671_10200790 3300025914 Bacteria 1557
247 Ga0207657_10054002 3300025919 Bacteria 3477
248 Ga0207649_10153529 3300025920 Bacteria 1588
249 Ga0207681_10139526 3300025923 Unclassified 1804
250 Ga0207694_10015366 3300025924 Bacteria 5774
251 Ga0207694_10271123 3300025924 Bacteria 1392
252 Ga0207650_10081616 3300025925 Bacteria 2453
253 Ga0207659_10027806 3300025926 Bacteria 3834
254 Ga0207659_10028669 3300025926 Bacteria 3786
255 Ga0207659_10067108 3300025926 Bacteria 2605
256 Ga0207659_10137444 3300025926 Unclassified 1893
257 Ga0207706_10011729 3300025933 Bacteria 7987
258 Ga0207686_10000722 3300025934 Bacteria 20514
259 Ga0207686_10160939 3300025934 Bacteria 1573
260 Ga0207670_10142309 3300025936 Bacteria 1770
261 Ga0207691_10010578 3300025940 Bacteria 8849
262 Ga0207691_10017968 3300025940 Bacteria 6698
263 Ga0207691_10018396 3300025940 Bacteria 6621
264 Ga0207691_10198620 3300025940 Bacteria 1746
265 Ga0207711_10046034 3300025941 Bacteria 3727
266 Ga0207689_10004939 3300025942 Bacteria 12012
267 Ga0207689_10180435 3300025942 Bacteria 1741
268 Ga0207661_10002021 3300025944 Bacteria 13987
269 Ga0207661_10109042 3300025944 Bacteria 2338
270 Ga0207667_10000403 3300025949 Bacteria 58481
271 Ga0207667_10001258 3300025949 Bacteria 31777
272 Ga0207667_10022507 3300025949 Bacteria 6959
273 Ga0207667_10125408 3300025949 Bacteria 2644
274 Ga0207651_10015187 3300025960 Bacteria 4468
275 Ga0207651_10136537 3300025960 Bacteria 1887
276 Ga0207712_10029647 3300025961 Bacteria 3673
277 Ga0207712_10279312 3300025961 Bacteria 1362
278 Ga0207668_10243040 3300025972 Unclassified 1458
279 Ga0207640_10066873 3300025981 Bacteria 2403
280 Ga0207658_10040812 3300025986 Bacteria 3357
281 Ga0207658_10129946 3300025986 Bacteria 2022
282 Ga0207658_10189548 3300025986 Bacteria 1708
283 Ga0207677_10319038 3300026023 Bacteria 1290
284 Ga0207703_10142123 3300026035 Bacteria 2084
285 Ga0207639_10018474 3300026041 Bacteria 4955
286 Ga0207639_10051504 3300026041 Unclassified 3132
287 Ga0207639_10411400 3300026041 Unclassified 1221
288 Ga0207702_10211699 3300026078 Bacteria 1802
289 Ga0207641_10000783 3300026088 Bacteria 33947
290 Ga0207648_10026399 3300026089 Bacteria 5161
291 Ga0207648_10051653 3300026089 Bacteria 3593
292 Ga0207676_10108651 3300026095 Bacteria 2316
293 Ga0207674_10000600 3300026116 Bacteria 47324
294 Ga0207674_10059731 3300026116 Bacteria 3857
295 Ga0207674_10106446 3300026116 Bacteria 2782
296 Ga0207675_100005681 3300026118 Bacteria 11937
297 Ga0207675_100039287 3300026118 Bacteria 4417
298 Ga0207683_10015154 3300026121 Bacteria 6560
299 Ga0207683_10128353 3300026121 Bacteria 2280
300 Ga0207698_10003680 3300026142 Bacteria 9265
301 Ga0207698_10011350 3300026142 Bacteria 5771
302 Ga0207698_10014452 3300026142 Bacteria 5249
303 Ga0209974_10051586 3300027876 Bacteria 1384
304 Ga0268266_10101682 3300028379 Bacteria 2534
305 Ga0268265_10190663 3300028380 Bacteria 1770
306 Ga0268264_10000015 3300028381 Bacteria 508501
307 Ga0268264_10000019 3300028381 Bacteria 488112
308 Ga0268264_10000054 3300028381 Bacteria 317048
309 Ga0268264_10002332 3300028381 Bacteria 16777
310 Ga0268264_10028905 3300028381 Bacteria 4538
311 Ga0307517_10001171 3300028786 Bacteria 44114
312 Ga0307517_10144687 3300028786 Bacteria 1654
313 Ga0307513_10138558 3300031456 Bacteria 2364
314 Ga0307509_10104247 3300031507 Bacteria 2862
315 Ga0307509_10155272 3300031507 Bacteria 2196
316 Ga0307508_10000162 3300031616 Bacteria 80675
317 Ga0307516_10054170 3300031730 Bacteria 3921
318 Ga0307406_10287470 3300031901 Bacteria 1257
319 Ga0307407_10000009 3300031903 Bacteria 188746
320 Ga0307412_10000075 3300031911 Bacteria 97612
321 Ga0307416_100000019 3300032002 Bacteria 199706
322 Ga0307414_10001789 3300032004 Bacteria 11123
323 Ga0307414_10136337 3300032004 Bacteria 1914
324 Ga0307510_10010057 3300033180 Bacteria 11243
325 Ga0373936_0047719 3300035113 Bacteria 1728
326 Ga0373935_0280077 3300035692 Bacteria 1174
327 Ga0395899_0025319 3300037312 Bacteria 4478
328 Ga0395900_0042519 3300037418 Bacteria 4682
329 Ga0395898_0029694 3300037466 Bacteria 5472
330 Ga0395905_0007445 3300037471 Bacteria 10889
331 Ga0395901_0064301 3300038443 Bacteria 3818
332 Ga0439436_0005395 3300041404 Bacteria 3915
333 Ga0451800_1238597 3300041459 Bacteria 1091
334 Ga0439442_003910 3300042002 Bacteria 2954
335 Ga0439449_0008697 3300042007 Bacteria 3854
336 Ga0439462_0005705 3300042015 Bacteria 3076
337 Ga0439434_0021436 3300042435 Bacteria 1941
338 Ga0466969_0000987 3300044656 Bacteria 15353
339 Ga0466972_0000032 3300044658 Bacteria 159445
340 Ga0466972_0000099 3300044658 Bacteria 76709
341 Ga0466972_0077574 3300044658 Bacteria 1582
342 Ga0453683_0073194 3300044673 Bacteria 2145
343 Ga0466966_0000054 3300044684 Bacteria 82352
344 Ga0466961_0115507 3300044693 Unclassified 1687
