F448549

General Info

Members Datasets Scaffolds Average Seq Length
460 272 460 118

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10385273|Ga0157380_103852733
Length 105
Sequence MTDKIKLVAAVLLVALGIWGYYRLGDSALVLRILAWWSEPGKQFAVFAGEAIEEVKKVVWPTRKETMQTTAAVFAFVVVMAVFLWLTDKTLEWALYDLILGWKKT

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
135 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
142 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
143 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
144 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
155 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
156 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
157 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
166 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
167 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
168 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
169 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
170 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
171 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
172 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
173 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
174 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
175 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
176 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
177 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
178 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
196 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
203 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
222 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
223 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
224 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
225 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
245 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
246 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
247 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
248 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
269 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
270 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.09
Nodule 0
Rhizoplane 0
Rhizosphere 98.48
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10309035 3300005289 Bacteria 865
2 Ga0065707_10137559 3300005295 Bacteria 1798
3 Ga0065707_10425700 3300005295 Bacteria 826
4 Ga0065707_10536195 3300005295 Bacteria 728
5 Ga0070676_10172435 3300005328 Bacteria 1400
6 Ga0070680_100672180 3300005336 Bacteria 891
7 Ga0070689_100113620 3300005340 Bacteria 2156
8 Ga0070689_100142292 3300005340 Bacteria 1929
9 Ga0070691_10035193 3300005341 Bacteria 2357
10 Ga0070687_100005966 3300005343 Bacteria 4958
11 Ga0070687_100133202 3300005343 Bacteria 1437
12 Ga0070687_100484370 3300005343 Bacteria 829
13 Ga0070687_100666855 3300005343 Bacteria 722
14 Ga0070692_10175134 3300005345 Bacteria 1239
15 Ga0070692_10192743 3300005345 Bacteria 1189
16 Ga0070692_10384510 3300005345 Bacteria 881
17 Ga0070668_100445338 3300005347 Bacteria 1112
18 Ga0070669_100114736 3300005353 Bacteria 2048
19 Ga0070675_100424377 3300005354 Bacteria 1189
20 Ga0070675_101784280 3300005354 Bacteria 568
21 Ga0070671_101539535 3300005355 Bacteria 589
22 Ga0070674_100017599 3300005356 Bacteria 4501
23 Ga0070674_101042765 3300005356 Bacteria 719
24 Ga0070673_100142021 3300005364 Bacteria 2026
25 Ga0070673_100340188 3300005364 Bacteria 1329
26 Ga0070673_101583648 3300005364 Bacteria 619
27 Ga0070659_101212141 3300005366 Bacteria 668
28 Ga0070703_10119027 3300005406 Bacteria 956
29 Ga0070703_10305496 3300005406 Bacteria 665
30 Ga0070710_10015838 3300005437 Bacteria 3823
31 Ga0070710_10336955 3300005437 Bacteria 995
32 Ga0070701_10030684 3300005438 Bacteria 2661
33 Ga0070701_10320777 3300005438 Bacteria 958
34 Ga0070711_100838073 3300005439 Bacteria 782
35 Ga0070705_100035743 3300005440 Bacteria 2787
