F448598

General Info

Members Datasets Scaffolds Average Seq Length
460 349 920 257

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0008522|Ga0495603_0008522_789_1691
Length 300
Sequence VPTSARSKRFIRYGPRFLRQSAARSKSINLEFTAMKHETIRTSAFAMPLTNPAFPPGPYRFVNREYFIIQYRSDPEALRRVVPEPLELTEPVVNYEFIRMPDSTGFGDYTESGQIIPVSYRGQAGSFTHQMFLNDHPPIAGGRELWGFPKKLAQPKLAVEIDTLVGTLNYGSVRIATGTMGYKHRALDIAVEAAKLAAPNFLLKIIPHVDGRPRICELVRFHLEDITVKGAWTGPAALDLYSHALAPVAELPVLQVLSAKHIVADLTLGLGTVVHDYLAPGATVRRRGTGSEILIEANAG

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
50 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
56 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
60 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
98 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
105 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
106 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
107 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
118 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
148 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
155 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
156 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
157 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
158 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
161 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
162 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
163 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
183 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
184 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
185 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
186 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
187 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
188 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
189 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
190 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
191 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
192 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
193 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
194 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
195 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
196 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
197 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
198 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
199 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
200 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
201 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
202 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
203 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
204 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
205 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
206 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
209 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
210 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
211 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
212 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
213 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
214 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
215 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
216 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
217 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
218 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
219 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
220 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
221 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
222 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
223 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
224 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
225 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
226 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
227 2791355199
228 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
229 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
230 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
231 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
232 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
233 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
234 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
235 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
236 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
237 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
238 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
239 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
240 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
241 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
242 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
243 2851182111 Bosea sp. Tri-44 Isolate Nodule
244 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
245 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
246 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
247 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
248 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
249 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
250 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
251 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
252 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
253 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