345 Ga0453684_0072272 3300044712 Bacteria 4356
346 Ga0466970_0034646 3300044765 Bacteria 2673
347 Ga0466957_0000656 3300044842 Bacteria 17549
348 Ga0466960_0070345 3300044901 Bacteria 1741
349 Ga0466959_0000012 3300045049 Bacteria 168961
350 Ga0466959_0000436 3300045049 Bacteria 24268
351 Ga0495638_0044975 3300046460 Bacteria 2780
352 Ga0495606_0003604 3300046507 Bacteria 16293
353 Ga0495610_0012275 3300046512 Bacteria 5170
354 Ga0495630_0053250 3300046517 Bacteria 3030
355 Ga0495630_0073510 3300046517 Bacteria 2575
356 Ga0495648_0001051 3300046524 Bacteria 28002
357 Ga0495621_0014082 3300046539 Bacteria 2525
358 Ga0495668_0003162 3300046616 Bacteria 12690
359 Ga0495634_0041202 3300046642 Bacteria 3137
360 Ga0495611_0002528 3300046648 Bacteria 8319
361 Ga0495625_0089322 3300046660 Bacteria 2133
362 Ga0495658_0005149 3300046683 Bacteria 6428
363 Ga0495670_0025666 3300046691 Bacteria 2915
364 Ga0495649_0058986 3300046694 Bacteria 2067
365 Ga0495672_0022983 3300047320 Unclassified 4044
366 Ga0495672_0026218 3300047320 Bacteria 3721
367 Ga0495676_0100694 3300047321 Bacteria 2139
368 Ga0496104_0343300 3300048907 Bacteria 1406
369 Ga0496115_0064676 3300048918 Bacteria 2953
370 Ga0496122_0000765 3300048925 Bacteria 62189
371 Ga0496123_0005845 3300048926 Bacteria 12189
372 Ga0501290_001589 3300049513 Bacteria 3062
373 Ga0501297_000579 3300049520 Bacteria 3311
374 Ga0501032_0036133 3300049569 Bacteria 3374
375 Ga0501032_0042507 3300049569 Bacteria 3082
376 Ga0501034_0011765 3300049571 Bacteria 9055
377 Ga0501034_0020155 3300049571 Bacteria 6807
378 Ga0501036_0031255 3300049572 Bacteria 4499
379 Ga0501037_0075581 3300049573 Bacteria 2446
380 Ga0501038_0015399 3300049574 Bacteria 6952
381 Ga0501038_0050071 3300049574 Bacteria 3611
382 Ga0501039_0049397 3300049575 Bacteria 3252
383 Ga0501043_0010222 3300049579 Bacteria 7355
384 Ga0501043_0061179 3300049579 Bacteria 2957
385 Ga0501043_0207902 3300049579 Bacteria 1517
386 Ga0501043_0302257 3300049579 Bacteria 1222
387 Ga0501046_0048001 3300049580 Bacteria 3382
388 Ga0501047_0003414 3300049581 Bacteria 15035
389 Ga0501047_0009295 3300049581 Bacteria 9283
390 Ga0501047_0029171 3300049581 Bacteria 5321
391 Ga0501047_0042976 3300049581 Bacteria 4366
392 Ga0501047_0180392 3300049581 Bacteria 1978
393 Ga0501048_0017746 3300049582 Bacteria 5237
394 Ga0501048_0150201 3300049582 Unclassified 1648
395 Ga0501070_0055996 3300049586 Bacteria 3269
396 Ga0501070_0143569 3300049586 Bacteria 1970
397 Ga0501073_0006622 3300049589 Bacteria 8625
398 Ga0501074_0002982 3300049590 Bacteria 11896
399 Ga0501198_002349 3300049649 Bacteria 2543
400 Ga0501202_000356 3300049652 Bacteria 6369
401 Ga0501206_001354 3300049653 Bacteria 3062
402 Ga0501217_000636 3300049661 Bacteria 5919
403 Ga0501217_007302 3300049661 Bacteria 2365
404 Ga0501224_000608 3300049664 Bacteria 4414
405 Ga0501235_000430 3300049669 Bacteria 8137
406 Ga0501235_025022 3300049669 Bacteria 1335
407 Ga0501243_000328 3300049675 Bacteria 6180
408 Ga0501249_033255 3300049679 Viruses 1155
409 Ga0501253_000404 3300049683 Bacteria 3637
410 Ga0501259_000947 3300049688 Bacteria 4793
411 Ga0501261_001046 3300049690 Bacteria 3398
412 Ga0501225_0000892 3300049705 Bacteria 9288
413 Ga0501225_0001221 3300049705 Bacteria 8004
414 Ga0501234_000801 3300049707 Bacteria 4924
415 Ga0501079_0160635 3300049741 Bacteria 1752
416 Ga0501083_0037414 3300049744 Bacteria 3306
417 Ga0501083_0068334 3300049744 Bacteria 2364
418 Ga0501241_007505 3300049758 Bacteria 1996
419 Ga0501241_008381 3300049758 Bacteria 1889
420 Ga0501273_004573 3300049770 Bacteria 1526
421 Ga0501035_0007679 3300049822 Bacteria 10075
422 Ga0501035_0081840 3300049822 Bacteria 2849
423 Ga0501044_0013869 3300049823 Bacteria 8710
424 Ga0501044_0055923 3300049823 Bacteria 4051
425 Ga0501044_0065602 3300049823 Bacteria 3702
426 Ga0501045_0116003 3300049824 Bacteria 1987
427 Ga0501284_00015 3300050005 Bacteria 104438
428 nmdc:mga0k408_21233_c1 3300050493 Bacteria 3645
429 nmdc:mga05p37_1846_c2 3300050507 Bacteria 21167
430 nmdc:mga06r32_144304_c1 3300050510 Bacteria 2358
431 nmdc:mga08y16_199945_c1 3300050511 Bacteria 2071
432 Ga0500578_0000001 3300053086 Bacteria 317120
433 Ga0500578_0061856 3300053086 Bacteria 2390
434 Ga0500583_0000048 3300053092 Bacteria 78503
435 Ga0500583_0000388 3300053092 Bacteria 14200
436 Ga0500583_0013232 3300053092 Bacteria 3184
437 Ga0500651_0002187 3300053093 Bacteria 10235
438 Ga0500555_039834 3300053103 Bacteria 1311
439 Ga0500568_0036638 3300053139 Bacteria 1995
440 Ga0500604_0004170 3300053151 Bacteria 3851
441 Ga0500622_0084532 3300053156 Unclassified 1584
442 Ga0500637_0011158 3300053178 Bacteria 4633
443 Ga0500587_008976 3300053739 Bacteria 1283
444 Ga0501084_0034032 3300054114 Bacteria 4261
445 Ga0501082_0046766 3300060353 Bacteria 3729
446 Ga0501082_0241808 3300060353 Bacteria 1571