36 Ga0070705_100097301 3300005440 Bacteria 1849
37 Ga0070705_101776196 3300005440 Bacteria 523
38 Ga0070700_100291475 3300005441 Bacteria 1187
39 Ga0070700_100580083 3300005441 Bacteria 875
40 Ga0070700_100799019 3300005441 Bacteria 759
41 Ga0070694_100033358 3300005444 Bacteria 3387
42 Ga0070694_100117820 3300005444 Bacteria 1901
43 Ga0070694_100942011 3300005444 Bacteria 714
44 Ga0068867_100271201 3300005459 Bacteria 1387
45 Ga0068867_100939204 3300005459 Bacteria 781
46 Ga0070685_10143130 3300005466 Bacteria 1508
47 Ga0070706_100876399 3300005467 Bacteria 830
48 Ga0070707_100629477 3300005468 Bacteria 1035
49 Ga0070698_100160741 3300005471 Bacteria 2190
50 Ga0070699_100005128 3300005518 Bacteria 11520
51 Ga0070679_100855777 3300005530 Bacteria 853
52 Ga0070684_100261003 3300005535 Bacteria 1585
53 Ga0070697_100254463 3300005536 Bacteria 1502
54 Ga0070697_101564199 3300005536 Bacteria 590
55 Ga0070672_101352083 3300005543 Bacteria 637
56 Ga0070686_100012586 3300005544 Bacteria 4822
57 Ga0070686_100381934 3300005544 Bacteria 1066
58 Ga0070686_100525962 3300005544 Bacteria 921
59 Ga0070686_100592300 3300005544 Bacteria 873
60 Ga0070695_100035895 3300005545 Bacteria 3116
61 Ga0070695_100697522 3300005545 Bacteria 805
62 Ga0070696_100626754 3300005546 Bacteria 869
63 Ga0070696_100667217 3300005546 Bacteria 844
64 Ga0070696_101755681 3300005546 Bacteria 535
65 Ga0070693_100080237 3300005547 Bacteria 1943
66 Ga0070704_100131166 3300005549 Bacteria 1942
67 Ga0070704_101800975 3300005549 Bacteria 566
68 Ga0068855_100179722 3300005563 Bacteria 2393
69 Ga0068857_100526419 3300005577 Bacteria 1111
70 Ga0068856_100128641 3300005614 Bacteria 2536
71 Ga0070702_100428896 3300005615 Bacteria 953
72 Ga0068852_101709380 3300005616 Bacteria 652
73 Ga0068859_100430124 3300005617 Bacteria 1416
74 Ga0068864_100032337 3300005618 Bacteria 4445
75 Ga0068864_100508935 3300005618 Bacteria 1159
76 Ga0068866_10590094 3300005718 Bacteria 748
77 Ga0068861_101197025 3300005719 Bacteria 734
78 Ga0068861_101354859 3300005719 Bacteria 693
79 Ga0068861_101812223 3300005719 Bacteria 605
80 Ga0068870_10547554 3300005840 Bacteria 779
81 Ga0068870_11263939 3300005840 Bacteria 537
82 Ga0068863_100439365 3300005841 Bacteria 1279
83 Ga0068858_100161792 3300005842 Bacteria 2108
84 Ga0068860_100059351 3300005843 Bacteria 3637
85 Ga0068862_100340725 3300005844 Bacteria 1389
86 Ga0068862_100611572 3300005844 Bacteria 1047
87 Ga0068862_100738819 3300005844 Bacteria 956
88 Ga0068862_100903138 3300005844 Bacteria 868
89 Ga0075364_10457104 3300006051 Bacteria 872
90 Ga0070716_100123324 3300006173 Bacteria 1626
91 Ga0075362_10213550 3300006177 Bacteria 941
92 Ga0075366_10242920 3300006195 Bacteria 1098
93 Ga0097621_100005707 3300006237 Bacteria 8794
94 Ga0068871_100137412 3300006358 Bacteria 2076
95 Ga0068871_101699237 3300006358 Bacteria 599
96 Ga0068871_102208549 3300006358 Bacteria 524
97 Ga0075428_100910824 3300006844 Bacteria 932
98 Ga0075430_100062166 3300006846 Bacteria 3137
99 Ga0075430_100176511 3300006846 Bacteria 1777
100 Ga0075430_100266117 3300006846 Bacteria 1419
101 Ga0075430_100271574 3300006846 Bacteria 1403
102 Ga0075430_100353996 3300006846 Bacteria 1212
103 Ga0075431_100032779 3300006847 Bacteria 5354
104 Ga0075431_100256808 3300006847 Bacteria 1774
105 Ga0075431_100401122 3300006847 Bacteria 1372
106 Ga0075431_100599729 3300006847 Bacteria 1085
107 Ga0075433_10081675 3300006852 Bacteria 2850
108 Ga0075433_11518190 3300006852 Bacteria 578
109 Ga0075433_11739548 3300006852 Bacteria 536
110 Ga0075434_100000108 3300006871 Bacteria 47506
111 Ga0075434_100017797 3300006871 Bacteria 6854
112 Ga0075434_101875256 3300006871 Bacteria 606
113 Ga0075434_102483388 3300006871 Bacteria 520
114 Ga0075429_100241145 3300006880 Bacteria 1583
115 Ga0075429_100287165 3300006880 Bacteria 1440
116 Ga0075429_101432455 3300006880 Bacteria 602
117 Ga0068865_100351947 3300006881 Bacteria 1193
118 Ga0075436_100004151 3300006914 Bacteria 9939