254 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
255 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
256 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
257 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
258 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
259 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
260 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
261 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
262 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
263 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
264 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
265 2904699407
266 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
267 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
268 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
269 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
270 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
271 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
272 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
273 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
274 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
275 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
276 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
277 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
278 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
279 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
280 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
281 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
282 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
283 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
284 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
285 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
286 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
287 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
288 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
289 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
290 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
291 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
292 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
293 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
294 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
295 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
296 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
297 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
298 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
299 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
300 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
301 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
302 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
303 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
304 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
305 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
306 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
307 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
308 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
309 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
310 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
311 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
312 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
313 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
314 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
315 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
316 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
317 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
318 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
319 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
320 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
321 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
322 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
323 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
324 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
325 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
326 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
327 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
328 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
329 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
330 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
331 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
332 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
333 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
334 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
335 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
336 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
337 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
338 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
339 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
340 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
341 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
342 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
343 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
344 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
345 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
346 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
347 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
348 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
349 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.34
Metatranscriptomes 0
Isolates 31.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.48
Nodule 22.17
Rhizoplane 1.3
Rhizosphere 41.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0008522 3300046455 Bacteria 6195
2 JGI25153J46596_10045637 3300003215 Bacteria 1305
3 JGI25160J50197_1031394 3300003354 Bacteria 1369
4 JGI25404J52841_10021532 3300003659 Bacteria 1395
5 Ga0055531_10035334 3300003794 Bacteria 1565
6 Ga0070666_10054985 3300005335 Bacteria 2686
7 Ga0068868_100321909 3300005338 Bacteria 1317
8 Ga0070668_100023040 3300005347 Bacteria 4707
9 Ga0070671_100049506 3300005355 Bacteria 3495
10 Ga0070667_100002698 3300005367 Bacteria 15368
11 Ga0070667_100579394 3300005367 Bacteria 1033
12 Ga0070709_10000609 3300005434 Bacteria 20716
13 Ga0070714_100010925 3300005435 Bacteria 7190
14 Ga0070714_100012268 3300005435 Bacteria 6836
15 Ga0070713_100015089 3300005436 Bacteria 5757
16 Ga0070710_10000144 3300005437 Bacteria 32895
17 Ga0070711_100084175 3300005439 Bacteria 2275
18 Ga0070698_100752178 3300005471 Bacteria 918
19 Ga0070699_100252076 3300005518 Bacteria 1577
20 Ga0068853_100102272 3300005539 Bacteria 2535
21 Ga0070665_100011217 3300005548 Bacteria 9061
22 Ga0068852_100003420 3300005616 Bacteria 11088
23 Ga0068852_100554462 3300005616 Bacteria 1150
24 Ga0068859_100249654 3300005617 Bacteria 1865
25 Ga0068864_100006013 3300005618 Bacteria 9963
26 Ga0068863_100010184 3300005841 Bacteria 9142
27 Ga0068863_100538075 3300005841 Bacteria 1153
28 Ga0068858_100083161 3300005842 Bacteria 2977
29 Ga0068862_100288868 3300005844 Bacteria 1505
30 Ga0081455_10002274 3300005937 Bacteria 22913
31 Ga0081455_10012682 3300005937 Bacteria 8388
32 Ga0081455_10083138 3300005937 Bacteria 2617
33 Ga0081538_10101186 3300005981 Bacteria 1451
34 Ga0081540_1001170 3300005983 Bacteria 23013
35 Ga0081540_1002809 3300005983 Bacteria 14097
36 Ga0081540_1006898 3300005983 Bacteria 8192
37 Ga0081540_1008494 3300005983 Bacteria 7168
38 Ga0081540_1017586 3300005983 Bacteria 4420
39 Ga0081540_1040185 3300005983 Bacteria 2441
40 Ga0081539_10141425 3300005985 Bacteria 1169
41 Ga0075365_10000025 3300006038 Bacteria 62479
42 Ga0075364_10289101 3300006051 Bacteria 1115
43 Ga0070712_100004935 3300006175 Bacteria 8253
44 Ga0075367_10003271 3300006178 Bacteria 7674
45 Ga0075367_10269349 3300006178 Bacteria 1070
46 Ga0075369_10009421 3300006186 Bacteria 3793
47 Ga0075370_10000361 3300006353 Bacteria 16648
48 Ga0075370_10131097 3300006353 Bacteria 1463
49 Ga0075370_10141645 3300006353 Bacteria 1406
50 Ga0075434_100033534 3300006871 Bacteria 5068
51 Ga0068865_100388630 3300006881 Bacteria 1140
52 Ga0097620_100249660 3300006931 Bacteria 1865
53 Ga0105240_10240179 3300009093 Bacteria 2100
54 Ga0111539_10002647 3300009094 Bacteria 23736
55 Ga0111539_10274564 3300009094 Bacteria 1962
56 Ga0105245_10178696 3300009098 Bacteria 2026
57 Ga0105247_10005208 3300009101 Bacteria 8217
58 Ga0114129_10384116 3300009147 Bacteria 1854
59 Ga0105243_10237971 3300009148 Bacteria 1619
60 Ga0105241_10024389 3300009174 Bacteria 4491
61 Ga0105241_10034151 3300009174 Bacteria 3819
62 Ga0105242_10137229 3300009176 Bacteria 2118
63 Ga0105237_10004480 3300009545 Bacteria 16143
64 Ga0105237_10041708 3300009545 Bacteria 4627
65 Ga0105237_10160702 3300009545 Bacteria 2245
66 Ga0105237_10161146 3300009545 Bacteria 2242
67 Ga0105237_10320032 3300009545 Bacteria 1555
68 Ga0105237_10643803 3300009545 Bacteria 1067
69 Ga0105249_10391495 3300009553 Bacteria 1418
70 Ga0105033_107077 3300009986 Bacteria 972
71 Ga0105035_106948 3300009988 Bacteria 944
72 Ga0105239_10033350 3300010375 Bacteria 5655
73 Ga0105239_10312818 3300010375 Bacteria 1770
74 Ga0105239_10778438 3300010375 Bacteria 1096
75 Ga0157378_10501137 3300013297 Bacteria 1213
76 Ga0163162_10090213 3300013306 Bacteria 3146
77 Ga0157379_10050746 3300014968 Bacteria 3704
78 Ga0214544_1023343 3300021320 Bacteria 3477
79 Ga0214542_1009367 3300021321 Bacteria 15278
80 Ga0213872_10001698 3300021361 Bacteria 13852
81 Ga0213872_10033029 3300021361 Bacteria 2371
82 Ga0209148_1000192 3300025254 Bacteria 115724
83 Ga0209148_1001171 3300025254 Bacteria 15147
84 Ga0209233_1010089 3300025261 Bacteria 2845
85 Ga0209455_1000196 3300025272 Bacteria 88682
86 Ga0209130_1004312 3300025284 Bacteria 5477
87 Ga0209676_1013903 3300025292 Bacteria 3064
88 Ga0209025_1000282 3300025294 Bacteria 115627
89 Ga0209758_1001866 3300025297 Bacteria 23110
90 Ga0207426_1000358 3300025302 Bacteria 83113
91 Ga0207426_1013751 3300025302 Bacteria 2986
92 Ga0209257_1000266 3300025304 Bacteria 119974
93 Ga0207692_10000215 3300025898 Bacteria 19463
94 Ga0207710_10090664 3300025900 Bacteria 1430
95 Ga0207685_10055701 3300025905 Bacteria 1544
96 Ga0207699_10001468 3300025906 Bacteria 11197
97 Ga0207684_10326208 3300025910 Bacteria 1323
98 Ga0207654_10271264 3300025911 Bacteria 1145
99 Ga0207695_10000008 3300025913 Bacteria 1058268
100 Ga0207671_10041477 3300025914 Bacteria 3407
101 Ga0207671_10064195 3300025914 Bacteria 2730
102 Ga0207671_10294842 3300025914 Bacteria 1281
103 Ga0207693_10009787 3300025915 Bacteria 7805
104 Ga0207663_10062266 3300025916 Bacteria 2371
105 Ga0207657_10024174 3300025919 Bacteria 5638
106 Ga0207700_10132518 3300025928 Bacteria 2037
107 Ga0207664_10031599 3300025929 Bacteria 4052