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053103 Ga0500555_039834 Ga0500555_039834_108_941 277
2 3300005337 Ga0070682_100000005 Ga0070682_10000000572 300
3 3300014326 Ga0157380_10142902 Ga0157380_101429023 300
4 3300047320 Ga0495672_0026218 Ga0495672_0026218_1734_2639 300
5 3300003322 rootL2_10024437 rootL2_100244372 309
6 3300013297 Ga0157378_10051569 Ga0157378_100515693 318
7 3300025972 Ga0207668_10243040 Ga0207668_102430401 318
8 3300005339 Ga0070660_100001218 Ga0070660_10000121815 319
9 3300025919 Ga0207657_10054002 Ga0207657_100540024 319
10 3300049741 Ga0501079_0160635 Ga0501079_0160635_12_971 319
11 3300009094 Ga0111539_10002057 Ga0111539_1000205716 321
12 3300014745 Ga0157377_10106384 Ga0157377_101063842 321
13 3300026118 Ga0207675_100039287 Ga0207675_1000392873 321
14 3300025903 Ga0207680_10080217 Ga0207680_100802171 322
15 3300031901 Ga0307406_10287470 Ga0307406_102874701 324
16 3300046517 Ga0495630_0053250 Ga0495630_0053250_585_1619 325
17 3300046642 Ga0495634_0041202 Ga0495634_0041202_123_1157 325
18 3300046683 Ga0495658_0005149 Ga0495658_0005149_4680_5714 325
19 3300046694 Ga0495649_0058986 Ga0495649_0058986_233_1303 325
20 3300047321 Ga0495676_0100694 Ga0495676_0100694_56_1090 325
21 3300049679 Ga0501249_033255 Ga0501249_033255_128_1108 325
22 iso_pu_bacteria 2738541278 2738728862 326
23 3300031730 Ga0307516_10054170 Ga0307516_100541703 328
24 3300003322 rootL2_10209965 rootL2_102099652 329
25 3300049569 Ga0501032_0036133 Ga0501032_0036133_349_1356 329
26 3300049571 Ga0501034_0011765 Ga0501034_0011765_60_1067 329
27 3300049573 Ga0501037_0075581 Ga0501037_0075581_688_1695 329
28 3300049574 Ga0501038_0015399 Ga0501038_0015399_1764_2771 329
29 3300049581 Ga0501047_0003414 Ga0501047_0003414_2955_3962 329
30 3300049822 Ga0501035_0081840 Ga0501035_0081840_601_1608 329
31 3300049823 Ga0501044_0065602 Ga0501044_0065602_2210_3217 329
32 3300005356 Ga0070674_100108089 Ga0070674_1001080892 330
33 3300044693 Ga0466961_0115507 Ga0466961_0115507_604_1662 330
34 3300045049 Ga0466959_0000436 Ga0466959_0000436_12256_13314 330
35 3300046648 Ga0495611_0002528 Ga0495611_0002528_3702_4760 330
36 3300005329 Ga0070683_100002782 Ga0070683_10000278211 333
37 3300005338 Ga0068868_100465104 Ga0068868_1004651041 333
38 3300005459 Ga0068867_100096403 Ga0068867_1000964032 333
39 3300005535 Ga0070684_100014118 Ga0070684_1000141185 333
40 3300005539 Ga0068853_100001810 Ga0068853_1000018108 333
41 3300005563 Ga0068855_100001432 Ga0068855_10000143221 333
42 3300005578 Ga0068854_100093646 Ga0068854_1000936462 333
43 3300009093 Ga0105240_10003829 Ga0105240_1000382917 333
44 3300009093 Ga0105240_10006516 Ga0105240_1000651613 333
45 3300009176 Ga0105242_10224019 Ga0105242_102240191 333
46 3300010375 Ga0105239_10012133 Ga0105239_100121335 333
47 3300010375 Ga0105239_10024455 Ga0105239_100244553 333
48 3300013104 Ga0157370_10104367 Ga0157370_101043672 333
49 3300013105 Ga0157369_10063484 Ga0157369_100634842 333
50 3300025913 Ga0207695_10000282 Ga0207695_1000028290 333
51 3300025913 Ga0207695_10051044 Ga0207695_100510442 333
52 3300025942 Ga0207689_10180435 Ga0207689_101804352 333
53 3300025944 Ga0207661_10002021 Ga0207661_100020213 333
54 3300025949 Ga0207667_10001258 Ga0207667_1000125813 333
55 3300026041 Ga0207639_10018474 Ga0207639_100184743 333
56 3300026089 Ga0207648_10026399 Ga0207648_100263993 333
57 3300049579 Ga0501043_0061179 Ga0501043_0061179_1849_2868 333
58 3300003320 rootH2_10037451 rootH2_100374516 334
59 3300005328 Ga0070676_10048328 Ga0070676_100483284 334
60 3300005334 Ga0068869_100003774 Ga0068869_1000037747 334
61 3300005338 Ga0068868_100026419 Ga0068868_1000264192 334
62 3300005543 Ga0070672_100039139 Ga0070672_1000391395 334
63 3300005617 Ga0068859_100034496 Ga0068859_1000344966 334
64 3300005840 Ga0068870_10005475 Ga0068870_100054757 334
65 3300006237 Ga0097621_100081296 Ga0097621_1000812963 334
66 3300006358 Ga0068871_100027554 Ga0068871_1000275543 334
67 3300006931 Ga0097620_100034496 Ga0097620_1000344966 334
68 3300009098 Ga0105245_10452338 Ga0105245_104523381 334
69 3300025901 Ga0207688_10003403 Ga0207688_100034033 334
70 3300025907 Ga0207645_10001413 Ga0207645_100014134 334
71 3300025908 Ga0207643_10005893 Ga0207643_100058937 334
72 3300025926 Ga0207659_10067108 Ga0207659_100671083 334
73 3300025934 Ga0207686_10160939 Ga0207686_101609392 334
74 3300025940 Ga0207691_10017968 Ga0207691_100179684 334
75 3300025942 Ga0207689_10004939 Ga0207689_100049392 334
76 3300025960 Ga0207651_10136537 Ga0207651_101365372 334
77 3300025986 Ga0207658_10189548 Ga0207658_101895483 334
78 3300026041 Ga0207639_10051504 Ga0207639_100515044 334
79 3300026089 Ga0207648_10051653 Ga0207648_100516533 334
80 3300028379 Ga0268266_10101682 Ga0268266_101016821 334
81 3300028380 Ga0268265_10190663 Ga0268265_101906631 334
82 3300035692 Ga0373935_0280077 Ga0373935_0280077_55_1098 334
83 3300049579 Ga0501043_0302257 Ga0501043_0302257_202_1206 334
84 3300049581 Ga0501047_0180392 Ga0501047_0180392_912_1916 334
85 iso_pu_bacteria 2904445276 2904445766 334
86 3300005293 Ga0065715_10102809 Ga0065715_101028091 335
87 3300006847 Ga0075431_100039382 Ga0075431_1000393822 335
88 3300014326 Ga0157380_10009117 Ga0157380_100091176 335
89 3300025926 Ga0207659_10028669 Ga0207659_100286694 335
90 3300025940 Ga0207691_10010578 Ga0207691_100105787 335
91 3300026121 Ga0207683_10128353 Ga0207683_101283532 335
92 3300050510 nmdc:mga06r32_144304_c1 nmdc:mga06r32_144304_c1_827_1837 335
93 3300053156 Ga0500622_0084532 Ga0500622_0084532_242_1249 335