119 Ga0075436_100005987 3300006914 Bacteria 8351
120 Ga0075436_100312138 3300006914 Bacteria 1129
121 Ga0075436_100364894 3300006914 Bacteria 1042
122 Ga0075436_101077230 3300006914 Bacteria 604
123 Ga0097620_100430122 3300006931 Bacteria 1416
124 Ga0075435_100002462 3300007076 Bacteria 12302
125 Ga0075435_100111980 3300007076 Bacteria 2270
126 Ga0075435_100136068 3300007076 Bacteria 2058
127 Ga0075435_100181753 3300007076 Bacteria 1777
128 Ga0075435_101180941 3300007076 Bacteria 669
129 Ga0099794_10009256 3300007265 Bacteria 4131
130 Ga0099794_10407989 3300007265 Bacteria 710
131 Ga0099795_10346561 3300007788 Bacteria 663
132 Ga0111539_10163730 3300009094 Bacteria 2601
133 Ga0111539_10358423 3300009094 Bacteria 1697
134 Ga0111539_11172519 3300009094 Bacteria 892
135 Ga0111539_11473155 3300009094 Bacteria 789
136 Ga0111539_11944157 3300009094 Bacteria 682
137 Ga0114129_10084574 3300009147 Bacteria 4404
138 Ga0114129_10177943 3300009147 Bacteria 2896
139 Ga0114129_11070245 3300009147 Bacteria 1011
140 Ga0114129_11922223 3300009147 Bacteria 717
141 Ga0105243_10167260 3300009148 Bacteria 1901
142 Ga0105248_10816755 3300009177 Bacteria 1052
143 Ga0105248_12225055 3300009177 Bacteria 624
144 Ga0105249_10557105 3300009553 Bacteria 1197
145 Ga0099796_10096594 3300010159 Bacteria 1106
146 Ga0099796_10178310 3300010159 Bacteria 851
147 Ga0105239_12092281 3300010375 Bacteria 658
148 Ga0105246_11276690 3300011119 Bacteria 679
149 Ga0157337_1008558 3300012483 Bacteria 755
150 Ga0157378_10931828 3300013297 Bacteria 900
151 Ga0163162_11571172 3300013306 Bacteria 750
152 Ga0157372_13447944 3300013307 Bacteria 503
153 Ga0157375_11094575 3300013308 Bacteria 933
154 Ga0157380_10385273 3300014326 Bacteria 1324
155 Ga0157380_10992944 3300014326 Bacteria 872
156 Ga0157380_11526238 3300014326 Bacteria 722
157 Ga0157376_10302294 3300014969 Bacteria 1515
158 Ga0163161_10115095 3300017792 Bacteria 2015
159 Ga0207653_10216465 3300025885 Bacteria 726
160 Ga0207653_10266777 3300025885 Bacteria 659
161 Ga0207692_10046508 3300025898 Bacteria 2176
162 Ga0207642_10064024 3300025899 Bacteria 1722
163 Ga0207645_10074855 3300025907 Bacteria 2168
164 Ga0207643_10453797 3300025908 Bacteria 816
165 Ga0207684_10284392 3300025910 Bacteria 1426
166 Ga0207663_10654789 3300025916 Bacteria 829
167 Ga0207660_10167916 3300025917 Bacteria 1697
168 Ga0207660_10424941 3300025917 Bacteria 1072
169 Ga0207660_11075558 3300025917 Bacteria 656
170 Ga0207662_10486498 3300025918 Bacteria 848
171 Ga0207662_11330625 3300025918 Bacteria 510
172 Ga0207652_10967981 3300025921 Bacteria 749
173 Ga0207646_10151294 3300025922 Bacteria 2093
174 Ga0207681_10009582 3300025923 Bacteria 5919
175 Ga0207659_10116488 3300025926 Bacteria 2040
176 Ga0207690_10507641 3300025932 Bacteria 976
177 Ga0207686_10811840 3300025934 Bacteria 750
178 Ga0207709_10002389 3300025935 Bacteria 11836
179 Ga0207709_11066297 3300025935 Bacteria 662
180 Ga0207670_10379116 3300025936 Bacteria 1126
181 Ga0207670_11305766 3300025936 Bacteria 615
182 Ga0207704_10052138 3300025938 Bacteria 2478
183 Ga0207665_10240081 3300025939 Bacteria 1335
184 Ga0207691_10024076 3300025940 Bacteria 5726
185 Ga0207711_10678408 3300025941 Bacteria 961
186 Ga0207689_10763726 3300025942 Bacteria 816
187 Ga0207651_10227969 3300025960 Bacteria 1510
188 Ga0207651_11577334 3300025960 Bacteria 591
189 Ga0207712_10526495 3300025961 Bacteria 1014
190 Ga0207668_10190354 3300025972 Bacteria 1625
191 Ga0207640_10332722 3300025981 Bacteria 1214
192 Ga0207703_10994816 3300026035 Bacteria 804
193 Ga0207708_10178451 3300026075 Bacteria 1685
194 Ga0207708_11033115 3300026075 Bacteria 715
195 Ga0207708_11100049 3300026075 Bacteria 693
196 Ga0207641_10200741 3300026088 Bacteria 1838
197 Ga0207648_10027500 3300026089 Bacteria 5049
198 Ga0207648_11798249 3300026089 Bacteria 574
199 Ga0207648_12102749 3300026089 Bacteria 525
200 Ga0207676_10083750 3300026095 Bacteria 2598