108 Ga0207690_10234414 3300025932 Bacteria 1411
109 Ga0207669_10035024 3300025937 Bacteria 2852
110 Ga0207679_10432536 3300025945 Bacteria 1164
111 Ga0207667_10195930 3300025949 Bacteria 2073
112 Ga0207712_10240089 3300025961 Bacteria 1459
113 Ga0207658_10000596 3300025986 Bacteria 32369
114 Ga0207677_10041863 3300026023 Bacteria 3032
115 Ga0207639_10100919 3300026041 Bacteria 2332
116 Ga0207678_10015867 3300026067 Bacteria 6620
117 Ga0207678_10231771 3300026067 Bacteria 1581
118 Ga0207648_10370758 3300026089 Bacteria 1293
119 Ga0207675_100350033 3300026118 Bacteria 1448
120 Ga0207698_10476837 3300026142 Bacteria 1209
121 Ga0209371_1038005 3300027312 Bacteria 996
122 Ga0207428_10000086 3300027907 Bacteria 131832
123 Ga0268265_10313468 3300028380 Bacteria 1417
124 Ga0268265_10519208 3300028380 Bacteria 1126
125 Ga0268264_10253803 3300028381 Bacteria 1635
126 Ga0307515_10079886 3300028794 Bacteria 4276
127 Ga0307515_10250292 3300028794 Bacteria 1526
128 Ga0268256_1042762 3300030500 Bacteria 1004
129 Ga0307511_10030724 3300030521 Bacteria 4819
130 Ga0307509_10005194 3300031507 Bacteria 18256
131 Ga0307509_10046512 3300031507 Bacteria 4671
132 Ga0307509_10090709 3300031507 Bacteria 3130
133 Ga0307509_10170359 3300031507 Bacteria 2057
134 Ga0307509_10435602 3300031507 Bacteria 1008
135 Ga0307508_10000092 3300031616 Bacteria 105585
136 Ga0307508_10027425 3300031616 Bacteria 5155
137 Ga0307508_10085997 3300031616 Bacteria 2727
138 Ga0307508_10276420 3300031616 Bacteria 1273
139 Ga0307516_10313950 3300031730 Bacteria 1240
140 Ga0307413_10073263 3300031824 Bacteria 2164
141 Ga0307406_10030481 3300031901 Bacteria 3276
142 Ga0307507_10007638 3300033179 Bacteria 15530
143 Ga0307510_10069266 3300033180 Bacteria 3535
144 Ga0373934_0035118 3300035086 Bacteria 1972
145 Ga0373923_0162658 3300035111 Bacteria 1019
146 Ga0373936_0094566 3300035113 Bacteria 1256
147 Ga0373935_0008154 3300035692 Bacteria 6279
148 Ga0373935_0008610 3300035692 Bacteria 6107
149 Ga0373927_0003672 3300035695 Bacteria 10930
150 Ga0373927_0003977 3300035695 Bacteria 10453
151 Ga0373927_0051903 3300035695 Bacteria 2652
152 Ga0373947_0118657 3300035725 Bacteria 1679
153 Ga0373925_0006499 3300037068 Bacteria 8594
154 Ga0373925_0082982 3300037068 Bacteria 2440
155 Ga0395900_0374138 3300037418 Bacteria 1394
156 Ga0395905_0006978 3300037471 Bacteria 11294
157 Ga0395905_0061917 3300037471 Bacteria 3500
158 Ga0395905_0233362 3300037471 Bacteria 1720
159 Ga0395901_0167126 3300038443 Bacteria 2309
160 Ga0436361_0092959 3300039447 Bacteria 5645
161 Ga0436361_0279127 3300039447 Bacteria 5610
162 Ga0436361_1154780 3300039447 Bacteria 9055
163 Ga0451802_2175089 3300041460 Bacteria 880
164 Ga0439445_0018637 3300042004 Bacteria 1725
165 Ga0466972_0024962 3300044658 Bacteria 2965
166 Ga0466961_0278320 3300044693 Bacteria 1024
167 Ga0466967_0162270 3300045976 Bacteria 2099
168 Ga0495629_0001177 3300046459 Bacteria 20634
169 Ga0495651_0111876 3300046462 Bacteria 2018
170 Ga0495580_0016566 3300046472 Bacteria 5528
171 Ga0495664_0102148 3300046477 Bacteria 1728
172 Ga0495606_0144461 3300046507 Bacteria 1402
173 Ga0495610_0014555 3300046512 Bacteria 4616
174 Ga0495643_0003992 3300046522 Bacteria 10545
175 Ga0495643_0148851 3300046522 Bacteria 1161
176 Ga0495648_0042874 3300046524 Bacteria 2843
177 Ga0495648_0070914 3300046524 Bacteria 2022
178 Ga0495666_0004954 3300046526 Bacteria 6745
179 Ga0495652_0009551 3300046529 Bacteria 8809
180 Ga0495652_0192480 3300046529 Bacteria 1555
181 Ga0495665_0005458 3300046531 Bacteria 6847
182 Ga0495640_0037222 3300046533 Bacteria 3434
183 Ga0495622_0029963 3300046557 Bacteria 2542
184 Ga0495668_0128706 3300046616 Bacteria 1386
185 Ga0495634_0120291 3300046642 Bacteria 1682
186 Ga0495611_0146561 3300046648 Bacteria 1102
187 Ga0495625_0087193 3300046660 Bacteria 2164
188 Ga0495635_0000978 3300046663 Bacteria 18814
189 Ga0495658_0335868 3300046683 Bacteria 959
190 Ga0495613_0215450 3300046689 Bacteria 1349
191 Ga0495649_0063321 3300046694 Bacteria 1987
192 Ga0495600_0013410 3300046809 Bacteria 5150
193 Ga0495604_0000626 3300047317 Bacteria 30413
194 Ga0495672_0091288 3300047320 Bacteria 1672
195 Ga0495676_0249574 3300047321 Bacteria 1211
196 Ga0495687_069917 3300047443 Bacteria 1411
197 Ga0495673_0052545 3300047469 Bacteria 1780
198 Ga0495602_0316354 3300048088 Bacteria 1137
199 Ga0496101_0208248 3300048904 Bacteria 1514
200 Ga0496102_0085483 3300048905 Bacteria 2913
201 Ga0496102_0356047 3300048905 Bacteria 1378
202 Ga0496103_0119254 3300048906 Bacteria 1680
203 Ga0496112_0363933 3300048915 Bacteria 1388
204 Ga0496116_0001518 3300048919 Bacteria 25764
205 Ga0496116_0004051 3300048919 Bacteria 14165
206 Ga0496116_0005221 3300048919 Bacteria 12153
207 Ga0496116_0036947 3300048919 Bacteria 3412
208 Ga0496116_0038665 3300048919 Bacteria 3309
209 Ga0496117_0001723 3300048920 Bacteria 30257
210 Ga0496117_0059333 3300048920 Bacteria 2643
211 Ga0496118_0008273 3300048921 Bacteria 10781
212 Ga0496118_0019473 3300048921 Bacteria 6064
213 Ga0496118_0025468 3300048921 Bacteria 5071
214 Ga0496118_0026942 3300048921 Bacteria 4879
215 Ga0496118_0091909 3300048921 Bacteria 2085
216 Ga0496118_0129742 3300048921 Bacteria 1622
217 Ga0496118_0268136 3300048921 Bacteria 959
218 Ga0496119_0000014 3300048922 Bacteria 313816
219 Ga0496119_0008850 3300048922 Bacteria 8754
220 Ga0496119_0010237 3300048922 Bacteria 7911
221 Ga0496119_0012063 3300048922 Bacteria 7063