94 iso_pu_bacteria 2852627209 2852631672 335
95 iso_pu_bacteria 2919186247 2919187016 335
96 iso_pu_bacteria 2939664404 2939665715 335
97 3300003322 rootL2_10008147 rootL2_100081474 336
98 3300014325 Ga0163163_10059845 Ga0163163_100598453 336
99 3300033180 Ga0307510_10010057 Ga0307510_100100574 336
100 3300046507 Ga0495606_0003604 Ga0495606_0003604_6064_7104 336
101 iso_pu_bacteria 2738541302 2738853903 336
102 iso_pu_bacteria 2739367651 2739588480 336
103 iso_pu_bacteria 2739367656 2739617955 336
104 iso_pu_bacteria 2739367663 2739645169 336
105 iso_pu_bacteria 2849281842 2849284369 336
106 iso_pu_bacteria 2857627736 2857631023 336
107 3300005335 Ga0070666_10206089 Ga0070666_102060892 337
108 3300005843 Ga0068860_100003398 Ga0068860_1000033989 337
109 3300006237 Ga0097621_100121208 Ga0097621_1001212082 337
110 3300006358 Ga0068871_100197388 Ga0068871_1001973883 337
111 3300009093 Ga0105240_10003449 Ga0105240_1000344910 337
112 3300009093 Ga0105240_10003572 Ga0105240_1000357210 337
113 3300009551 Ga0105238_10331505 Ga0105238_103315052 337
114 3300010375 Ga0105239_10002232 Ga0105239_1000223213 337
115 3300013296 Ga0157374_10000025 Ga0157374_1000002539 337
116 3300013306 Ga0163162_10000124 Ga0163162_100001242 337
117 3300014969 Ga0157376_10016798 Ga0157376_100167985 337
118 3300025913 Ga0207695_10001469 Ga0207695_1000146910 337
119 3300025913 Ga0207695_10003026 Ga0207695_1000302614 337
120 3300025913 Ga0207695_10262773 Ga0207695_102627732 337
121 3300025924 Ga0207694_10271123 Ga0207694_102711232 337
122 3300028381 Ga0268264_10002332 Ga0268264_100023326 337
123 3300031507 Ga0307509_10104247 Ga0307509_101042472 337
124 3300037312 Ga0395899_0025319 Ga0395899_0025319_149_1165 337
125 3300037418 Ga0395900_0042519 Ga0395900_0042519_156_1172 337
126 3300037466 Ga0395898_0029694 Ga0395898_0029694_149_1165 337
127 3300037471 Ga0395905_0007445 Ga0395905_0007445_9341_10357 337
128 3300038443 Ga0395901_0064301 Ga0395901_0064301_1584_2600 337
129 3300044658 Ga0466972_0000099 Ga0466972_0000099_6862_8004 337
130 3300044765 Ga0466970_0034646 Ga0466970_0034646_1498_2646 337
131 3300044901 Ga0466960_0070345 Ga0466960_0070345_353_1381 337
132 3300053092 Ga0500583_0013232 Ga0500583_0013232_896_1948 337
133 3300005290 Ga0065712_10011070 Ga0065712_100110703 338
134 3300005335 Ga0070666_10144205 Ga0070666_101442052 338
135 3300005367 Ga0070667_100133605 Ga0070667_1001336052 338
136 3300005471 Ga0070698_100001279 Ga0070698_10000127914 338
137 3300005471 Ga0070698_100002592 Ga0070698_10000259213 338
138 3300005618 Ga0068864_100136915 Ga0068864_1001369152 338
139 3300006237 Ga0097621_100004097 Ga0097621_1000040976 338
140 3300006844 Ga0075428_100038235 Ga0075428_1000382352 338
141 3300009147 Ga0114129_10333505 Ga0114129_103335052 338
142 3300009176 Ga0105242_10029348 Ga0105242_100293482 338
143 3300009176 Ga0105242_10318496 Ga0105242_103184962 338
144 3300011119 Ga0105246_10037839 Ga0105246_100378393 338
145 3300013100 Ga0157373_10025384 Ga0157373_100253844 338
146 3300013104 Ga0157370_10063883 Ga0157370_100638834 338
147 3300013306 Ga0163162_10016117 Ga0163162_100161176 338
148 3300013307 Ga0157372_10474616 Ga0157372_104746162 338
149 3300014325 Ga0163163_10324883 Ga0163163_103248831 338
150 3300014497 Ga0182008_10000975 Ga0182008_1000097517 338
151 3300015261 Ga0182006_1000244 Ga0182006_100024425 338
152 3300025903 Ga0207680_10134619 Ga0207680_101346192 338
153 3300025934 Ga0207686_10000722 Ga0207686_1000072213 338
154 3300025961 Ga0207712_10279312 Ga0207712_102793122 338
155 3300025986 Ga0207658_10129946 Ga0207658_101299462 338
156 3300026088 Ga0207641_10000783 Ga0207641_1000078315 338
157 3300026095 Ga0207676_10108651 Ga0207676_101086512 338
158 3300027876 Ga0209974_10051586 Ga0209974_100515862 338
159 3300028786 Ga0307517_10001171 Ga0307517_100011717 338
160 3300028786 Ga0307517_10144687 Ga0307517_101446872 338
161 3300044673 Ga0453683_0073194 Ga0453683_0073194_916_1938 338
162 3300046539 Ga0495621_0014082 Ga0495621_0014082_646_1668 338
163 3300047320 Ga0495672_0022983 Ga0495672_0022983_2577_3593 338
164 3300048918 Ga0496115_0064676 Ga0496115_0064676_1542_2564 338
165 3300003320 rootH2_10001202 rootH2_1000120224 339
166 3300005290 Ga0065712_10069521 Ga0065712_100695213 339
167 3300005327 Ga0070658_10005285 Ga0070658_100052853 339
168 3300005329 Ga0070683_100002310 Ga0070683_10000231013 339
169 3300005331 Ga0070670_100050817 Ga0070670_1000508173 339
170 3300005331 Ga0070670_100107630 Ga0070670_1001076302 339
171 3300005333 Ga0070677_10072266 Ga0070677_100722661 339
172 3300005335 Ga0070666_10079539 Ga0070666_100795392 339
173 3300005337 Ga0070682_100060512 Ga0070682_1000605123 339
174 3300005338 Ga0068868_100284621 Ga0068868_1002846212 339
175 3300005339 Ga0070660_100141677 Ga0070660_1001416772 339
176 3300005344 Ga0070661_100052921 Ga0070661_1000529213 339
177 3300005353 Ga0070669_100025766 Ga0070669_1000257662 339
178 3300005354 Ga0070675_100074762 Ga0070675_1000747621 339
179 3300005354 Ga0070675_100095353 Ga0070675_1000953533 339
180 3300005355 Ga0070671_100186222 Ga0070671_1001862222 339
181 3300005364 Ga0070673_100038472 Ga0070673_1000384721 339
182 3300005364 Ga0070673_100256410 Ga0070673_1002564102 339
183 3300005366 Ga0070659_100001755 Ga0070659_1000017558 339
184 3300005366 Ga0070659_100036370 Ga0070659_1000363701 339
185 3300005438 Ga0070701_10049685 Ga0070701_100496851 339
186 3300005535 Ga0070684_100018210 Ga0070684_1000182103 339
187 3300005539 Ga0068853_100078283 Ga0068853_1000782831 339