201 Ga0207674_10458793 3300026116 Bacteria 1232
202 Ga0207675_100288940 3300026118 Bacteria 1595
203 Ga0207675_100847813 3300026118 Bacteria 929
204 Ga0207683_10419886 3300026121 Bacteria 1232
205 Ga0207698_10355884 3300026142 Bacteria 1385
206 Ga0209967_1011113 3300027364 Bacteria 1260
207 Ga0209981_1000418 3300027378 Bacteria 5415
208 Ga0210000_1020122 3300027462 Bacteria 1017
209 Ga0209999_1010072 3300027543 Bacteria 1707
210 Ga0209970_1037616 3300027614 Bacteria 855
211 Ga0209983_1089930 3300027665 Bacteria 691
212 Ga0209588_1044459 3300027671 Bacteria 1436
213 Ga0209971_1137408 3300027682 Bacteria 602
214 Ga0209966_1014089 3300027695 Bacteria 1488
215 Ga0209966_1017909 3300027695 Bacteria 1353
216 Ga0209974_10014768 3300027876 Bacteria 2594
217 Ga0207428_10044307 3300027907 Bacteria 3590
218 Ga0207428_10070569 3300027907 Bacteria 2746
219 Ga0207428_10130938 3300027907 Bacteria 1919
220 Ga0207428_10684680 3300027907 Bacteria 734
221 Ga0268265_11274258 3300028380 Bacteria 734
222 Ga0268264_10053231 3300028381 Bacteria 3376
223 Ga0268264_11696108 3300028381 Bacteria 642
224 Ga0307517_10541244 3300028786 Bacteria 584
225 Ga0265328_10295526 3300031239 Bacteria 625
226 Ga0307408_100061611 3300031548 Bacteria 2739
227 Ga0307408_101330855 3300031548 Bacteria 674
228 Ga0307413_10588004 3300031824 Bacteria 909
229 Ga0307406_11151292 3300031901 Bacteria 672
230 Ga0307416_100621845 3300032002 Bacteria 1162
231 Ga0307416_102566924 3300032002 Bacteria 607
232 Ga0307411_10261676 3300032005 Bacteria 1366
233 Ga0373950_0047224 3300034818 Bacteria 838
234 Ga0373958_0090102 3300034819 Bacteria 706
235 Ga0373951_0025490 3300035091 Bacteria 1374
236 Ga0373923_0348873 3300035111 Bacteria 706
237 Ga0373923_0625016 3300035111 Bacteria 531
238 Ga0373939_0263416 3300035114 Bacteria 675
239 Ga0373941_0196245 3300035115 Bacteria 765
240 Ga0373941_0450100 3300035115 Bacteria 540
241 Ga0373953_0015021 3300035117 Bacteria 2797
242 Ga0373953_0182170 3300035117 Bacteria 906
243 Ga0373954_0000137 3300035118 Bacteria 25393
244 Ga0373954_0012198 3300035118 Bacteria 3821
245 Ga0373956_0042978 3300035119 Bacteria 2011
246 Ga0373956_0149732 3300035119 Bacteria 1098
247 Ga0373960_0329403 3300035121 Bacteria 574
248 Ga0373943_0377574 3300035170 Bacteria 815
249 Ga0373946_0017017 3300035171 Bacteria 2776
250 Ga0373955_0016001 3300035172 Bacteria 3684
251 Ga0373942_0136684 3300035207 Bacteria 777
252 Ga0373942_0138459 3300035207 Bacteria 773
253 Ga0373942_0288194 3300035207 Bacteria 567
254 Ga0373961_0102166 3300035241 Bacteria 929
255 Ga0373962_0156465 3300035242 Bacteria 749
256 Ga0373924_0590758 3300035410 Bacteria 501
257 Ga0373931_0054464 3300035691 Bacteria 2138
258 Ga0373931_0055426 3300035691 Bacteria 2121
259 Ga0373935_0120999 3300035692 Bacteria 1749
260 Ga0373935_0282219 3300035692 Bacteria 1169
261 Ga0373935_1119274 3300035692 Bacteria 586
262 Ga0373927_0161386 3300035695 Bacteria 1468
263 Ga0373933_0080339 3300035724 Bacteria 1998
264 Ga0373933_0145439 3300035724 Bacteria 1499
265 Ga0373933_0175374 3300035724 Bacteria 1365
266 Ga0373937_0003113 3300036401 Bacteria 13870
267 Ga0373937_0016478 3300036401 Bacteria 6565
268 Ga0373937_0321729 3300036401 Bacteria 1463
269 Ga0373925_0340469 3300037068 Bacteria 1216
270 Ga0436360_0212210 3300039438 Bacteria 864
271 Ga0439439_0089909 3300041406 Bacteria 838
272 Ga0439453_0008422 3300041408 Bacteria 1657
273 Ga0439466_0106342 3300041411 Bacteria 872
274 Ga0451845_0241010 3300041501 Bacteria 599
275 Ga0439433_0009905 3300041999 Bacteria 2081
276 Ga0439441_000269 3300042001 Bacteria 5099
277 Ga0439441_103888 3300042001 Bacteria 639
278 Ga0439443_031463 3300042003 Bacteria 876
279 Ga0439443_033187 3300042003 Bacteria 858
280 Ga0450894_010093 3300042131 Bacteria 1224
281 Ga0450896_012491 3300042133 Bacteria 1202
282 Ga0439446_0025965 3300042156 Bacteria 1676
283 Ga0439446_0118209 3300042156 Bacteria 851
284 Ga0439446_0365942 3300042156 Bacteria 516
