F448664

General Info

Members Datasets Scaffolds Average Seq Length
461 206 922 321

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10089685|rootL2_100896855
Length 356
Sequence MRTVSASQRFGQSDFRHPISSGDCIMLAHSQGRSAMKTLRRLHPILCLVGLLLMSGLANAQPPAQNGDGNSSSRGPGKPVTIPLTIRTGSDREVPELQNIDLIVSEDGEPQQILSIRAVGTNSPITLAVLIQDDLVPSVANEIKPLAAFIRGLPKNSRVMIGYLRTGSLQVKQKFTNDLEKAANSLRPPSGFASVGPYNPYVEVVEALRKFDAQPLGRRAILLVSDGLDISRGVDSSGPTQSVDLQRAVNESQRRGVAIYGFYSPTFASAANRSLAGNAQSSLLRLSNETGGLAFFQGTGAPVSFEPFIRELDVSLEKQAALTFLSTHLNKGFHKIEVKSATPGVRIAFPSGYVRQ

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
4 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
161 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
168 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
169 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
180 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
181 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
185 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
186 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
187 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
188 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
189 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
190 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
191 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
192 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
193 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
194 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
195 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
196 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
197 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
198 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
199 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 0.87
Rhizosphere 98.26
Stem 0
Stem Tuber 0
Unclassified 18.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10089685 3300003322 Bacteria 6450
2 MBSR1b_contig_13447674 2162886012 Unclassified 1202
3 MBSR1b_contig_492026 2162886012 Unclassified 1198
4 CNBas_1000314 3300000531 Bacteria 1969
5 CNAas_1000004 3300000532 Bacteria 14982
6 JGI24751J29686_10000017 3300002459 Bacteria 109415
7 JGI24751J29686_10000149 3300002459 Bacteria 33687
8 JGI25406J46586_10014972 3300003203 Unclassified 3282
9 Ga0065714_10064460 3300005288 Bacteria 66400
10 Ga0065704_10083950 3300005289 Bacteria 3397
11 Ga0065704_10118959 3300005289 Bacteria 1808
12 Ga0065712_10068069 3300005290 Bacteria 15521
13 Ga0065715_10028452 3300005293 Bacteria 1598
14 Ga0065715_10089839 3300005293 Bacteria 8355
15 Ga0065715_10095392 3300005293 Bacteria 4095
16 Ga0065715_10117551 3300005293 Bacteria 2344
17 Ga0065715_10131647 3300005293 Bacteria 1975
18 Ga0065715_10209969 3300005293 Bacteria 1319
19 Ga0065707_10010856 3300005295 Bacteria 2354
20 Ga0070676_10032637 3300005328 Bacteria 2984
21 Ga0070683_100151571 3300005329 Bacteria 2198
22 Ga0070690_100037425 3300005330 Bacteria 3057
23 Ga0070690_100165310 3300005330 Bacteria 1519
24 Ga0070670_100005375 3300005331 Bacteria 10812
25 Ga0070670_100085719 3300005331 Bacteria 2706
26 Ga0070670_100339090 3300005331 Unclassified 1319
27 Ga0070670_100504335 3300005331 Unclassified 1076
28 Ga0068869_100007551 3300005334 Bacteria 6960
29 Ga0068869_100049836 3300005334 Bacteria 3033
30 Ga0070666_10179611 3300005335 Bacteria 1484
31 Ga0070680_100013569 3300005336 Bacteria 6350
32 Ga0070680_100057291 3300005336 Bacteria 3186
33 Ga0070680_100122236 3300005336 Unclassified 2174
34 Ga0070680_100166982 3300005336 Bacteria 1851
35 Ga0070682_100012254 3300005337 Bacteria 4910
36 Ga0070682_100093931 3300005337 Bacteria 1967
37 Ga0068868_100007808 3300005338 Bacteria 7637
38 Ga0068868_100271763 3300005338 Bacteria 1432
39 Ga0070660_100087521 3300005339 Bacteria 2452
40 Ga0070689_100002993 3300005340 Bacteria 11113
41 Ga0070691_10160028 3300005341 Unclassified 1160
42 Ga0070687_100014088 3300005343 Bacteria 3583
43 Ga0070687_100023965 3300005343 Bacteria 2907
44 Ga0070692_10006058 3300005345 Bacteria 5218
45 Ga0070692_10010290 3300005345 Bacteria 4251
46 Ga0070669_100010477 3300005353 Bacteria 6584
47 Ga0070675_100256469 3300005354 Bacteria 1532
48 Ga0070671_100002480 3300005355 Bacteria 14270
49 Ga0070671_100045419 3300005355 Bacteria 3652
50 Ga0070671_100153493 3300005355 Bacteria 1945
51 Ga0070674_100319918 3300005356 Bacteria 1243
52 Ga0070673_100209221 3300005364 Bacteria 1684
53 Ga0070659_100039290 3300005366 Unclassified 3694
54 Ga0070659_100128321 3300005366 Bacteria 2058
55 Ga0070667_100021151 3300005367 Bacteria 5405
56 Ga0070667_100163170 3300005367 Bacteria 1964