188 3300005539 Ga0068853_100156744 Ga0068853_1001567442 339
189 3300005539 Ga0068853_100179005 Ga0068853_1001790052 339
190 3300005543 Ga0070672_100169287 Ga0070672_1001692872 339
191 3300005544 Ga0070686_100038249 Ga0070686_1000382492 339
192 3300005577 Ga0068857_100031441 Ga0068857_1000314415 339
193 3300005616 Ga0068852_100000424 Ga0068852_1000004243 339
194 3300005616 Ga0068852_100138386 Ga0068852_1001383862 339
195 3300005843 Ga0068860_100000252 Ga0068860_10000025242 339
196 3300005843 Ga0068860_100023111 Ga0068860_1000231114 339
197 3300009093 Ga0105240_10000431 Ga0105240_1000043118 339
198 3300009093 Ga0105240_10004355 Ga0105240_1000435514 339
199 3300009094 Ga0111539_10009272 Ga0111539_100092729 339
200 3300009174 Ga0105241_10002146 Ga0105241_100021465 339
201 3300009545 Ga0105237_10009667 Ga0105237_100096673 339
202 3300009545 Ga0105237_10040303 Ga0105237_100403032 339
203 3300009545 Ga0105237_10043497 Ga0105237_100434973 339
204 3300009551 Ga0105238_10001088 Ga0105238_1000108812 339
205 3300010375 Ga0105239_10002512 Ga0105239_1000251212 339
206 3300010375 Ga0105239_10148225 Ga0105239_101482253 339
207 3300013100 Ga0157373_10256164 Ga0157373_102561641 339
208 3300013102 Ga0157371_10002575 Ga0157371_1000257514 339
209 3300013104 Ga0157370_10002741 Ga0157370_100027415 339
210 3300013105 Ga0157369_10306246 Ga0157369_103062462 339
211 3300013296 Ga0157374_10025814 Ga0157374_100258143 339
212 3300013296 Ga0157374_10051285 Ga0157374_100512852 339
213 3300013296 Ga0157374_10232423 Ga0157374_102324232 339
214 3300013297 Ga0157378_10140148 Ga0157378_101401482 339
215 3300013306 Ga0163162_10000410 Ga0163162_100004102 339
216 3300014326 Ga0157380_10014693 Ga0157380_100146932 339
217 3300025893 Ga0207682_10072225 Ga0207682_100722252 339
218 3300025904 Ga0207647_10000017 Ga0207647_1000001772 339
219 3300025909 Ga0207705_10028650 Ga0207705_100286503 339
220 3300025913 Ga0207695_10001411 Ga0207695_1000141113 339
221 3300025913 Ga0207695_10012182 Ga0207695_100121823 339
222 3300025914 Ga0207671_10004781 Ga0207671_100047818 339
223 3300025914 Ga0207671_10065465 Ga0207671_100654652 339
224 3300025914 Ga0207671_10200790 Ga0207671_102007902 339
225 3300025920 Ga0207649_10153529 Ga0207649_101535292 339
226 3300025923 Ga0207681_10139526 Ga0207681_101395262 339
227 3300025925 Ga0207650_10081616 Ga0207650_100816162 339
228 3300025926 Ga0207659_10027806 Ga0207659_100278062 339
229 3300025936 Ga0207670_10142309 Ga0207670_101423091 339
230 3300025940 Ga0207691_10018396 Ga0207691_100183962 339
231 3300025940 Ga0207691_10198620 Ga0207691_101986202 339
232 3300025944 Ga0207661_10109042 Ga0207661_101090422 339
233 3300026023 Ga0207677_10319038 Ga0207677_103190381 339
234 3300026116 Ga0207674_10059731 Ga0207674_100597312 339
235 3300026142 Ga0207698_10011350 Ga0207698_100113505 339
236 3300026142 Ga0207698_10014452 Ga0207698_100144522 339
237 3300028381 Ga0268264_10000015 Ga0268264_10000015158 339
238 3300028381 Ga0268264_10000019 Ga0268264_10000019256 339
239 3300028381 Ga0268264_10000054 Ga0268264_10000054116 339
240 3300028381 Ga0268264_10028905 Ga0268264_100289053 339
241 3300031616 Ga0307508_10000162 Ga0307508_1000016214 339
242 3300031903 Ga0307407_10000009 Ga0307407_1000000969 339
243 3300032002 Ga0307416_100000019 Ga0307416_100000019126 339
244 3300032004 Ga0307414_10136337 Ga0307414_101363372 339
245 3300035113 Ga0373936_0047719 Ga0373936_0047719_290_1348 339
246 3300044712 Ga0453684_0072272 Ga0453684_0072272_510_1538 339
247 3300046460 Ga0495638_0044975 Ga0495638_0044975_1018_2043 339
248 3300046524 Ga0495648_0001051 Ga0495648_0001051_11978_13003 339
249 3300046616 Ga0495668_0003162 Ga0495668_0003162_8108_9139 339
250 3300049513 Ga0501290_001589 Ga0501290_001589_928_1959 339
251 3300049520 Ga0501297_000579 Ga0501297_000579_670_1701 339
252 3300049579 Ga0501043_0207902 Ga0501043_0207902_451_1479 339
253 3300049649 Ga0501198_002349 Ga0501198_002349_1479_2510 339
254 3300049652 Ga0501202_000356 Ga0501202_000356_2307_3338 339
255 3300049653 Ga0501206_001354 Ga0501206_001354_1094_2125 339
256 3300049661 Ga0501217_000636 Ga0501217_000636_3583_4614 339
257 3300049661 Ga0501217_007302 Ga0501217_007302_578_1603 339
258 3300049664 Ga0501224_000608 Ga0501224_000608_1989_3020 339
259 3300049669 Ga0501235_000430 Ga0501235_000430_4333_5364 339
260 3300049675 Ga0501243_000328 Ga0501243_000328_4023_5054 339
261 3300049683 Ga0501253_000404 Ga0501253_000404_1098_2129 339
262 3300049688 Ga0501259_000947 Ga0501259_000947_2620_3651 339
263 3300049690 Ga0501261_001046 Ga0501261_001046_1080_2111 339
264 3300049705 Ga0501225_0000892 Ga0501225_0000892_3835_4866 339
265 3300049707 Ga0501234_000801 Ga0501234_000801_3113_4144 339
266 3300049770 Ga0501273_004573 Ga0501273_004573_241_1272 339
267 3300050511 nmdc:mga08y16_199945_c1 nmdc:mga08y16_199945_c1_957_1979 339
268 3300053139 Ga0500568_0036638 Ga0500568_0036638_904_1929 339
269 3300053151 Ga0500604_0004170 Ga0500604_0004170_2385_3416 339
270 iso_pu_bacteria 2738543023 2739305194 339
271 3300002773 JGI25152J39213_1000111 JGI25152J39213_100011145 340
272 3300002774 JGI25150J39212_1000009 JGI25150J39212_1000009147 340
273 3300003187 JGI25151J46595_10000017 JGI25151J46595_10000017147 340
274 3300003215 JGI25153J46596_10000023 JGI25153J46596_1000002392 340
275 3300003316 rootH1_10043460 rootH1_100434606 340
276 3300003320 rootH2_10253432 rootH2_102534322 340
277 3300003323 rootH1_10023435 rootH1_100234355 340
278 3300003781 Ga0055536_1000003 Ga0055536_1000003352 340
279 3300003791 Ga0055530_10005502 Ga0055530_100055027 340