285 Ga0439434_0016539 3300042435 Bacteria 2204
286 Ga0439435_0005383 3300042436 Bacteria 2813
287 Ga0439435_0140830 3300042436 Bacteria 768
288 Ga0439444_0002683 3300042437 Bacteria 2456
289 Ga0439460_0085373 3300042461 Bacteria 996
290 Ga0451577_0129911 3300042876 Bacteria 2259
291 Ga0451577_0250739 3300042876 Bacteria 1602
292 Ga0453683_0520145 3300044673 Bacteria 773
293 Ga0453683_0776731 3300044673 Bacteria 630
294 Ga0453684_0200323 3300044712 Bacteria 2328
295 Ga0451576_0061023 3300045051 Bacteria 3932
296 Ga0451576_0147230 3300045051 Bacteria 2455
297 Ga0451576_0708232 3300045051 Bacteria 1058
298 Ga0451576_0811624 3300045051 Bacteria 982
299 Ga0495592_0001459 3300046454 Bacteria 16431
300 Ga0495629_0213398 3300046459 Bacteria 1333
301 Ga0495641_0177712 3300046461 Bacteria 953
302 Ga0495651_0168529 3300046462 Bacteria 1562
303 Ga0495653_0894807 3300046463 Bacteria 529
304 Ga0495662_0081887 3300046476 Bacteria 1570
305 Ga0495664_0420339 3300046477 Bacteria 802
306 Ga0495594_0748127 3300046499 Bacteria 552
307 Ga0495608_0014358 3300046511 Bacteria 5496
308 Ga0495618_0369164 3300046514 Bacteria 882
309 Ga0495628_0007233 3300046516 Bacteria 9614
310 Ga0495628_0195791 3300046516 Bacteria 1525
311 Ga0495630_0106327 3300046517 Bacteria 2125
312 Ga0495630_0283251 3300046517 Bacteria 1266
313 Ga0495630_0589669 3300046517 Bacteria 852
314 Ga0495632_0458747 3300046519 Bacteria 552
315 Ga0495663_0104184 3300046525 Bacteria 937
316 Ga0495666_0064350 3300046526 Bacteria 1750
317 Ga0495652_0078729 3300046529 Bacteria 2727
318 Ga0495640_0001548 3300046533 Bacteria 18112
319 Ga0495586_0000357 3300046535 Bacteria 28588
320 Ga0495587_0025483 3300046536 Bacteria 3614
321 Ga0495598_0101589 3300046537 Bacteria 952
322 Ga0495621_0081966 3300046539 Bacteria 1204
323 Ga0495621_0131079 3300046539 Bacteria 975
324 Ga0495621_0420243 3300046539 Bacteria 569
325 Ga0495645_0460621 3300046543 Bacteria 800
326 Ga0495667_0670782 3300046559 Bacteria 643
327 Ga0495634_0073672 3300046642 Bacteria 2245
328 Ga0495634_0526811 3300046642 Bacteria 691
329 Ga0495635_0449496 3300046663 Bacteria 852
330 Ga0495635_1095244 3300046663 Bacteria 504
331 Ga0495659_0215660 3300046664 Bacteria 791
332 Ga0495657_0030714 3300046675 Bacteria 3760
333 Ga0495599_0289701 3300046678 Bacteria 990
334 Ga0495646_0210927 3300046680 Bacteria 1054
335 Ga0495658_0465116 3300046683 Bacteria 808
336 Ga0495669_0165969 3300046684 Bacteria 1049
337 Ga0495613_0017571 3300046689 Bacteria 5327
338 Ga0495600_0205758 3300046809 Bacteria 1262
339 Ga0495581_0335891 3300047315 Bacteria 882
340 Ga0495604_0038956 3300047317 Bacteria 3737
341 Ga0495604_0255365 3300047317 Bacteria 1193
342 Ga0495674_1138385 3300047319 Bacteria 592
343 Ga0495680_0001930 3300047322 Bacteria 21801
344 Ga0495680_0380887 3300047322 Bacteria 977
345 Ga0495684_0502971 3300047471 Bacteria 833
346 Ga0495593_0192147 3300047673 Bacteria 1027
347 Ga0501291_098278 3300049514 Bacteria 607
348 Ga0501296_006584 3300049519 Bacteria 1320
349 Ga0501298_076232 3300049521 Bacteria 731
350 Ga0501299_005557 3300049522 Bacteria 1942
351 Ga0501031_0718074 3300049568 Bacteria 641
352 Ga0501033_0777888 3300049570 Bacteria 648
353 Ga0501033_0849660 3300049570 Bacteria 615
354 Ga0501037_0622345 3300049573 Bacteria 723
355 Ga0501038_0245188 3300049574 Bacteria 1421
356 Ga0501038_0699915 3300049574 Bacteria 759
357 Ga0501039_0030765 3300049575 Bacteria 4139
358 Ga0501039_0130232 3300049575 Bacteria 1974
359 Ga0501039_1169730 3300049575 Bacteria 595
360 Ga0501040_0773707 3300049576 Bacteria 694
361 Ga0501041_0265831 3300049577 Bacteria 1079
362 Ga0501041_0548576 3300049577 Bacteria 736
363 Ga0501042_0105145 3300049578 Bacteria 2031
364 Ga0501042_0955291 3300049578 Bacteria 624
365 Ga0501043_0281767 3300049579 Bacteria 1274
366 Ga0501046_0000238 3300049580 Bacteria 56798
367 Ga0501046_0084965 3300049580 Bacteria 2440
368 Ga0501046_0086061 3300049580 Bacteria 2423
369 Ga0501048_0154133 3300049582 Bacteria 1625