57 Ga0070703_10002189 3300005406 Bacteria 5684
58 Ga0070701_10008309 3300005438 Bacteria 4484
59 Ga0070701_10014106 3300005438 Bacteria 3655
60 Ga0070701_10065518 3300005438 Unclassified 1928
61 Ga0070701_10091912 3300005438 Bacteria 1664
62 Ga0070705_100004752 3300005440 Bacteria 6613
63 Ga0070705_100107057 3300005440 Bacteria 1778
64 Ga0070705_100147274 3300005440 Bacteria 1557
65 Ga0070700_100000964 3300005441 Bacteria 14218
66 Ga0070700_100102062 3300005441 Bacteria 1891
67 Ga0070700_100161480 3300005441 Bacteria 1543
68 Ga0070694_100043726 3300005444 Bacteria 2996
69 Ga0070694_100058270 3300005444 Bacteria 2627
70 Ga0070694_100096618 3300005444 Bacteria 2083
71 Ga0070694_100123883 3300005444 Bacteria 1858
72 Ga0070694_100135574 3300005444 Bacteria 1783
73 Ga0070694_100147570 3300005444 Unclassified 1714
74 Ga0070694_100170141 3300005444 Bacteria 1604
75 Ga0070708_100000508 3300005445 Bacteria 29318
76 Ga0070708_100022495 3300005445 Bacteria 5348
77 Ga0070708_100153039 3300005445 Bacteria 2146
78 Ga0070708_100272762 3300005445 Bacteria 1591
79 Ga0070708_100280968 3300005445 Unclassified 1567
80 Ga0070678_100325692 3300005456 Bacteria 1313
81 Ga0070662_100085451 3300005457 Bacteria 2358
82 Ga0070681_10000489 3300005458 Bacteria 32333
83 Ga0070681_10046425 3300005458 Bacteria 4343
84 Ga0070681_10047995 3300005458 Bacteria 4267
85 Ga0070681_10072586 3300005458 Unclassified 3404
86 Ga0070681_10231787 3300005458 Unclassified 1761
87 Ga0068867_100014896 3300005459 Bacteria 5510
88 Ga0070706_100000088 3300005467 Bacteria 107818
89 Ga0070706_100009738 3300005467 Bacteria 8930
90 Ga0070706_100070901 3300005467 Bacteria 3223
91 Ga0070707_100102815 3300005468 Bacteria 2768
92 Ga0070707_100116288 3300005468 Bacteria 2596
93 Ga0070707_100199754 3300005468 Bacteria 1949
94 Ga0070698_100002826 3300005471 Bacteria 19105
95 Ga0070698_100027844 3300005471 Bacteria 5872
96 Ga0070698_100031002 3300005471 Bacteria 5544
97 Ga0070698_100212505 3300005471 Bacteria 1868
98 Ga0070699_100001427 3300005518 Bacteria 21970
99 Ga0070699_100017437 3300005518 Bacteria 6164
100 Ga0070699_100103113 3300005518 Bacteria 2501
101 Ga0070679_100000604 3300005530 Bacteria 30555
102 Ga0070679_100143251 3300005530 Bacteria 2368
103 Ga0070684_100257437 3300005535 Bacteria 1596
104 Ga0070697_100009364 3300005536 Bacteria 7653
105 Ga0070697_100116504 3300005536 Bacteria 2231
106 Ga0070697_100325783 3300005536 Bacteria 1323
107 Ga0068853_100075885 3300005539 Bacteria 2934
108 Ga0068853_100104662 3300005539 Bacteria 2506
109 Ga0068853_100216260 3300005539 Bacteria 1748
110 Ga0068853_100296633 3300005539 Bacteria 1493
111 Ga0070672_100047637 3300005543 Bacteria 3327
112 Ga0070672_100245730 3300005543 Unclassified 1506
113 Ga0070686_100001026 3300005544 Bacteria 16055
114 Ga0070686_100056067 3300005544 Bacteria 2526
115 Ga0070695_100020677 3300005545 Bacteria 4020
116 Ga0070695_100074279 3300005545 Bacteria 2234
117 Ga0070695_100188451 3300005545 Bacteria 1466
118 Ga0070696_100035292 3300005546 Unclassified 3442
119 Ga0070696_100069921 3300005546 Unclassified 2468
120 Ga0070696_100074135 3300005546 Bacteria 2399
121 Ga0070693_100004578 3300005547 Bacteria 6560
122 Ga0070693_100005407 3300005547 Bacteria 6128
123 Ga0070693_100083470 3300005547 Bacteria 1910
124 Ga0070693_100145608 3300005547 Bacteria 1496
125 Ga0070693_100171149 3300005547 Bacteria 1391
126 Ga0070704_100037629 3300005549 Bacteria 3308
127 Ga0070704_100072040 3300005549 Bacteria 2513
128 Ga0070704_100082246 3300005549 Bacteria 2374
129 Ga0070704_100118011 3300005549 Unclassified 2032
130 Ga0070664_100003375 3300005564 Bacteria 12898
131 Ga0068857_100012945 3300005577 Bacteria 7269
132 Ga0068857_100113116 3300005577 Bacteria 2440
133 Ga0068857_100131800 3300005577 Bacteria 2255
134 Ga0068857_100373861 3300005577 Unclassified 1322
135 Ga0070702_100060215 3300005615 Bacteria 2207
136 Ga0070702_100170687 3300005615 Bacteria 1414
137 Ga0068859_100002739 3300005617 Bacteria 17881
138 Ga0068859_100046093 3300005617 Bacteria 4379
139 Ga0068859_100093048 3300005617 Bacteria 3066
140 Ga0068859_100110623 3300005617 Bacteria 2809
141 Ga0068859_100121851 3300005617 Bacteria 2674
142 Ga0068859_100138053 3300005617 Unclassified 2511
143 Ga0068859_100207090 3300005617 Bacteria 2047
144 Ga0068859_100283215 3300005617 Unclassified 1750
145 Ga0068859_100347119 3300005617 Bacteria 1579
146 Ga0068859_100379771 3300005617 Unclassified 1508
147 Ga0068864_100042336 3300005618 Unclassified 3897
148 Ga0068864_100065888 3300005618 Bacteria 3142
149 Ga0068864_100078778 3300005618 Unclassified 2884
150 Ga0068864_100124254 3300005618 Bacteria 2311