280 3300005288 Ga0065714_10012852 Ga0065714_100128521 340
281 3300005295 Ga0065707_10026134 Ga0065707_100261341 340
282 3300005340 Ga0070689_100016954 Ga0070689_1000169542 340
283 3300005354 Ga0070675_100257361 Ga0070675_1002573611 340
284 3300005365 Ga0070688_100127284 Ga0070688_1001272842 340
285 3300005457 Ga0070662_100047997 Ga0070662_1000479972 340
286 3300005563 Ga0068855_100040018 Ga0068855_1000400182 340
287 3300005614 Ga0068856_100024839 Ga0068856_1000248393 340
288 3300005617 Ga0068859_100436054 Ga0068859_1004360542 340
289 3300005618 Ga0068864_100100086 Ga0068864_1001000863 340
290 3300005719 Ga0068861_100024539 Ga0068861_1000245393 340
291 3300005983 Ga0081540_1008958 Ga0081540_10089583 340
292 3300006931 Ga0097620_100436033 Ga0097620_1004360332 340
293 3300009093 Ga0105240_10024925 Ga0105240_100249256 340
294 3300009093 Ga0105240_10242760 Ga0105240_102427602 340
295 3300009147 Ga0114129_10002037 Ga0114129_1000203716 340
296 3300009545 Ga0105237_10014339 Ga0105237_100143395 340
297 3300009545 Ga0105237_10078911 Ga0105237_100789113 340
298 3300009553 Ga0105249_10050324 Ga0105249_100503242 340
299 3300010375 Ga0105239_10001881 Ga0105239_1000188114 340
300 3300010375 Ga0105239_10012220 Ga0105239_100122203 340
301 3300013104 Ga0157370_10189139 Ga0157370_101891392 340
302 3300013104 Ga0157370_10192217 Ga0157370_101922172 340
303 3300013296 Ga0157374_10122966 Ga0157374_101229662 340
304 3300013307 Ga0157372_10002269 Ga0157372_100022692 340
305 3300014326 Ga0157380_10295421 Ga0157380_102954212 340
306 3300014745 Ga0157377_10001182 Ga0157377_100011823 340
307 3300015261 Ga0182006_1000646 Ga0182006_10006469 340
308 3300015682 Ga0183373_1010 Ga0183373_101028 340
309 3300017792 Ga0163161_10000468 Ga0163161_1000046810 340
310 3300017792 Ga0163161_10001705 Ga0163161_100017056 340
311 3300025245 Ga0207425_1000007 Ga0207425_1000007409 340
312 3300025258 Ga0209129_1000006 Ga0209129_1000006409 340
313 3300025292 Ga0209676_1000001 Ga0209676_1000001686 340
314 3300025294 Ga0209025_1000025 Ga0209025_1000025239 340
315 3300025297 Ga0209758_1000016 Ga0209758_1000016409 340
316 3300025298 Ga0209050_1000016 Ga0209050_1000016351 340
317 3300025908 Ga0207643_10003479 Ga0207643_100034796 340
318 3300025913 Ga0207695_10070785 Ga0207695_100707853 340
319 3300025913 Ga0207695_10091226 Ga0207695_100912262 340
320 3300025914 Ga0207671_10017316 Ga0207671_100173164 340
321 3300025914 Ga0207671_10070076 Ga0207671_100700763 340
322 3300025926 Ga0207659_10137444 Ga0207659_101374442 340
323 3300025933 Ga0207706_10011729 Ga0207706_100117293 340
324 3300025949 Ga0207667_10022507 Ga0207667_100225075 340
325 3300025960 Ga0207651_10015187 Ga0207651_100151872 340
326 3300025981 Ga0207640_10066873 Ga0207640_100668732 340
327 3300026078 Ga0207702_10211699 Ga0207702_102116992 340
328 3300026118 Ga0207675_100005681 Ga0207675_1000056818 340
329 3300031456 Ga0307513_10138558 Ga0307513_101385582 340
330 3300041404 Ga0439436_0005395 Ga0439436_0005395_1710_2732 340
331 3300041459 Ga0451800_1238597 Ga0451800_1238597_48_1070 340
332 3300042002 Ga0439442_003910 Ga0439442_003910_733_1779 340
333 3300042007 Ga0439449_0008697 Ga0439449_0008697_2364_3386 340
334 3300042015 Ga0439462_0005705 Ga0439462_0005705_1202_2224 340
335 3300042435 Ga0439434_0021436 Ga0439434_0021436_859_1905 340
336 3300044658 Ga0466972_0000032 Ga0466972_0000032_143781_144803 340
337 3300044658 Ga0466972_0077574 Ga0466972_0077574_327_1349 340
338 3300046512 Ga0495610_0012275 Ga0495610_0012275_2733_3758 340
339 3300049569 Ga0501032_0042507 Ga0501032_0042507_913_1941 340
340 3300049571 Ga0501034_0020155 Ga0501034_0020155_218_1246 340
341 3300049572 Ga0501036_0031255 Ga0501036_0031255_1215_2243 340
342 3300049574 Ga0501038_0050071 Ga0501038_0050071_1777_2805 340
343 3300049575 Ga0501039_0049397 Ga0501039_0049397_1940_2968 340
344 3300049579 Ga0501043_0010222 Ga0501043_0010222_588_1616 340
345 3300049580 Ga0501046_0048001 Ga0501046_0048001_634_1662 340
346 3300049581 Ga0501047_0009295 Ga0501047_0009295_6740_7768 340
347 3300049581 Ga0501047_0029171 Ga0501047_0029171_610_1632 340
348 3300049581 Ga0501047_0042976 Ga0501047_0042976_1130_2152 340
349 3300049582 Ga0501048_0017746 Ga0501048_0017746_1098_2126 340
350 3300049586 Ga0501070_0055996 Ga0501070_0055996_1354_2382 340
351 3300049589 Ga0501073_0006622 Ga0501073_0006622_346_1374 340
352 3300049590 Ga0501074_0002982 Ga0501074_0002982_7218_8246 340
353 3300049669 Ga0501235_025022 Ga0501235_025022_170_1192 340
354 3300049705 Ga0501225_0001221 Ga0501225_0001221_2682_3704 340
355 3300049744 Ga0501083_0037414 Ga0501083_0037414_1794_2822 340
356 3300049758 Ga0501241_007505 Ga0501241_007505_151_1197 340
357 3300049822 Ga0501035_0007679 Ga0501035_0007679_2585_3613 340
358 3300049823 Ga0501044_0013869 Ga0501044_0013869_2324_3346 340
359 3300049823 Ga0501044_0055923 Ga0501044_0055923_978_2006 340
360 3300049824 Ga0501045_0116003 Ga0501045_0116003_205_1233 340
361 3300050005 Ga0501284_00015 Ga0501284_00015_89630_90676 340
362 3300050493 nmdc:mga0k408_21233_c1 nmdc:mga0k408_21233_c1_2038_3060 340
363 3300050507 nmdc:mga05p37_1846_c2 nmdc:mga05p37_1846_c2_14748_15770 340
364 3300053086 Ga0500578_0000001 Ga0500578_0000001_298324_299346 340
365 3300053086 Ga0500578_0061856 Ga0500578_0061856_557_1579 340
366 3300053092 Ga0500583_0000048 Ga0500583_0000048_50359_51381 340
367 3300053092 Ga0500583_0000388 Ga0500583_0000388_5826_6848 340
368 3300053178 Ga0500637_0011158 Ga0500637_0011158_214_1254 340
369 3300053739 Ga0500587_008976 Ga0500587_008976_52_1074 340