222 Ga0496119_0032417 3300048922 Bacteria 3482
223 Ga0496120_0000007 3300048923 Bacteria 436796
224 Ga0496120_0000518 3300048923 Bacteria 59893
225 Ga0496120_0005076 3300048923 Bacteria 10655
226 Ga0496120_0008944 3300048923 Bacteria 7170
227 Ga0496120_0011537 3300048923 Bacteria 6070
228 Ga0496120_0044944 3300048923 Bacteria 2562
229 Ga0496121_0000698 3300048924 Bacteria 62442
230 Ga0496121_0008000 3300048924 Bacteria 12621
231 Ga0496121_0014821 3300048924 Bacteria 8231
232 Ga0496121_0027682 3300048924 Bacteria 5298
233 Ga0496121_0058815 3300048924 Bacteria 3174
234 Ga0496121_0126182 3300048924 Bacteria 1923
235 Ga0496121_0137885 3300048924 Bacteria 1815
236 Ga0496121_0153011 3300048924 Bacteria 1695
237 Ga0496122_0000014 3300048925 Bacteria 491410
238 Ga0496122_0008364 3300048925 Bacteria 11185
239 Ga0496122_0049492 3300048925 Bacteria 3217
240 Ga0496122_0111771 3300048925 Bacteria 1790
241 Ga0496123_0002036 3300048926 Bacteria 26111
242 Ga0496123_0041593 3300048926 Bacteria 3183
243 Ga0496123_0228859 3300048926 Bacteria 932
244 Ga0496124_0000953 3300048927 Bacteria 46161
245 Ga0496124_0209883 3300048927 Bacteria 1474
246 Ga0496124_0372866 3300048927 Bacteria 1001
247 Ga0496125_0000073 3300048928 Bacteria 236928
248 Ga0496125_0002032 3300048928 Bacteria 27422
249 Ga0496125_0088329 3300048928 Bacteria 2337
250 Ga0496126_0000019 3300048929 Bacteria 564723
251 Ga0496126_0000265 3300048929 Bacteria 111370
252 Ga0496126_0020664 3300048929 Bacteria 6449
253 Ga0496126_0030820 3300048929 Bacteria 5076
254 Ga0496126_0067493 3300048929 Bacteria 3195
255 Ga0495682_0011455 3300049460 Bacteria 3412
256 Ga0501034_0039309 3300049571 Bacteria 4792
257 Ga0501034_0062744 3300049571 Bacteria 3732
258 Ga0501038_0610258 3300049574 Bacteria 825
259 Ga0501043_0031375 3300049579 Bacteria 4177
260 Ga0501047_0006680 3300049581 Bacteria 10844
261 Ga0501070_0061085 3300049586 Bacteria 3123
262 Ga0501070_0242482 3300049586 Bacteria 1475
263 Ga0501073_0102923 3300049589 Bacteria 1983
264 Ga0501074_0400087 3300049590 Bacteria 974
265 Ga0501080_0051844 3300049742 Bacteria 3819
266 Ga0501083_0017351 3300049744 Bacteria 5018
267 Ga0501044_0015452 3300049823 Bacteria 8222
268 nmdc:mga0yw44_18_c1 3300050492 Bacteria 73023
269 nmdc:mga06z11_161375_c1 3300050494 Bacteria 1281
270 nmdc:mga06z11_62_c1 3300050494 Bacteria 46133
271 nmdc:mga06z11_84964_c1 3300050494 Bacteria 1706
272 nmdc:mga07m45_176_c1 3300050496 Bacteria 25687
273 nmdc:mga08y16_268_c1 3300050511 Bacteria 47257
274 nmdc:mga08y16_283036_c1 3300050511 Bacteria 1710
275 nmdc:mga0n895_96199_c1 3300050512 Bacteria 2966
276 nmdc:mga0a205_185668_c1 3300050515 Bacteria 964
277 nmdc:mga0sz30_82_c1 3300050516 Bacteria 36445
278 Ga0495612_0141905 3300053078 Bacteria 1042
279 Ga0500610_0000070 3300053079 Bacteria 30813
280 Ga0500635_0007279 3300053080 Bacteria 2997
281 Ga0500578_0060521 3300053086 Bacteria 2419
282 Ga0500646_0009466 3300053090 Bacteria 2494
283 Ga0500647_0079273 3300053091 Bacteria 1575
284 Ga0500583_0079292 3300053092 Bacteria 1584
285 Ga0500583_0233686 3300053092 Bacteria 910
286 Ga0500651_0007918 3300053093 Bacteria 6220
287 Ga0500566_0113618 3300053094 Bacteria 1469
288 Ga0500566_0158977 3300053094 Bacteria 1180
289 Ga0500566_0182760 3300053094 Bacteria 1074
290 Ga0500650_0094626 3300053098 Bacteria 1399
291 Ga0500595_041005 3300053119 Bacteria 1490
292 Ga0500607_151842 3300053121 Bacteria 1072
293 Ga0500642_0004561 3300053130 Bacteria 4356
294 Ga0500642_0132071 3300053130 Bacteria 1170
295 Ga0500658_0026710 3300053134 Bacteria 2226
296 Ga0500658_0103996 3300053134 Bacteria 1242
297 Ga0500568_0057033 3300053139 Bacteria 1520
298 Ga0500588_0005065 3300053146 Bacteria 2901
299 Ga0500588_0023011 3300053146 Bacteria 1703
300 Ga0500590_033185 3300053148 Bacteria 2677
301 Ga0500603_049559 3300053150 Bacteria 1145
302 Ga0500604_0002121 3300053151 Bacteria 5456
303 Ga0500604_0011415 3300053151 Bacteria 2385
304 Ga0500633_0153402 3300053160 Bacteria 864
305 Ga0500639_009928 3300053163 Bacteria 4981
306 Ga0500639_060412 3300053163 Bacteria 1954
307 Ga0500636_0004336 3300053177 Bacteria 8030
308 Ga0500636_0004708 3300053177 Bacteria 7738
309 Ga0500636_0107978 3300053177 Bacteria 1575
310 Ga0500636_0207556 3300053177 Bacteria 1031
311 Ga0500637_0022523 3300053178 Bacteria 3433
312 Ga0500609_000059 3300053731 Bacteria 14539
313 Ga0501082_0019171 3300060353 Bacteria 5894
314 2507505532 2507262055 Bacteria 8048963
315 2508695747 2508501042 Bacteria 8719808
316 2513670731 2513237098 Bacteria 9902361
317 2513692225 2513237101 Bacteria 7952346
318 2513721669 2513237104 Bacteria 10034502
319 2513873238 2513237139 Bacteria 8737671
320 2515630172 2515154112 Bacteria 8294334
321 2517104661 2517093001 Bacteria 9002274
322 2524442639 2524023205 Bacteria 8918781
323 2524459800 2524023209 Bacteria 6679728
324 2524538307 2524023228 Bacteria 10118060
325 2550904485 2548877040 Bacteria 7507281
326 2571531272 2571042143 Bacteria 6986194
327 2617350715 2617270735 Bacteria 9163226
328 2723602759 2721755693 Bacteria 6126117
329 2728533111 2728368933 Bacteria 7044283
330 2730138733 2728369359 Bacteria 5621728
331 2745082539 2744054633 Bacteria 8678936
332 2753808344 2751185905 Bacteria 6142767
333 2793077760
334 2802438917 2802428803 Bacteria 5806948
335 2805914773 2802429603 Bacteria 8777136
336 2821446741 2821443989 Bacteria 7658172
337 2821450099 2821443989 Bacteria 7658172