151 Ga0068864_100169193 3300005618 Bacteria 1991
152 Ga0068864_100171675 3300005618 Unclassified 1977
153 Ga0068861_100017567 3300005719 Bacteria 5082
154 Ga0068861_100127543 3300005719 Unclassified 2061
155 Ga0068861_100312266 3300005719 Unclassified 1366
156 Ga0068851_10059050 3300005834 Bacteria 1962
157 Ga0068870_10008350 3300005840 Bacteria 4656
158 Ga0068870_10027938 3300005840 Unclassified 2827
159 Ga0068870_10115797 3300005840 Bacteria 1537
160 Ga0068870_10162526 3300005840 Unclassified 1325
161 Ga0068863_100018044 3300005841 Bacteria 6756
162 Ga0068863_100189818 3300005841 Bacteria 1974
163 Ga0068863_100294821 3300005841 Unclassified 1572
164 Ga0068858_100185364 3300005842 Bacteria 1966
165 Ga0068860_100004210 3300005843 Bacteria 14745
166 Ga0068860_100030469 3300005843 Bacteria 5188
167 Ga0068860_100053875 3300005843 Unclassified 3824
168 Ga0068860_100072351 3300005843 Bacteria 3276
169 Ga0068860_100079833 3300005843 Bacteria 3111
170 Ga0068860_100114891 3300005843 Bacteria 2574
171 Ga0068860_100193004 3300005843 Bacteria 1971
172 Ga0068860_100273083 3300005843 Unclassified 1650
173 Ga0068860_100405958 3300005843 Bacteria 1348
174 Ga0068860_100665219 3300005843 Bacteria 1050
175 Ga0068862_100075730 3300005844 Bacteria 2911
176 Ga0068862_100104602 3300005844 Bacteria 2480
177 Ga0068862_100111498 3300005844 Unclassified 2402
178 Ga0081539_10000043 3300005985 Bacteria 288108
179 Ga0081539_10005869 3300005985 Bacteria 12167
180 Ga0097621_100001685 3300006237 Bacteria 15122
181 Ga0097621_100088346 3300006237 Bacteria 2589
182 Ga0068871_100006022 3300006358 Bacteria 8535
183 Ga0068871_100015503 3300006358 Bacteria 5706
184 Ga0068871_100028784 3300006358 Bacteria 4359
185 Ga0075431_100064005 3300006847 Bacteria 3796
186 Ga0075431_100131761 3300006847 Bacteria 2578
187 Ga0075433_10020255 3300006852 Bacteria 5558
188 Ga0075433_10022972 3300006852 Bacteria 5243
189 Ga0075434_100032647 3300006871 Bacteria 5135
190 Ga0075434_100150631 3300006871 Bacteria 2346
191 Ga0075434_100417145 3300006871 Unclassified 1363
192 Ga0075429_100072291 3300006880 Bacteria 3004
193 Ga0075429_100109852 3300006880 Bacteria 2411
194 Ga0068865_100130776 3300006881 Bacteria 1880
195 Ga0075436_100041994 3300006914 Bacteria 3154
196 Ga0097620_100002739 3300006931 Bacteria 17881
197 Ga0097620_100046093 3300006931 Bacteria 4379
198 Ga0097620_100093051 3300006931 Bacteria 3066
199 Ga0097620_100110619 3300006931 Bacteria 2809
200 Ga0097620_100121856 3300006931 Bacteria 2674
201 Ga0097620_100138047 3300006931 Unclassified 2511
202 Ga0097620_100207100 3300006931 Bacteria 2047
203 Ga0097620_100283230 3300006931 Unclassified 1750
204 Ga0097620_100347108 3300006931 Bacteria 1579
205 Ga0097620_100379749 3300006931 Unclassified 1508
206 Ga0075435_100003678 3300007076 Bacteria 10443
207 Ga0075435_100117894 3300007076 Bacteria 2212
208 Ga0111539_10012727 3300009094 Bacteria 10536
209 Ga0111539_10024482 3300009094 Bacteria 7405
210 Ga0105245_10539677 3300009098 Unclassified 1187
211 Ga0105247_10000592 3300009101 Bacteria 29439
212 Ga0105247_10085393 3300009101 Bacteria 1996
213 Ga0105247_10089947 3300009101 Bacteria 1947
214 Ga0105247_10191004 3300009101 Unclassified 1371
215 Ga0114129_10030857 3300009147 Bacteria 7580
216 Ga0114129_10063314 3300009147 Bacteria 5165
217 Ga0114129_10103825 3300009147 Bacteria 3929
218 Ga0114129_10328202 3300009147 Bacteria 2032
219 Ga0114129_10354022 3300009147 Bacteria 1944
220 Ga0114129_10678384 3300009147 Unclassified 1327
221 Ga0105243_10068303 3300009148 Bacteria 2864
222 Ga0105243_10086783 3300009148 Bacteria 2567
223 Ga0105243_10227077 3300009148 Bacteria 1654
224 Ga0105241_10055499 3300009174 Bacteria 3035
225 Ga0105241_10109573 3300009174 Bacteria 2208
226 Ga0105241_10204210 3300009174 Unclassified 1652
227 Ga0105241_10237460 3300009174 Bacteria 1539
228 Ga0105241_10466383 3300009174 Bacteria 1120
229 Ga0105242_10007429 3300009176 Bacteria 8437
230 Ga0105242_10466293 3300009176 Bacteria 1194
231 Ga0105242_10498206 3300009176 Bacteria 1158
232 Ga0105248_10004879 3300009177 Bacteria 14830
233 Ga0105248_10006056 3300009177 Bacteria 13274
234 Ga0105248_10017237 3300009177 Bacteria 7959
235 Ga0105248_10057421 3300009177 Bacteria 4369
236 Ga0105248_10146328 3300009177 Unclassified 2666
237 Ga0105248_10255889 3300009177 Bacteria 1971
238 Ga0105237_10008903 3300009545 Bacteria 10815
239 Ga0105237_10015838 3300009545 Bacteria 7842
240 Ga0105238_10007632 3300009551 Bacteria 10835
241 Ga0105238_10027606 3300009551 Bacteria 5785
242 Ga0105249_10007021 3300009553 Bacteria 9829
243 Ga0105249_10056201 3300009553 Bacteria 3603