370 Ga0501048_0651750 3300049582 Bacteria 756
371 Ga0501048_1061674 3300049582 Bacteria 583
372 Ga0501068_0507591 3300049584 Bacteria 782
373 Ga0501071_0188483 3300049587 Bacteria 1546
374 Ga0501071_0663697 3300049587 Bacteria 802
375 Ga0501072_0096730 3300049588 Bacteria 2346
376 Ga0501072_0107939 3300049588 Bacteria 2214
377 Ga0501074_0224238 3300049590 Bacteria 1338
378 Ga0501074_0419630 3300049590 Bacteria 949
379 Ga0501075_0003230 3300049591 Bacteria 10903
380 Ga0501075_0933550 3300049591 Bacteria 659
381 Ga0501075_1050314 3300049591 Bacteria 619
382 Ga0501076_0007714 3300049592 Bacteria 7839
383 Ga0501076_0849561 3300049592 Bacteria 753
384 Ga0501076_1270672 3300049592 Bacteria 605
385 Ga0501077_0014839 3300049593 Bacteria 4898
386 Ga0501077_1019510 3300049593 Bacteria 532
387 Ga0501209_064244 3300049656 Bacteria 1031
388 Ga0501216_135352 3300049660 Bacteria 575
389 Ga0501227_026990 3300049665 Bacteria 1357
390 Ga0501249_095269 3300049679 Bacteria 709
391 Ga0501261_057237 3300049690 Bacteria 654
392 Ga0501079_0106150 3300049741 Bacteria 2179
393 Ga0501080_0106951 3300049742 Bacteria 2592
394 Ga0501080_0913129 3300049742 Bacteria 765
395 Ga0501080_1478419 3300049742 Bacteria 578
396 Ga0501081_0163800 3300049743 Bacteria 1603
397 Ga0501081_0277480 3300049743 Bacteria 1226
398 Ga0501083_0192113 3300049744 Bacteria 1332
399 Ga0501264_032185 3300049761 Bacteria 608
400 Ga0501035_0228062 3300049822 Bacteria 1588
401 Ga0501035_1385755 3300049822 Bacteria 539
402 Ga0501045_0045519 3300049824 Bacteria 3194
403 Ga0501045_0172440 3300049824 Bacteria 1611
404 Ga0501045_0860039 3300049824 Bacteria 667
405 Ga0501045_1057677 3300049824 Bacteria 594
406 nmdc:mga03683_126992_c1 3300050489 Bacteria 1138
407 nmdc:mga0k408_390882_c1 3300050493 Bacteria 828
408 nmdc:mga05p37_1021482_c1 3300050507 Bacteria 876
409 nmdc:mga05p37_1520294_c1 3300050507 Bacteria 665
410 nmdc:mga05p37_2016436_c1 3300050507 Bacteria 545
411 nmdc:mga05p37_280386_c1 3300050507 Bacteria 1988
412 nmdc:mga09592_1228898_c1 3300050508 Bacteria 618
413 nmdc:mga09592_1320053_c1 3300050508 Bacteria 592
414 nmdc:mga09592_439004_c1 3300050508 Bacteria 1127
415 nmdc:mga09592_819059_c1 3300050508 Bacteria 787
416 nmdc:mga09592_868937_c1 3300050508 Bacteria 760
417 nmdc:mga0qj67_20252_c1 3300050509 Bacteria 5091
418 nmdc:mga0qj67_204684_c1 3300050509 Bacteria 1603
419 nmdc:mga0qj67_818481_c1 3300050509 Bacteria 737
420 nmdc:mga0qj67_97052_c1 3300050509 Bacteria 2373
421 nmdc:mga06r32_1018954_c1 3300050510 Bacteria 780
422 nmdc:mga06r32_120453_c1 3300050510 Bacteria 2588
423 nmdc:mga06r32_1487463_c1 3300050510 Bacteria 618
424 nmdc:mga06r32_153333_c1 3300050510 Bacteria 2284
425 nmdc:mga06r32_308993_c1 3300050510 Bacteria 1567
426 nmdc:mga08y16_144611_c1 3300050511 Bacteria 2472
427 nmdc:mga08y16_1542684_c1 3300050511 Bacteria 624
428 nmdc:mga08y16_175248_c1 3300050511 Bacteria 2227
429 nmdc:mga08y16_210128_c1 3300050511 Bacteria 2016
430 nmdc:mga08y16_2178356_c1 3300050511 Bacteria 501
431 nmdc:mga08y16_56120_c1 3300050511 Bacteria 4117
432 nmdc:mga0n895_141626_c1 3300050512 Bacteria 2433
433 nmdc:mga0n895_4257_c1 3300050512 Bacteria 11707
434 nmdc:mga0n895_84_c1 3300050512 Bacteria 54345
435 nmdc:mga0rr50_1118570_c1 3300050513 Bacteria 670
436 nmdc:mga0rr50_1637_c1 3300050513 Bacteria 12325
437 nmdc:mga0rr50_221923_c1 3300050513 Bacteria 1561
438 nmdc:mga0rr50_337094_c1 3300050513 Bacteria 1267
439 nmdc:mga0rr50_61571_c1 3300050513 Bacteria 2828
440 nmdc:mga0rr50_63068_c1 3300050513 Bacteria 2798
441 nmdc:mga0rr50_729090_c1 3300050513 Bacteria 846
442 nmdc:mga08x19_19968_c1 3300050514 Bacteria 4121
443 nmdc:mga08x19_31088_c1 3300050514 Bacteria 3357
444 nmdc:mga08x19_640_c1 3300050514 Bacteria 22635
445 nmdc:mga08x19_849093_c1 3300050514 Bacteria 649
446 nmdc:mga08x19_96464_c1 3300050514 Bacteria 1957
447 nmdc:mga0a205_1228040_c1 3300050515 Bacteria 597
448 nmdc:mga0a205_570406_c1 3300050515 Bacteria 986