338 2824608359 2824600985 Bacteria 8488197
339 2824616746 2824609381 Bacteria 8672835
340 2824663212 2824661429 Bacteria 9877870
341 2841962532 2841957949 Bacteria 8652217
342 2842042973 2842038055 Bacteria 8002051
343 2842043033 2842038055 Bacteria 8002051
344 2842051014 2842045827 Bacteria 8006841
345 2842051074 2842045827 Bacteria 8006841
346 2842301596 2842298080 Bacteria 6123127
347 2842333342 2842333319 Bacteria 8899485
348 2842360697 2842357229 Bacteria 6485165
349 2844534706 2844533157 Bacteria 7517899
350 2844536665 2844533157 Bacteria 7517899
351 2847932390 2847930680 Bacteria 9342022
352 2847947140 2847939898 Bacteria 8606328
353 2851185705 2851182111 Bacteria 6047226
354 2874592607 2874590934 Bacteria 8299676
355 2874647431 2874645413 Bacteria 8214782
356 2876763103 2876761206 Bacteria 10111113
357 2876772731 2876771140 Bacteria 8287509
358 2876820064 2876818435 Bacteria 8274608
359 2879076569 2879074833 Bacteria 8279565
360 2879104184 2879099564 Bacteria 10442239
361 2879129202 2879127579 Bacteria 8294491
362 2879144841 2879142872 Bacteria 8267021
363 2881668902 2881665667 Bacteria 8175609
364 2881670781 2881665667 Bacteria 8175609
365 2885374506 2885366525 Bacteria 8326213
366 2885386034 2885383462 Bacteria 9473874
367 2885417803 2885409591 Bacteria 9235467
368 2889042435 2889033259 Bacteria 9099371
369 2889278718 2889276214 Bacteria 5979355
370 2899808566 2899803654 Bacteria 5577784
371 2903735068 2903727486 Bacteria 8281579
372 2903751892 2903748898 Bacteria 9972761
373 2903775611 2903768456 Bacteria 9749579
374 2904598677 2904595352 Bacteria 6124848
375 2904692984 2904690495 Bacteria 9412302
376 2904706642
377 2906604184 2906602504 Bacteria 8295279
378 2906630455 2906626472 Bacteria 8826946
379 2906639867 2906635258 Bacteria 8601019
380 2906645808 2906643746 Bacteria 8722424
381 2906662663 2906660503 Bacteria 8595048
382 2908746363 2908739725 Bacteria 8628932
383 2908757992 2908756301 Bacteria 8864324
384 2917702204 2917699015 Bacteria 7043791
385 2929620817 2929615660 Bacteria 9193770
386 2929626711 2929624759 Bacteria 9339455
387 2932784422 2932784394 Bacteria 9704911
388 2932809404 2932809354 Bacteria 9135765
389 2932818853 2932818245 Bacteria 9955613
390 2932828192 2932828146 Bacteria 9745859
391 2933582731 2933577622 Bacteria 9116884
392 2935617166 2935616580 Bacteria 9032984
393 2935639353 2935638405 Bacteria 10015038
394 2935654750 2935648319 Bacteria 8801166
395 2935663630 2935656913 Bacteria 8965014
396 2935665796 2935665750 Bacteria 9571747
397 2935675441 2935675223 Bacteria 9928132
398 2935685547 2935684952 Bacteria 9590419
399 2935698796 2935694250 Bacteria 9291695
400 2935704360 2935703347 Bacteria 10242284
401 2935714100 2935713505 Bacteria 9608509
402 2935724719 2935722832 Bacteria 9608746
403 2935732923 2935732158 Bacteria 9706831
404 2935742302 2935741537 Bacteria 9707219
405 2935751512 2935750917 Bacteria 9590372
406 2935765715 2935760218 Bacteria 9817913
407 2935802443 2935801545 Bacteria 9301974
408 2935828848 2935827899 Bacteria 10038562
409 2935840222 2935837841 Bacteria 9454360
410 2935855791 2935855204 Bacteria 9035059
411 2935866266 2935864058 Bacteria 9784707
412 2935877408 2935873716 Bacteria 9632195
413 2935983131 2935975950 Bacteria 8347125
414 2935985241 2935984226 Bacteria 8302647
415 2935992353 2935992306 Bacteria 9802711
416 2936002225 2936002035 Bacteria 9362176
417 2936017786 2936011229 Bacteria 8801034
418 2936026289 2936019824 Bacteria 8804134
419 2936035036 2936028420 Bacteria 8965941
420 2936037313 2936037263 Bacteria 9446081
421 2936053207 2936046547 Bacteria 8903709
422 2936056997 2936055302 Bacteria 8785755
423 2938651312 2938649242 Bacteria 7118381
424 2940557686 2940556831 Bacteria 9590747
425 2941537390 2941531003 Bacteria 7653939
426 2941540437 2941538514 Bacteria 9402094
427 2954011699 2954011201 Bacteria 4762601
428 2968561881 2968558590 Bacteria 6956864
429 2996313485 2996310559 Bacteria 6357320
430 2996634064 2996632988 Bacteria 6921523
431 2996709122 2996706504 Bacteria 5757485
432 3005486023 3005483717 Bacteria 7877331
433 3005596818 3005594810 Bacteria 8716512
434 3005720185 3005718088 Bacteria 8283608
435 648169101 648028048 Bacteria 5394884
436 8006937772 8006933436 Bacteria 10410654
437 8006977800 8006973647 Bacteria 10679141
438 8006985717 8006984368 Bacteria 9651211
439 8016589951 8016583857 Bacteria 10421953
440 8016608703 8016603502 Bacteria 8731218
441 8016616172 8016613128 Bacteria 8794220
442 8016635339 8016630954 Bacteria 9217207
443 8017064277 8017057580 Bacteria 10023680
444 8019546600 8019538911 Bacteria 7872763
445 8019558076 8019555841 Bacteria 9642137
446 8019567213 8019565922 Bacteria 9639779
447 8019583622 8019576017 Bacteria 10049540
448 8019591432 8019586578 Bacteria 10212056
449 8019599907 8019597564 Bacteria 10041141
450 8019618639 8019608314 Bacteria 10042931
451 8019623255 8019619141 Bacteria 9218857
452 8019629840 8019629233 Bacteria 8687553
453 8019640775 8019638758 Bacteria 9062356
454 8019649673 8019648815 Bacteria 10014479
455 8019666679 8019659431 Bacteria 8577854
456 8019676441 8019668869 Bacteria 8791617
457 8019679897 8019678201 Bacteria 8863603
458 8054465686 8054465665 Bacteria 7323556
459 8055745678 8055742211 Bacteria 9226248
460 8056973070 8056967851 Bacteria 9038162
461 Ga0495603_0008522
462 JGI25153J46596_10045637
463 JGI25160J50197_1031394
464 JGI25404J52841_10021532