244 Ga0105249_10219725 3300009553 Bacteria 1869
245 Ga0105239_10098779 3300010375 Bacteria 3227
246 Ga0105246_10094253 3300011119 Bacteria 2165
247 Ga0105246_10253193 3300011119 Unclassified 1399
248 Ga0157373_10002883 3300013100 Bacteria 13006
249 Ga0157373_10008292 3300013100 Bacteria 7720
250 Ga0157373_10138029 3300013100 Bacteria 1714
251 Ga0157371_10197523 3300013102 Bacteria 1441
252 Ga0157374_10023940 3300013296 Bacteria 5469
253 Ga0157374_10026890 3300013296 Bacteria 5182
254 Ga0157378_10001968 3300013297 Bacteria 18403
255 Ga0157378_10134439 3300013297 Bacteria 2292
256 Ga0157378_10149954 3300013297 Bacteria 2172
257 Ga0157378_10301574 3300013297 Unclassified 1551
258 Ga0163162_10002437 3300013306 Bacteria 17536
259 Ga0163162_10011708 3300013306 Bacteria 8555
260 Ga0163162_10012021 3300013306 Bacteria 8441
261 Ga0163162_10162770 3300013306 Bacteria 2353
262 Ga0163162_10237280 3300013306 Bacteria 1954
263 Ga0163162_10451360 3300013306 Unclassified 1418
264 Ga0163162_10696714 3300013306 Unclassified 1137
265 Ga0157372_10001564 3300013307 Bacteria 24928
266 Ga0157372_10113138 3300013307 Bacteria 3111
267 Ga0157375_10047825 3300013308 Bacteria 4179
268 Ga0157375_10215959 3300013308 Bacteria 2076
269 Ga0163163_10000862 3300014325 Bacteria 25852
270 Ga0163163_10058608 3300014325 Bacteria 3808
271 Ga0163163_10062838 3300014325 Bacteria 3680
272 Ga0163163_10067723 3300014325 Unclassified 3550
273 Ga0163163_10241251 3300014325 Bacteria 1857
274 Ga0157380_10072771 3300014326 Bacteria 2785
275 Ga0157380_10315847 3300014326 Bacteria 1446
276 Ga0157377_10175694 3300014745 Bacteria 1343
277 Ga0163161_10015460 3300017792 Bacteria 5320
278 Ga0213876_10000102 3300021384 Bacteria 94958
279 Ga0207710_10001166 3300025900 Bacteria 13372
280 Ga0207710_10070938 3300025900 Bacteria 1597
281 Ga0207680_10116217 3300025903 Bacteria 1743
282 Ga0207647_10000385 3300025904 Bacteria 35983
283 Ga0207647_10048111 3300025904 Bacteria 2649
284 Ga0207647_10239932 3300025904 Unclassified 1041
285 Ga0207643_10042107 3300025908 Unclassified 2574
286 Ga0207643_10079908 3300025908 Bacteria 1893
287 Ga0207684_10000131 3300025910 Bacteria 137508
288 Ga0207684_10032227 3300025910 Bacteria 4457
289 Ga0207654_10022993 3300025911 Bacteria 3334
290 Ga0207707_10000017 3300025912 Bacteria 237068
291 Ga0207707_10004243 3300025912 Bacteria 12691
292 Ga0207707_10109843 3300025912 Bacteria 2410
293 Ga0207707_10366243 3300025912 Unclassified 1240
294 Ga0207671_10099924 3300025914 Bacteria 2196
295 Ga0207671_10148293 3300025914 Bacteria 1811
296 Ga0207671_10161583 3300025914 Bacteria 1735
297 Ga0207660_10094974 3300025917 Unclassified 2217
298 Ga0207662_10005692 3300025918 Bacteria 6667
299 Ga0207662_10023437 3300025918 Bacteria 3546
300 Ga0207662_10080412 3300025918 Bacteria 1988
301 Ga0207652_10000335 3300025921 Bacteria 48903
302 Ga0207652_10074357 3300025921 Bacteria 2959
303 Ga0207652_10114949 3300025921 Bacteria 2390
304 Ga0207681_10044905 3300025923 Bacteria 2963
305 Ga0207694_10049440 3300025924 Bacteria 3255
306 Ga0207694_10076122 3300025924 Bacteria 2628
307 Ga0207694_10484841 3300025924 Unclassified 1034
308 Ga0207650_10000005 3300025925 Bacteria 663190
309 Ga0207650_10063251 3300025925 Bacteria 2766
310 Ga0207650_10163632 3300025925 Bacteria 1764
311 Ga0207650_10302083 3300025925 Unclassified 1307
312 Ga0207650_10431313 3300025925 Unclassified 1095
313 Ga0207659_10254107 3300025926 Unclassified 1427
314 Ga0207687_10080623 3300025927 Bacteria 2350
315 Ga0207644_10030944 3300025931 Bacteria 3726
316 Ga0207644_10100032 3300025931 Bacteria 2177
317 Ga0207690_10013967 3300025932 Bacteria 4839
318 Ga0207690_10056799 3300025932 Bacteria 2642
319 Ga0207706_10044092 3300025933 Bacteria 3953
320 Ga0207686_10010343 3300025934 Bacteria 5078
321 Ga0207686_10017843 3300025934 Unclassified 4006
322 Ga0207686_10255987 3300025934 Bacteria 1281
323 Ga0207686_10332250 3300025934 Bacteria 1139
324 Ga0207709_10074732 3300025935 Bacteria 2164
325 Ga0207709_10111572 3300025935 Unclassified 1829
326 Ga0207709_10273087 3300025935 Unclassified 1245
327 Ga0207670_10017942 3300025936 Bacteria 4288
328 Ga0207704_10083943 3300025938 Bacteria 2069
329 Ga0207691_10001531 3300025940 Bacteria 22999
330 Ga0207691_10262749 3300025940 Bacteria 1488
331 Ga0207711_10003667 3300025941 Bacteria 13273
332 Ga0207711_10045781 3300025941 Unclassified 3739
333 Ga0207711_10064400 3300025941 Unclassified 3166
334 Ga0207711_10329843 3300025941 Unclassified 1411
335 Ga0207689_10008713 3300025942 Bacteria 8828
336 Ga0207689_10016842 3300025942 Bacteria 6185
337 Ga0207689_10146107 3300025942 Bacteria 1948
338 Ga0207689_10244123 3300025942 Unclassified 1485