370 3300060353 Ga0501082_0241808 Ga0501082_0241808_239_1267 340
371 iso_pu_bacteria 2738541283 2738759708 340
372 3300005331 Ga0070670_100047428 Ga0070670_1000474282 341
373 3300005367 Ga0070667_100146045 Ga0070667_1001460452 341
374 3300005456 Ga0070678_100012996 Ga0070678_1000129962 341
375 3300005577 Ga0068857_100323658 Ga0068857_1003236582 341
376 3300005842 Ga0068858_100173690 Ga0068858_1001736902 341
377 3300006237 Ga0097621_100002450 Ga0097621_1000024504 341
378 3300006358 Ga0068871_100001412 Ga0068871_1000014123 341
379 3300006358 Ga0068871_100013603 Ga0068871_1000136034 341
380 3300009093 Ga0105240_10001434 Ga0105240_1000143429 341
381 3300009553 Ga0105249_10002214 Ga0105249_100022141 341
382 3300009553 Ga0105249_10007217 Ga0105249_100072177 341
383 3300013102 Ga0157371_10064551 Ga0157371_100645513 341
384 3300013104 Ga0157370_10006838 Ga0157370_100068389 341
385 3300013297 Ga0157378_10019172 Ga0157378_100191724 341
386 3300013306 Ga0163162_10000994 Ga0163162_1000099413 341
387 3300013306 Ga0163162_10002190 Ga0163162_100021903 341
388 3300013306 Ga0163162_10033988 Ga0163162_100339881 341
389 3300013306 Ga0163162_10133741 Ga0163162_101337412 341
390 3300013308 Ga0157375_10017191 Ga0157375_100171913 341
391 3300013308 Ga0157375_10027858 Ga0157375_100278581 341
392 3300014325 Ga0163163_10168596 Ga0163163_101685961 341
393 3300014968 Ga0157379_10014882 Ga0157379_100148823 341
394 3300014968 Ga0157379_10019062 Ga0157379_100190623 341
395 3300014969 Ga0157376_10000404 Ga0157376_1000040413 341
396 3300014969 Ga0157376_10078856 Ga0157376_100788561 341
397 3300014969 Ga0157376_10281280 Ga0157376_102812802 341
398 3300017792 Ga0163161_10005954 Ga0163161_100059548 341
399 3300017792 Ga0163161_10021017 Ga0163161_100210172 341
400 3300025911 Ga0207654_10040557 Ga0207654_100405572 341
401 3300025941 Ga0207711_10046034 Ga0207711_100460342 341
402 3300025949 Ga0207667_10125408 Ga0207667_101254082 341
403 3300025961 Ga0207712_10029647 Ga0207712_100296472 341
404 3300025986 Ga0207658_10040812 Ga0207658_100408123 341
405 3300026035 Ga0207703_10142123 Ga0207703_101421232 341
406 3300026116 Ga0207674_10106446 Ga0207674_101064463 341
407 3300026121 Ga0207683_10015154 Ga0207683_100151545 341
408 3300044656 Ga0466969_0000987 Ga0466969_0000987_1400_2437 341
409 3300044684 Ga0466966_0000054 Ga0466966_0000054_35163_36200 341
410 3300045049 Ga0466959_0000012 Ga0466959_0000012_106014_107051 341
411 3300046517 Ga0495630_0073510 Ga0495630_0073510_636_1667 341
412 3300046691 Ga0495670_0025666 Ga0495670_0025666_1197_2228 341
413 3300048907 Ga0496104_0343300 Ga0496104_0343300_259_1344 341
414 3300049582 Ga0501048_0150201 Ga0501048_0150201_118_1152 341
415 3300049586 Ga0501070_0143569 Ga0501070_0143569_53_1087 341
416 3300049744 Ga0501083_0068334 Ga0501083_0068334_1183_2217 341
417 3300054114 Ga0501084_0034032 Ga0501084_0034032_1424_2458 341
418 3300060353 Ga0501082_0046766 Ga0501082_0046766_1634_2668 341
419 3300031507 Ga0307509_10155272 Ga0307509_101552722 342
420 iso_pu_bacteria 2775506987 2776613354 342
421 3300005337 Ga0070682_100000005 Ga0070682_10000000574 343
422 3300005544 Ga0070686_100295105 Ga0070686_1002951051 343
423 3300013297 Ga0157378_10462901 Ga0157378_104629011 343
424 3300044842 Ga0466957_0000656 Ga0466957_0000656_1972_3003 343
425 3300046660 Ga0495625_0089322 Ga0495625_0089322_225_1292 343
426 3300009545 Ga0105237_10024976 Ga0105237_100249765 344
427 3300013104 Ga0157370_10002625 Ga0157370_100026259 344
428 3300015261 Ga0182006_1005799 Ga0182006_10057993 344
429 3300017792 Ga0163161_10008720 Ga0163161_100087206 344
430 3300025914 Ga0207671_10039435 Ga0207671_100394351 344
431 3300048925 Ga0496122_0000765 Ga0496122_0000765_45354_46394 344
432 3300048926 Ga0496123_0005845 Ga0496123_0005845_2579_3619 344
433 3300005577 Ga0068857_100003231 Ga0068857_1000032313 345
434 3300005578 Ga0068854_100003818 Ga0068854_1000038188 345
435 3300009093 Ga0105240_10020767 Ga0105240_100207674 345
436 3300009093 Ga0105240_10257180 Ga0105240_102571801 345
437 3300009545 Ga0105237_10002049 Ga0105237_1000204911 345
438 3300009551 Ga0105238_10013492 Ga0105238_100134925 345
439 3300013104 Ga0157370_10024877 Ga0157370_100248773 345
440 3300013105 Ga0157369_10017716 Ga0157369_100177166 345
441 3300013307 Ga0157372_10000294 Ga0157372_100002942 345
442 3300025904 Ga0207647_10078666 Ga0207647_100786662 345
443 3300025913 Ga0207695_10054985 Ga0207695_100549852 345
444 3300025924 Ga0207694_10015366 Ga0207694_100153664 345
445 3300025949 Ga0207667_10000403 Ga0207667_1000040340 345
446 3300026041 Ga0207639_10411400 Ga0207639_104114001 345
447 3300026116 Ga0207674_10000600 Ga0207674_100006008 345
448 3300026142 Ga0207698_10003680 Ga0207698_100036807 345
449 2162886007 SwRhRL2b_contig_2932149 SwRhRL2b_0311.00002390 346
450 3300005288 Ga0065714_10002765 Ga0065714_1000276546 346
451 3300005289 Ga0065704_10000288 Ga0065704_1000028858 346
452 3300005289 Ga0065704_10071650 Ga0065704_100716506 346
453 3300013100 Ga0157373_10000043 Ga0157373_1000004328 346
454 3300013102 Ga0157371_10002166 Ga0157371_100021667 346
455 3300013102 Ga0157371_10006167 Ga0157371_100061676 346
456 3300013104 Ga0157370_10117732 Ga0157370_101177321 346
457 3300015261 Ga0182006_1007537 Ga0182006_10075374 346
458 3300031911 Ga0307412_10000075 Ga0307412_1000007556 346
459 3300032004 Ga0307414_10001789 Ga0307414_100017897 346
460 3300049758 Ga0501241_008381 Ga0501241_008381_298_1338 346
461 3300053093 Ga0500651_0002187 Ga0500651_0002187_8917_9957 346