449 nmdc:mga0a205_828995_c1 3300050515 Bacteria 772
450 nmdc:mga0a205_8513_c1 3300050515 Bacteria 9328
451 Ga0495601_0038212 3300053077 Bacteria 3001
452 Ga0495595_0135716 3300053084 Bacteria 1205
453 Ga0501084_0123948 3300054114 Bacteria 2173
454 Ga0501084_0693018 3300054114 Bacteria 859
455 Ga0590071_061863 3300059421 Bacteria 916
456 Ga0590071_102095 3300059421 Bacteria 723
457 Ga0590071_119310 3300059421 Bacteria 673
458 Ga0501082_0470367 3300060353 Bacteria 1098
459 Ga0530510_0006411 3300061734 Bacteria 8196
460 Ga0530510_1103955 3300061734 Bacteria 608

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007265 Ga0099794_10407989 Ga0099794_104079892 100
2 3300059421 Ga0590071_119310 Ga0590071_119310_123_497 101
3 3300025910 Ga0207684_10284392 Ga0207684_102843923 103
4 3300014326 Ga0157380_10385273 Ga0157380_103852733 104
5 3300035207 Ga0373942_0288194 Ga0373942_0288194_63_446 104
6 3300046539 Ga0495621_0131079 Ga0495621_0131079_475_834 105
7 3300005406 Ga0070703_10305496 Ga0070703_103054962 106
8 3300005459 Ga0068867_100939204 Ga0068867_1009392041 106
9 3300005544 Ga0070686_100592300 Ga0070686_1005923003 106
10 3300005844 Ga0068862_100340725 Ga0068862_1003407253 106
11 3300006846 Ga0075430_100353996 Ga0075430_1003539962 106
12 3300009147 Ga0114129_10177943 Ga0114129_101779433 106
13 3300025885 Ga0207653_10266777 Ga0207653_102667772 106
14 3300027462 Ga0210000_1020122 Ga0210000_10201222 106
15 3300027543 Ga0209999_1010072 Ga0209999_10100722 106
16 3300027614 Ga0209970_1037616 Ga0209970_10376162 106
17 3300027695 Ga0209966_1014089 Ga0209966_10140893 106
18 3300027876 Ga0209974_10014768 Ga0209974_100147684 106
19 3300041408 Ga0439453_0008422 Ga0439453_0008422_261_611 106
20 3300042003 Ga0439443_031463 Ga0439443_031463_258_608 106
21 3300042437 Ga0439444_0002683 Ga0439444_0002683_1864_2214 106
22 3300042461 Ga0439460_0085373 Ga0439460_0085373_498_848 106
23 3300050507 nmdc:mga05p37_1021482_c1 nmdc:mga05p37_1021482_c1_230_580 106
24 3300050508 nmdc:mga09592_439004_c1 nmdc:mga09592_439004_c1_351_701 106
25 3300050510 nmdc:mga06r32_1487463_c1 nmdc:mga06r32_1487463_c1_128_478 106
26 3300006195 Ga0075366_10242920 Ga0075366_102429202 107
27 3300027378 Ga0209981_1000418 Ga0209981_10004183 107
28 3300049824 Ga0501045_0172440 Ga0501045_0172440_1060_1416 107
29 3300050493 nmdc:mga0k408_390882_c1 nmdc:mga0k408_390882_c1_315_668 107
30 3300006846 Ga0075430_100062166 Ga0075430_1000621663 109
31 3300007076 Ga0075435_100136068 Ga0075435_1001360683 109
32 3300049742 Ga0501080_1478419 Ga0501080_1478419_109_462 109
33 3300050509 nmdc:mga0qj67_20252_c1 nmdc:mga0qj67_20252_c1_2061_2420 109
34 3300050513 nmdc:mga0rr50_337094_c1 nmdc:mga0rr50_337094_c1_747_1127 109
35 3300005345 Ga0070692_10175134 Ga0070692_101751342 110
36 3300005444 Ga0070694_100033358 Ga0070694_1000333586 110
37 3300005545 Ga0070695_100035895 Ga0070695_1000358954 110
38 3300005546 Ga0070696_101755681 Ga0070696_1017556811 110
39 3300049577 Ga0501041_0265831 Ga0501041_0265831_390_767 111
40 3300027682 Ga0209971_1137408 Ga0209971_11374082 114
41 3300042131 Ga0450894_010093 Ga0450894_010093_526_900 114
42 3300042133 Ga0450896_012491 Ga0450896_012491_198_572 114
43 3300049568 Ga0501031_0718074 Ga0501031_0718074_122_499 114
44 3300049570 Ga0501033_0849660 Ga0501033_0849660_146_523 114
45 3300049573 Ga0501037_0622345 Ga0501037_0622345_245_592 114
46 3300049574 Ga0501038_0699915 Ga0501038_0699915_213_590 114
47 3300049575 Ga0501039_0130232 Ga0501039_0130232_213_590 114
48 3300049578 Ga0501042_0105145 Ga0501042_0105145_290_667 114
49 3300049579 Ga0501043_0281767 Ga0501043_0281767_101_478 114
50 3300049580 Ga0501046_0000238 Ga0501046_0000238_33108_33458 114
51 3300049580 Ga0501046_0086061 Ga0501046_0086061_1840_2217 114
52 3300049587 Ga0501071_0663697 Ga0501071_0663697_211_588 114
53 3300049588 Ga0501072_0096730 Ga0501072_0096730_1782_2159 114
54 3300049590 Ga0501074_0419630 Ga0501074_0419630_511_888 114