339 Ga0207661_10252955 3300025944 Bacteria 1567
340 Ga0207679_10521280 3300025945 Unclassified 1063
341 Ga0207712_10028818 3300025961 Bacteria 3718
342 Ga0207640_10081777 3300025981 Bacteria 2210
343 Ga0207640_10112579 3300025981 Bacteria 1933
344 Ga0207640_10406958 3300025981 Bacteria 1109
345 Ga0207658_10068564 3300025986 Bacteria 2677
346 Ga0207677_10251485 3300026023 Bacteria 1435
347 Ga0207703_10531461 3300026035 Unclassified 1107
348 Ga0207639_10061466 3300026041 Bacteria 2901
349 Ga0207639_10219393 3300026041 Bacteria 1642
350 Ga0207639_10410929 3300026041 Unclassified 1221
351 Ga0207708_10000043 3300026075 Bacteria 121725
352 Ga0207708_10007831 3300026075 Bacteria 7914
353 Ga0207708_10140981 3300026075 Bacteria 1891
354 Ga0207702_10150385 3300026078 Bacteria 2117
355 Ga0207641_10109885 3300026088 Bacteria 2442
356 Ga0207641_10180752 3300026088 Bacteria 1932
357 Ga0207641_10246746 3300026088 Bacteria 1666
358 Ga0207648_10015138 3300026089 Bacteria 7099
359 Ga0207648_10048951 3300026089 Bacteria 3700
360 Ga0207648_10342336 3300026089 Unclassified 1347
361 Ga0207676_10004891 3300026095 Bacteria 9491
362 Ga0207676_10158301 3300026095 Bacteria 1959
363 Ga0207676_10351934 3300026095 Bacteria 1362
364 Ga0207674_10002367 3300026116 Bacteria 23830
365 Ga0207674_10236066 3300026116 Bacteria 1776
366 Ga0207674_10342165 3300026116 Unclassified 1446
367 Ga0207674_10417305 3300026116 Bacteria 1297
368 Ga0207675_100008740 3300026118 Bacteria 9514
369 Ga0207675_100021904 3300026118 Bacteria 5950
370 Ga0207675_100039921 3300026118 Bacteria 4379
371 Ga0207675_100098854 3300026118 Bacteria 2749
372 Ga0207675_100209912 3300026118 Bacteria 1872
373 Ga0207428_10013786 3300027907 Bacteria 7044
374 Ga0207428_10047588 3300027907 Bacteria 3443
375 Ga0268265_10177140 3300028380 Bacteria 1829
376 Ga0268265_10301028 3300028380 Unclassified 1444
377 Ga0268265_10348492 3300028380 Unclassified 1351
378 Ga0268264_10040717 3300028381 Unclassified 3839
379 Ga0268264_10073497 3300028381 Bacteria 2902
380 Ga0268264_10094055 3300028381 Bacteria 2591
381 Ga0268264_10106322 3300028381 Bacteria 2449
382 Ga0268264_10111503 3300028381 Bacteria 2397
383 Ga0268264_10113918 3300028381 Bacteria 2373
384 Ga0268264_10229768 3300028381 Bacteria 1713
385 Ga0268264_10278375 3300028381 Unclassified 1566
386 Ga0268264_10300939 3300028381 Bacteria 1510
387 Ga0268264_10302825 3300028381 Bacteria 1505
388 Ga0307408_100011791 3300031548 Bacteria 5781
389 Ga0307408_100161167 3300031548 Bacteria 1782
390 Ga0307405_10079066 3300031731 Bacteria 2142
391 Ga0307405_10243898 3300031731 Unclassified 1333
392 Ga0307410_10142349 3300031852 Bacteria 1776
393 Ga0307406_10008963 3300031901 Bacteria 5594
394 Ga0307407_10071307 3300031903 Bacteria 2068
395 Ga0307412_10008317 3300031911 Bacteria 5914
396 Ga0307412_10378029 3300031911 Bacteria 1146
397 Ga0307409_100157714 3300031995 Bacteria 1980
398 Ga0307416_100002153 3300032002 Bacteria 11158
399 Ga0307414_10001957 3300032004 Bacteria 10653
400 Ga0307414_10096394 3300032004 Bacteria 2213
401 Ga0307411_10005777 3300032005 Bacteria 6123
402 Ga0307411_10012992 3300032005 Bacteria 4574
403 Ga0307415_100009574 3300032126 Bacteria 5441
404 Ga0373951_0001101 3300035091 Bacteria 7209
405 Ga0373942_0007648 3300035207 Bacteria 2511
406 Ga0395900_0168787 3300037418 Unclassified 2229
407 Ga0395898_0199311 3300037466 Unclassified 1912
408 Ga0395898_0370997 3300037466 Unclassified 1365
409 Ga0395901_0256020 3300038443 Unclassified 1823
410 Ga0242420_000364 3300038996 Bacteria 4999
411 Ga0436365_0381713 3300039437 Bacteria 41304
412 Ga0439455_0013544 3300042012 Unclassified 1848
413 Ga0439458_0024627 3300042157 Bacteria 1408
414 Ga0439434_0015706 3300042435 Bacteria 2258
415 Ga0451577_0161360 3300042876 Unclassified 2019
416 Ga0451576_0303809 3300045051 Bacteria 1669
417 Ga0495610_0102878 3300046512 Unclassified 1276
418 Ga0495656_0039878 3300046615 Bacteria 1954
419 Ga0495672_0051431 3300047320 Unclassified 2426
420 Ga0496103_0160636 3300048906 Bacteria 1441
421 Ga0496104_0018973 3300048907 Bacteria 6284
422 Ga0496108_0254211 3300048911 Bacteria 1529
423 Ga0496112_0176822 3300048915 Bacteria 2099
424 Ga0501292_004453 3300049515 Unclassified 1919
425 Ga0501296_003792 3300049519 Unclassified 1626
426 Ga0501296_004121 3300049519 Bacteria 1573
427 Ga0501299_000709 3300049522 Bacteria 4001
428 Ga0501038_0005082 3300049574 Bacteria 12227
429 Ga0501075_0190575 3300049591 Bacteria 1564
430 Ga0501198_006514 3300049649 Bacteria 1665
431 Ga0501217_003166 3300049661 Bacteria 3301
432 Ga0501217_016565 3300049661 Bacteria 1690
433 Ga0501217_040332 3300049661 Bacteria 1186