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02016

Peptidase_S66

LD-carboxypeptidase N-terminal domain

50

166

0.95

PF17676

Peptidase_S66C

LD-carboxypeptidase C-terminal domain

216

333

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uuk-assembly1.cif.gz_B crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes 0.9216 51 345
6uuk-assembly1.cif.gz_B crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes 0.9005 51 345
6uuk-assembly1.cif.gz_A crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes 0.8993 53 345
6uuk-assembly1.cif.gz_A crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes 0.8814 53 345
5z01-assembly1.cif.gz_A-2 native escherichia coli l,d-carboxypeptidase a (ldca) 0.8813 49 345
ID Description Score Start End Superfamily
af_P76008_161_291_3.50.30.60 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like 0.9234 211 335 3.50.30.60
4h1hB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.8962 41 196 3.40.50.10740
1zrsA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.8832 35 201 3.40.50.10740
af_P76008_161_291_3.50.30.60 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like 0.8704 211 335 3.50.30.60
1zl0A02 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like 0.8686 211 343 3.50.30.60
ID Description Score Start End GO Terms
AF-A0A3C1T835-F1-model_v4 LD-carboxypeptidase 0.9955 40 346 GO:0004180
GO:0006508
GO:0008236
AF-A0A519YKH2-F1-model_v4 LD-carboxypeptidase N-terminal domain-containing protein 0.9942 43 144
AF-A0A4Q3TJZ9-F1-model_v4 deleted 0.9934 86 346
AF-A0A4Q3ATW3-F1-model_v4 LD-carboxypeptidase 0.9912 206 346 GO:0004180
GO:0006508
GO:0008236
AF-A0A3C1NNW9-F1-model_v4 LD-carboxypeptidase 0.991 165 346 GO:0004180
GO:0006508
GO:0008236

Feature Viewer

pLDDT pTM Quality
89.57 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map