465 Ga0055531_10035334
466 Ga0070666_10054985
467 Ga0068868_100321909
468 Ga0070668_100023040
469 Ga0070671_100049506
470 Ga0070667_100002698
471 Ga0070667_100579394
472 Ga0070709_10000609
473 Ga0070714_100010925
474 Ga0070714_100012268
475 Ga0070713_100015089
476 Ga0070710_10000144
477 Ga0070711_100084175
478 Ga0070698_100752178
479 Ga0070699_100252076
480 Ga0068853_100102272
481 Ga0070665_100011217
482 Ga0068852_100003420
483 Ga0068852_100554462
484 Ga0068859_100249654
485 Ga0068864_100006013
486 Ga0068863_100010184
487 Ga0068863_100538075
488 Ga0068858_100083161
489 Ga0068862_100288868
490 Ga0081455_10002274
491 Ga0081455_10012682
492 Ga0081455_10083138
493 Ga0081538_10101186
494 Ga0081540_1001170
495 Ga0081540_1002809
496 Ga0081540_1006898
497 Ga0081540_1008494
498 Ga0081540_1017586
499 Ga0081540_1040185
500 Ga0081539_10141425
501 Ga0075365_10000025
502 Ga0075364_10289101
503 Ga0070712_100004935
504 Ga0075367_10003271
505 Ga0075367_10269349
506 Ga0075369_10009421
507 Ga0075370_10000361
508 Ga0075370_10131097
509 Ga0075370_10141645
510 Ga0075434_100033534
511 Ga0068865_100388630
512 Ga0097620_100249660
513 Ga0105240_10240179
514 Ga0111539_10002647
515 Ga0111539_10274564
516 Ga0105245_10178696
517 Ga0105247_10005208
518 Ga0114129_10384116
519 Ga0105243_10237971
520 Ga0105241_10024389
521 Ga0105241_10034151
522 Ga0105242_10137229
523 Ga0105237_10004480
524 Ga0105237_10041708
525 Ga0105237_10160702
526 Ga0105237_10161146
527 Ga0105237_10320032
528 Ga0105237_10643803
529 Ga0105249_10391495
530 Ga0105033_107077
531 Ga0105035_106948
532 Ga0105239_10033350
533 Ga0105239_10312818
534 Ga0105239_10778438
535 Ga0157378_10501137
536 Ga0163162_10090213
537 Ga0157379_10050746
538 Ga0214544_1023343
539 Ga0214542_1009367
540 Ga0213872_10001698
541 Ga0213872_10033029
542 Ga0209148_1000192
543 Ga0209148_1001171
544 Ga0209233_1010089
545 Ga0209455_1000196
546 Ga0209130_1004312
547 Ga0209676_1013903
548 Ga0209025_1000282
549 Ga0209758_1001866
550 Ga0207426_1000358
551 Ga0207426_1013751
552 Ga0209257_1000266
553 Ga0207692_10000215
554 Ga0207710_10090664
555 Ga0207685_10055701
556 Ga0207699_10001468
557 Ga0207684_10326208
558 Ga0207654_10271264
559 Ga0207695_10000008
560 Ga0207671_10041477
561 Ga0207671_10064195
562 Ga0207671_10294842
563 Ga0207693_10009787
564 Ga0207663_10062266
565 Ga0207657_10024174
566 Ga0207700_10132518
567 Ga0207664_10031599
568 Ga0207690_10234414
569 Ga0207669_10035024
570 Ga0207679_10432536
571 Ga0207667_10195930
572 Ga0207712_10240089
573 Ga0207658_10000596
574 Ga0207677_10041863
575 Ga0207639_10100919
576 Ga0207678_10015867
577 Ga0207678_10231771
578 Ga0207648_10370758
579 Ga0207675_100350033
580 Ga0207698_10476837
581 Ga0209371_1038005
582 Ga0207428_10000086
583 Ga0268265_10313468
584 Ga0268265_10519208
585 Ga0268264_10253803
586 Ga0307515_10079886
587 Ga0307515_10250292
588 Ga0268256_1042762
589 Ga0307511_10030724
590 Ga0307509_10005194
591 Ga0307509_10046512
592 Ga0307509_10090709
593 Ga0307509_10170359
594 Ga0307509_10435602
595 Ga0307508_10000092
596 Ga0307508_10027425
597 Ga0307508_10085997
598 Ga0307508_10276420
599 Ga0307516_10313950
600 Ga0307413_10073263
601 Ga0307406_10030481
602 Ga0307507_10007638
603 Ga0307510_10069266
604 Ga0373934_0035118
605 Ga0373923_0162658
606 Ga0373936_0094566
607 Ga0373935_0008154
608 Ga0373935_0008610
609 Ga0373927_0003672
610 Ga0373927_0003977
611 Ga0373927_0051903
612 Ga0373947_0118657
613 Ga0373925_0006499
614 Ga0373925_0082982
615 Ga0395900_0374138
616 Ga0395905_0006978
617 Ga0395905_0061917
618 Ga0395905_0233362
619 Ga0395901_0167126
620 Ga0436361_0092959
621 Ga0436361_0279127
622 Ga0436361_1154780
623 Ga0451802_2175089
624 Ga0439445_0018637
625 Ga0466972_0024962
626 Ga0466961_0278320
627 Ga0466967_0162270
628 Ga0495629_0001177
629 Ga0495651_0111876
630 Ga0495580_0016566
631 Ga0495664_0102148
632 Ga0495606_0144461
633 Ga0495610_0014555
634 Ga0495643_0003992
635 Ga0495643_0148851
636 Ga0495648_0042874
637 Ga0495648_0070914
638 Ga0495666_0004954
639 Ga0495652_0009551
640 Ga0495652_0192480
641 Ga0495665_0005458
642 Ga0495640_0037222
643 Ga0495622_0029963
644 Ga0495668_0128706
645 Ga0495634_0120291
646 Ga0495611_0146561
647 Ga0495625_0087193
648 Ga0495635_0000978
649 Ga0495658_0335868
650 Ga0495613_0215450
651 Ga0495649_0063321
652 Ga0495600_0013410
653 Ga0495604_0000626
654 Ga0495672_0091288
655 Ga0495676_0249574
656 Ga0495687_069917
657 Ga0495673_0052545
658 Ga0495602_0316354
659 Ga0496101_0208248
660 Ga0496102_0085483
661 Ga0496102_0356047
662 Ga0496103_0119254
663 Ga0496112_0363933
664 Ga0496116_0001518
665 Ga0496116_0004051
666 Ga0496116_0005221
667 Ga0496116_0036947
668 Ga0496116_0038665
669 Ga0496117_0001723
670 Ga0496117_0059333
671 Ga0496118_0008273
672 Ga0496118_0019473
673 Ga0496118_0025468
674 Ga0496118_0026942
675 Ga0496118_0091909
676 Ga0496118_0129742
677 Ga0496118_0268136
678 Ga0496119_0000014
679 Ga0496119_0008850
680 Ga0496119_0010237
681 Ga0496119_0012063
682 Ga0496119_0032417
683 Ga0496120_0000007
684 Ga0496120_0000518
685 Ga0496120_0005076
686 Ga0496120_0008944
687 Ga0496120_0011537
688 Ga0496120_0044944
689 Ga0496121_0000698
690 Ga0496121_0008000
691 Ga0496121_0014821
692 Ga0496121_0027682
693 Ga0496121_0058815
694 Ga0496121_0126182
695 Ga0496121_0137885
696 Ga0496121_0153011
697 Ga0496122_0000014
698 Ga0496122_0008364
699 Ga0496122_0049492
700 Ga0496122_0111771
701 Ga0496123_0002036
702 Ga0496123_0041593
703 Ga0496123_0228859