434 Ga0501223_013755 3300049663 Bacteria 1609
435 Ga0501224_001708 3300049664 Bacteria 2942
436 Ga0501227_000106 3300049665 Bacteria 14058
437 Ga0501233_001523 3300049668 Unclassified 3957
438 Ga0501235_009953 3300049669 Bacteria 2079
439 Ga0501235_015896 3300049669 Bacteria 1660
440 Ga0501235_016818 3300049669 Bacteria 1617
441 Ga0501239_001568 3300049672 Bacteria 1981
442 Ga0501253_010787 3300049683 Unclassified 1387
443 Ga0501257_007565 3300049686 Bacteria 2427
444 Ga0501257_018467 3300049686 Bacteria 1626
445 Ga0501260_000407 3300049689 Unclassified 3356
446 Ga0501225_0000853 3300049705 Bacteria 9450
447 Ga0501225_0035682 3300049705 Unclassified 1369
448 Ga0501234_017350 3300049707 Bacteria 1138
449 Ga0501283_001813 3300049779 Bacteria 2764
450 Ga0501212_008325 3300049851 Unclassified 1440
451 Ga0501226_000544 3300049853 Bacteria 5191
452 nmdc:mga05p37_351269_c1 3300050507 Bacteria 1736
453 nmdc:mga05p37_65136_c1 3300050507 Bacteria 4484
454 nmdc:mga09592_121972_c1 3300050508 Bacteria 2239
455 nmdc:mga09592_57546_c1 3300050508 Bacteria 3286
456 nmdc:mga06r32_451053_c1 3300050510 Unclassified 1266
457 nmdc:mga08y16_13794_c1 3300050511 Bacteria 8504
458 nmdc:mga08y16_3655_c1 3300050511 Bacteria 15997
459 nmdc:mga0n895_175069_c1 3300050512 Bacteria 2177
460 nmdc:mga08x19_138782_c1 3300050514 Bacteria 1641
461 Ga0500616_0007420 3300053153 Bacteria 6974
462 rootL2_10089685
463 MBSR1b_contig_13447674
464 MBSR1b_contig_492026
465 CNBas_1000314
466 CNAas_1000004
467 JGI24751J29686_10000017
468 JGI24751J29686_10000149
469 JGI25406J46586_10014972
470 Ga0065714_10064460
471 Ga0065704_10083950
472 Ga0065704_10118959
473 Ga0065712_10068069
474 Ga0065715_10028452
475 Ga0065715_10089839
476 Ga0065715_10095392
477 Ga0065715_10117551
478 Ga0065715_10131647
479 Ga0065715_10209969
480 Ga0065707_10010856
481 Ga0070676_10032637
482 Ga0070683_100151571
483 Ga0070690_100037425
484 Ga0070690_100165310
485 Ga0070670_100005375
486 Ga0070670_100085719
487 Ga0070670_100339090
488 Ga0070670_100504335
489 Ga0068869_100007551
490 Ga0068869_100049836
491 Ga0070666_10179611
492 Ga0070680_100013569
493 Ga0070680_100057291
494 Ga0070680_100122236
495 Ga0070680_100166982
496 Ga0070682_100012254
497 Ga0070682_100093931
498 Ga0068868_100007808
499 Ga0068868_100271763
500 Ga0070660_100087521
501 Ga0070689_100002993
502 Ga0070691_10160028
503 Ga0070687_100014088
504 Ga0070687_100023965
505 Ga0070692_10006058
506 Ga0070692_10010290
507 Ga0070669_100010477
508 Ga0070675_100256469
509 Ga0070671_100002480
510 Ga0070671_100045419
511 Ga0070671_100153493
512 Ga0070674_100319918
513 Ga0070673_100209221
514 Ga0070659_100039290
515 Ga0070659_100128321
516 Ga0070667_100021151
517 Ga0070667_100163170
518 Ga0070703_10002189
519 Ga0070701_10008309
520 Ga0070701_10014106
521 Ga0070701_10065518
522 Ga0070701_10091912
523 Ga0070705_100004752
524 Ga0070705_100107057
525 Ga0070705_100147274
526 Ga0070700_100000964
527 Ga0070700_100102062
528 Ga0070700_100161480
529 Ga0070694_100043726
530 Ga0070694_100058270
531 Ga0070694_100096618
532 Ga0070694_100123883
533 Ga0070694_100135574
534 Ga0070694_100147570
535 Ga0070694_100170141
536 Ga0070708_100000508
537 Ga0070708_100022495
538 Ga0070708_100153039
539 Ga0070708_100272762
540 Ga0070708_100280968
541 Ga0070678_100325692
542 Ga0070662_100085451
543 Ga0070681_10000489
544 Ga0070681_10046425
545 Ga0070681_10047995
546 Ga0070681_10072586
547 Ga0070681_10231787
548 Ga0068867_100014896
549 Ga0070706_100000088
550 Ga0070706_100009738
551 Ga0070706_100070901
552 Ga0070707_100102815
553 Ga0070707_100116288
554 Ga0070707_100199754
555 Ga0070698_100002826
556 Ga0070698_100027844
557 Ga0070698_100031002
558 Ga0070698_100212505
559 Ga0070699_100001427
560 Ga0070699_100017437
561 Ga0070699_100103113
562 Ga0070679_100000604
563 Ga0070679_100143251
564 Ga0070684_100257437
565 Ga0070697_100009364
566 Ga0070697_100116504
567 Ga0070697_100325783
568 Ga0068853_100075885
569 Ga0068853_100104662
570 Ga0068853_100216260
571 Ga0068853_100296633
572 Ga0070672_100047637
573 Ga0070672_100245730
574 Ga0070686_100001026
575 Ga0070686_100056067
576 Ga0070695_100020677
577 Ga0070695_100074279
578 Ga0070695_100188451
579 Ga0070696_100035292
580 Ga0070696_100069921
581 Ga0070696_100074135
582 Ga0070693_100004578
583 Ga0070693_100005407
584 Ga0070693_100083470
585 Ga0070693_100145608
586 Ga0070693_100171149
587 Ga0070704_100037629
588 Ga0070704_100072040
589 Ga0070704_100082246
590 Ga0070704_100118011
591 Ga0070664_100003375
592 Ga0068857_100012945
593 Ga0068857_100113116
594 Ga0068857_100131800
595 Ga0068857_100373861
596 Ga0070702_100060215
597 Ga0070702_100170687
598 Ga0068859_100002739
599 Ga0068859_100046093
600 Ga0068859_100093048
601 Ga0068859_100110623
602 Ga0068859_100121851
603 Ga0068859_100138053
604 Ga0068859_100207090
605 Ga0068859_100283215
606 Ga0068859_100347119
607 Ga0068859_100379771
608 Ga0068864_100042336
609 Ga0068864_100065888
610 Ga0068864_100078778
611 Ga0068864_100124254
612 Ga0068864_100169193
613 Ga0068864_100171675
614 Ga0068861_100017567
615 Ga0068861_100127543
616 Ga0068861_100312266
617 Ga0068851_10059050
618 Ga0068870_10008350
619 Ga0068870_10027938
620 Ga0068870_10115797
621 Ga0068870_10162526
622 Ga0068863_100018044
623 Ga0068863_100189818
624 Ga0068863_100294821
625 Ga0068858_100185364
626 Ga0068860_100004210
627 Ga0068860_100030469
628 Ga0068860_100053875
629 Ga0068860_100072351
630 Ga0068860_100079833
631 Ga0068860_100114891
632 Ga0068860_100193004
633 Ga0068860_100273083
634 Ga0068860_100405958
635 Ga0068860_100665219
636 Ga0068862_100075730
637 Ga0068862_100104602
638 Ga0068862_100111498
639 Ga0081539_10000043
640 Ga0081539_10005869
641 Ga0097621_100001685
642 Ga0097621_100088346
643 Ga0068871_100006022
644 Ga0068871_100015503
645 Ga0068871_100028784
646 Ga0075431_100064005
647 Ga0075431_100131761
648 Ga0075433_10020255
649 Ga0075433_10022972
650 Ga0075434_100032647
651 Ga0075434_100150631
652 Ga0075434_100417145
653 Ga0075429_100072291
654 Ga0075429_100109852
655 Ga0068865_100130776
656 Ga0075436_100041994
657 Ga0097620_100002739
658 Ga0097620_100046093
659 Ga0097620_100093051
660 Ga0097620_100110619
661 Ga0097620_100121856
662 Ga0097620_100138047
663 Ga0097620_100207100
664 Ga0097620_100283230
665 Ga0097620_100347108
666 Ga0097620_100379749
667 Ga0075435_100003678
668 Ga0075435_100117894
669 Ga0111539_10012727
670 Ga0111539_10024482
671 Ga0105245_10539677
672 Ga0105247_10000592
673 Ga0105247_10085393
674 Ga0105247_10089947
675 Ga0105247_10191004
676 Ga0114129_10030857
677 Ga0114129_10063314
678 Ga0114129_10103825
679 Ga0114129_10328202
680 Ga0114129_10354022
681 Ga0114129_10678384
682 Ga0105243_10068303
683 Ga0105243_10086783
684 Ga0105243_10227077
685 Ga0105241_10055499
686 Ga0105241_10109573
687 Ga0105241_10204210
688 Ga0105241_10237460
689 Ga0105241_10466383
690 Ga0105242_10007429
691 Ga0105242_10466293
692 Ga0105242_10498206
693 Ga0105248_10004879
694 Ga0105248_10006056
695 Ga0105248_10017237
696 Ga0105248_10057421
697 Ga0105248_10146328
698 Ga0105248_10255889
699 Ga0105237_10008903
700 Ga0105237_10015838
701 Ga0105238_10007632
702 Ga0105238_10027606
703 Ga0105249_10007021
704 Ga0105249_10056201
705 Ga0105249_10219725
706 Ga0105239_10098779
707 Ga0105246_10094253
708 Ga0105246_10253193
709 Ga0157373_10002883
710 Ga0157373_10008292
711 Ga0157373_10138029
712 Ga0157371_10197523
713 Ga0157374_10023940
714 Ga0157374_10026890
715 Ga0157378_10001968
716 Ga0157378_10134439
717 Ga0157378_10149954
718 Ga0157378_10301574
719 Ga0163162_10002437
720 Ga0163162_10011708
721 Ga0163162_10012021
722 Ga0163162_10162770
723 Ga0163162_10237280
724 Ga0163162_10451360
725 Ga0163162_10696714
726 Ga0157372_10001564
727 Ga0157372_10113138
728 Ga0157375_10047825
729 Ga0157375_10215959
730 Ga0163163_10000862
731 Ga0163163_10058608
732 Ga0163163_10062838
733 Ga0163163_10067723
734 Ga0163163_10241251
735 Ga0157380_10072771
736 Ga0157380_10315847
737 Ga0157377_10175694
738 Ga0163161_10015460
739 Ga0213876_10000102
740 Ga0207710_10001166
741 Ga0207710_10070938
742 Ga0207680_10116217
743 Ga0207647_10000385
744 Ga0207647_10048111
745 Ga0207647_10239932
746 Ga0207643_10042107
747 Ga0207643_10079908
748 Ga0207684_10000131
749 Ga0207684_10032227
750 Ga0207654_10022993
751 Ga0207707_10000017
752 Ga0207707_10004243
753 Ga0207707_10109843
754 Ga0207707_10366243
755 Ga0207671_10099924
756 Ga0207671_10148293
757 Ga0207671_10161583
758 Ga0207660_10094974
759 Ga0207662_10005692
760 Ga0207662_10023437
761 Ga0207662_10080412
762 Ga0207652_10000335
763 Ga0207652_10074357
764 Ga0207652_10114949
765 Ga0207681_10044905
766 Ga0207694_10049440
767 Ga0207694_10076122
768 Ga0207694_10484841
769 Ga0207650_10000005
770 Ga0207650_10063251
771 Ga0207650_10163632
772 Ga0207650_10302083
773 Ga0207650_10431313
774 Ga0207659_10254107
775 Ga0207687_10080623
776 Ga0207644_10030944
777 Ga0207644_10100032
778 Ga0207690_10013967
779 Ga0207690_10056799
780 Ga0207706_10044092
781 Ga0207686_10010343
782 Ga0207686_10017843
783 Ga0207686_10255987
784 Ga0207686_10332250
785 Ga0207709_10074732
786 Ga0207709_10111572
787 Ga0207709_10273087
788 Ga0207670_10017942
789 Ga0207704_10083943
790 Ga0207691_10001531
791 Ga0207691_10262749
792 Ga0207711_10003667
793 Ga0207711_10045781
794 Ga0207711_10064400
795 Ga0207711_10329843