704 Ga0496124_0000953
705 Ga0496124_0209883
706 Ga0496124_0372866
707 Ga0496125_0000073
708 Ga0496125_0002032
709 Ga0496125_0088329
710 Ga0496126_0000019
711 Ga0496126_0000265
712 Ga0496126_0020664
713 Ga0496126_0030820
714 Ga0496126_0067493
715 Ga0495682_0011455
716 Ga0501034_0039309
717 Ga0501034_0062744
718 Ga0501038_0610258
719 Ga0501043_0031375
720 Ga0501047_0006680
721 Ga0501070_0061085
722 Ga0501070_0242482
723 Ga0501073_0102923
724 Ga0501074_0400087
725 Ga0501080_0051844
726 Ga0501083_0017351
727 Ga0501044_0015452
728 nmdc:mga0yw44_18_c1
729 nmdc:mga06z11_161375_c1
730 nmdc:mga06z11_62_c1
731 nmdc:mga06z11_84964_c1
732 nmdc:mga07m45_176_c1
733 nmdc:mga08y16_268_c1
734 nmdc:mga08y16_283036_c1
735 nmdc:mga0n895_96199_c1
736 nmdc:mga0a205_185668_c1
737 nmdc:mga0sz30_82_c1
738 Ga0495612_0141905
739 Ga0500610_0000070
740 Ga0500635_0007279
741 Ga0500578_0060521
742 Ga0500646_0009466
743 Ga0500647_0079273
744 Ga0500583_0079292
745 Ga0500583_0233686
746 Ga0500651_0007918
747 Ga0500566_0113618
748 Ga0500566_0158977
749 Ga0500566_0182760
750 Ga0500650_0094626
751 Ga0500595_041005
752 Ga0500607_151842
753 Ga0500642_0004561
754 Ga0500642_0132071
755 Ga0500658_0026710
756 Ga0500658_0103996
757 Ga0500568_0057033
758 Ga0500588_0005065
759 Ga0500588_0023011
760 Ga0500590_033185
761 Ga0500603_049559
762 Ga0500604_0002121
763 Ga0500604_0011415
764 Ga0500633_0153402
765 Ga0500639_009928
766 Ga0500639_060412
767 Ga0500636_0004336
768 Ga0500636_0004708
769 Ga0500636_0107978
770 Ga0500636_0207556
771 Ga0500637_0022523
772 Ga0500609_000059
773 Ga0501082_0019171
774 2507505532
775 2508695747
776 2513670731
777 2513692225
778 2513721669
779 2513873238
780 2515630172
781 2517104661
782 2524442639
783 2524459800
784 2524538307
785 2550904485
786 2571531272
787 2617350715
788 2723602759
789 2728533111
790 2730138733
791 2745082539
792 2753808344
793 2793077760
794 2802438917
795 2805914773
796 2821446741
797 2821450099
798 2824608359
799 2824616746
800 2824663212
801 2841962532
802 2842042973
803 2842043033
804 2842051014
805 2842051074
806 2842301596
807 2842333342
808 2842360697
809 2844534706
810 2844536665
811 2847932390
812 2847947140
813 2851185705
814 2874592607
815 2874647431
816 2876763103
817 2876772731
818 2876820064
819 2879076569
820 2879104184
821 2879129202
822 2879144841
823 2881668902
824 2881670781
825 2885374506
826 2885386034
827 2885417803
828 2889042435
829 2889278718
830 2899808566
831 2903735068
832 2903751892
833 2903775611
834 2904598677
835 2904692984
836 2904706642
837 2906604184
838 2906630455
839 2906639867
840 2906645808
841 2906662663
842 2908746363
843 2908757992
844 2917702204
845 2929620817
846 2929626711
847 2932784422
848 2932809404
849 2932818853
850 2932828192
851 2933582731
852 2935617166
853 2935639353
854 2935654750
855 2935663630
856 2935665796
857 2935675441
858 2935685547
859 2935698796
860 2935704360
861 2935714100
862 2935724719
863 2935732923
864 2935742302
865 2935751512
866 2935765715
867 2935802443
868 2935828848
869 2935840222
870 2935855791
871 2935866266
872 2935877408
873 2935983131
874 2935985241
875 2935992353
876 2936002225
877 2936017786
878 2936026289
879 2936035036
880 2936037313
881 2936053207
882 2936056997
883 2938651312
884 2940557686
885 2941537390
886 2941540437
887 2954011699
888 2968561881
889 2996313485
890 2996634064
891 2996709122
892 3005486023
893 3005596818
894 3005720185
895 648169101
896 8006937772
897 8006977800
898 8006985717
899 8016589951
900 8016608703
901 8016616172
902 8016635339
903 8017064277
904 8019546600
905 8019558076
906 8019567213
907 8019583622
908 8019591432
909 8019599907
910 8019618639
911 8019623255
912 8019629840
913 8019640775
914 8019649673
915 8019666679
916 8019676441
917 8019679897
918 8054465686
919 8055745678
920 8056973070

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06314

ADC

Acetoacetate decarboxylase (ADC)

46

278

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c8w-assembly1.cif.gz_A crystal structure of acetoacetate decarboxylase (adc) (yp_094708.1) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.60 a resolution 0.9834 17 245
3bgt-assembly1.cif.gz_D structural studies of acetoacetate decarboxylase 0.9594 1 244
3bgt-assembly1.cif.gz_D structural studies of acetoacetate decarboxylase 0.9518 1 244
3bh2-assembly1.cif.gz_A structural studies of acetoacetate decarboxylase 0.9416 1 245
3bh2-assembly1.cif.gz_A structural studies of acetoacetate decarboxylase 0.9378 1 245
ID Description Score Start End Superfamily
3bgtC01 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.9797 14 244 2.40.400.10
3bgtC01 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.9754 14 244 2.40.400.10
4zbtD00 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.8909 16 242 2.40.400.10
4jmcB00 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.874 11 243 2.40.400.10
3cmbA00 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.8624 20 239 2.40.400.10
ID Description Score Start End GO Terms
AF-A0A352SAK1-F1-model_v4 Acetoacetate decarboxylase (EC 4.1.1.4) 0.9955 48 245 GO:0047602
AF-A0A211ZJP5-F1-model_v4 Acetoacetate decarboxylase 0.9939 77 245 GO:0016829
AF-A0A529LHI8-F1-model_v4 Acetoacetate decarboxylase (EC 4.1.1.4) 0.9929 32 147 GO:0047602
AF-A0A535EX24-F1-model_v4 Acetoacetate decarboxylase (EC 4.1.1.4) 0.9922 98 244 GO:0047602
AF-A0A257PF19-F1-model_v4 Acetoacetate decarboxylase 0.9911 33 245 GO:0016829

Map