796 Ga0207689_10008713
797 Ga0207689_10016842
798 Ga0207689_10146107
799 Ga0207689_10244123
800 Ga0207661_10252955
801 Ga0207679_10521280
802 Ga0207712_10028818
803 Ga0207640_10081777
804 Ga0207640_10112579
805 Ga0207640_10406958
806 Ga0207658_10068564
807 Ga0207677_10251485
808 Ga0207703_10531461
809 Ga0207639_10061466
810 Ga0207639_10219393
811 Ga0207639_10410929
812 Ga0207708_10000043
813 Ga0207708_10007831
814 Ga0207708_10140981
815 Ga0207702_10150385
816 Ga0207641_10109885
817 Ga0207641_10180752
818 Ga0207641_10246746
819 Ga0207648_10015138
820 Ga0207648_10048951
821 Ga0207648_10342336
822 Ga0207676_10004891
823 Ga0207676_10158301
824 Ga0207676_10351934
825 Ga0207674_10002367
826 Ga0207674_10236066
827 Ga0207674_10342165
828 Ga0207674_10417305
829 Ga0207675_100008740
830 Ga0207675_100021904
831 Ga0207675_100039921
832 Ga0207675_100098854
833 Ga0207675_100209912
834 Ga0207428_10013786
835 Ga0207428_10047588
836 Ga0268265_10177140
837 Ga0268265_10301028
838 Ga0268265_10348492
839 Ga0268264_10040717
840 Ga0268264_10073497
841 Ga0268264_10094055
842 Ga0268264_10106322
843 Ga0268264_10111503
844 Ga0268264_10113918
845 Ga0268264_10229768
846 Ga0268264_10278375
847 Ga0268264_10300939
848 Ga0268264_10302825
849 Ga0307408_100011791
850 Ga0307408_100161167
851 Ga0307405_10079066
852 Ga0307405_10243898
853 Ga0307410_10142349
854 Ga0307406_10008963
855 Ga0307407_10071307
856 Ga0307412_10008317
857 Ga0307412_10378029
858 Ga0307409_100157714
859 Ga0307416_100002153
860 Ga0307414_10001957
861 Ga0307414_10096394
862 Ga0307411_10005777
863 Ga0307411_10012992
864 Ga0307415_100009574
865 Ga0373951_0001101
866 Ga0373942_0007648
867 Ga0395900_0168787
868 Ga0395898_0199311
869 Ga0395898_0370997
870 Ga0395901_0256020
871 Ga0242420_000364
872 Ga0436365_0381713
873 Ga0439455_0013544
874 Ga0439458_0024627
875 Ga0439434_0015706
876 Ga0451577_0161360
877 Ga0451576_0303809
878 Ga0495610_0102878
879 Ga0495656_0039878
880 Ga0495672_0051431
881 Ga0496103_0160636
882 Ga0496104_0018973
883 Ga0496108_0254211
884 Ga0496112_0176822
885 Ga0501292_004453
886 Ga0501296_003792
887 Ga0501296_004121
888 Ga0501299_000709
889 Ga0501038_0005082
890 Ga0501075_0190575
891 Ga0501198_006514
892 Ga0501217_003166
893 Ga0501217_016565
894 Ga0501217_040332
895 Ga0501223_013755
896 Ga0501224_001708
897 Ga0501227_000106
898 Ga0501233_001523
899 Ga0501235_009953
900 Ga0501235_015896
901 Ga0501235_016818
902 Ga0501239_001568
903 Ga0501253_010787
904 Ga0501257_007565
905 Ga0501257_018467
906 Ga0501260_000407
907 Ga0501225_0000853
908 Ga0501225_0035682
909 Ga0501234_017350
910 Ga0501283_001813
911 Ga0501212_008325
912 Ga0501226_000544
913 nmdc:mga05p37_351269_c1
914 nmdc:mga05p37_65136_c1
915 nmdc:mga09592_121972_c1
916 nmdc:mga09592_57546_c1
917 nmdc:mga06r32_451053_c1
918 nmdc:mga08y16_13794_c1
919 nmdc:mga08y16_3655_c1
920 nmdc:mga0n895_175069_c1
921 nmdc:mga08x19_138782_c1
922 Ga0500616_0007420

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ft8-assembly1.cif.gz_A the von willebrand factor a domain of human capillary morphogenesis gene ii, flexibly fused to the 1tel crystallization chaperone, thr-val linker variant, sumo tag-free preparation 0.7243 95 292
1mhp-assembly1.cif.gz_A crystal structure of a chimeric alpha1 integrin i-domain in complex with the fab fragment of a humanized neutralizing antibody 0.7148 98 291
1mhp-assembly1.cif.gz_A crystal structure of a chimeric alpha1 integrin i-domain in complex with the fab fragment of a humanized neutralizing antibody 0.7079 98 291
6pyx-assembly2.cif.gz_B calcium activated chloride channel regulator 1 (clca1) vwa domain 0.7059 98 273
6pyx-assembly2.cif.gz_B calcium activated chloride channel regulator 1 (clca1) vwa domain 0.702 98 273
ID Description Score Start End Superfamily
af_P76481_215_393_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7192 101 288 3.40.50.410
4fx5A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7152 98 290 3.40.50.410
af_Q18048_390_564_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7144 101 289 3.40.50.410
af_X1WHI8_296_471_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7135 98 287 3.40.50.410
4fx5A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7081 98 290 3.40.50.410
ID Description Score Start End GO Terms
AF-A0A2V8R5Z5-F1-model_v4 NodB homology domain-containing protein 0.9587 97 188
AF-A0A357F450-F1-model_v4 VWFA domain-containing protein 0.951 116 283
AF-A0A7V9ZN05-F1-model_v4 VWFA domain-containing protein 0.9503 96 292
AF-A0A2V8RGG1-F1-model_v4 VWA domain-containing protein 0.9426 96 292
AF-A0A357F450-F1-model_v4 VWFA domain-containing protein 0.9189 116 283

Map