55 3300049591 Ga0501075_0933550 Ga0501075_0933550_129_506 114
56 3300049592 Ga0501076_1270672 Ga0501076_1270672_137_514 114
57 3300049593 Ga0501077_1019510 Ga0501077_1019510_52_426 114
58 3300049741 Ga0501079_0106150 Ga0501079_0106150_682_1059 114
59 3300049822 Ga0501035_1385755 Ga0501035_1385755_109_486 114
60 3300054114 Ga0501084_0693018 Ga0501084_0693018_224_601 114
61 3300059421 Ga0590071_102095 Ga0590071_102095_93_467 114
62 3300060353 Ga0501082_0470367 Ga0501082_0470367_258_635 114
63 3300061734 Ga0530510_1103955 Ga0530510_1103955_120_497 114
64 3300005295 Ga0065707_10425700 Ga0065707_104257002 115
65 3300049519 Ga0501296_006584 Ga0501296_006584_875_1222 115
66 3300049591 Ga0501075_1050314 Ga0501075_1050314_159_506 115
67 3300049656 Ga0501209_064244 Ga0501209_064244_524_871 115
68 3300005289 Ga0065704_10309035 Ga0065704_103090352 116
69 3300005295 Ga0065707_10137559 Ga0065707_101375593 116
70 3300005295 Ga0065707_10536195 Ga0065707_105361952 116
71 3300005328 Ga0070676_10172435 Ga0070676_101724352 116
72 3300005336 Ga0070680_100672180 Ga0070680_1006721802 116
73 3300005340 Ga0070689_100113620 Ga0070689_1001136204 116
74 3300005340 Ga0070689_100142292 Ga0070689_1001422924 116
75 3300005341 Ga0070691_10035193 Ga0070691_100351933 116
76 3300005343 Ga0070687_100005966 Ga0070687_1000059667 116
77 3300005343 Ga0070687_100133202 Ga0070687_1001332022 116
78 3300005343 Ga0070687_100484370 Ga0070687_1004843703 116
79 3300005343 Ga0070687_100666855 Ga0070687_1006668552 116
80 3300005345 Ga0070692_10192743 Ga0070692_101927431 116
81 3300005345 Ga0070692_10384510 Ga0070692_103845103 116
82 3300005347 Ga0070668_100445338 Ga0070668_1004453382 116
83 3300005353 Ga0070669_100114736 Ga0070669_1001147364 116
84 3300005354 Ga0070675_100424377 Ga0070675_1004243772 116
85 3300005354 Ga0070675_101784280 Ga0070675_1017842802 116
86 3300005355 Ga0070671_101539535 Ga0070671_1015395352 116
87 3300005356 Ga0070674_100017599 Ga0070674_1000175996 116
88 3300005356 Ga0070674_101042765 Ga0070674_1010427652 116
89 3300005364 Ga0070673_100142021 Ga0070673_1001420212 116
90 3300005364 Ga0070673_100340188 Ga0070673_1003401883 116
91 3300005364 Ga0070673_101583648 Ga0070673_1015836481 116
92 3300005366 Ga0070659_101212141 Ga0070659_1012121412 116
93 3300005406 Ga0070703_10119027 Ga0070703_101190272 116
94 3300005437 Ga0070710_10015838 Ga0070710_100158382 116
95 3300005437 Ga0070710_10336955 Ga0070710_103369553 116
96 3300005438 Ga0070701_10030684 Ga0070701_100306843 116
97 3300005438 Ga0070701_10320777 Ga0070701_103207772 116
98 3300005439 Ga0070711_100838073 Ga0070711_1008380731 116
99 3300005440 Ga0070705_100035743 Ga0070705_1000357434 116
100 3300005440 Ga0070705_100097301 Ga0070705_1000973013 116
101 3300005440 Ga0070705_101776196 Ga0070705_1017761962 116
102 3300005441 Ga0070700_100291475 Ga0070700_1002914752 116
103 3300005441 Ga0070700_100580083 Ga0070700_1005800832 116
104 3300005441 Ga0070700_100799019 Ga0070700_1007990193 116
105 3300005444 Ga0070694_100117820 Ga0070694_1001178203 116
106 3300005444 Ga0070694_100942011 Ga0070694_1009420113 116
107 3300005459 Ga0068867_100271201 Ga0068867_1002712013 116
108 3300005466 Ga0070685_10143130 Ga0070685_101431303 116
109 3300005467 Ga0070706_100876399 Ga0070706_1008763991 116
110 3300005468 Ga0070707_100629477 Ga0070707_1006294772 116
111 3300005471 Ga0070698_100160741 Ga0070698_1001607414 116
112 3300005518 Ga0070699_100005128 Ga0070699_10000512813 116
113 3300005530 Ga0070679_100855777 Ga0070679_1008557773 116
114 3300005535 Ga0070684_100261003 Ga0070684_1002610032 116
115 3300005536 Ga0070697_100254463 Ga0070697_1002544632 116
116 3300005536 Ga0070697_101564199 Ga0070697_1015641991 116
117 3300005543 Ga0070672_101352083 Ga0070672_1013520831 116
118 3300005544 Ga0070686_100012586 Ga0070686_1000125862 116
119 3300005544 Ga0070686_100381934 Ga0070686_1003819343 116
120 3300005544 Ga0070686_100525962 Ga0070686_1005259622 116
121 3300005545 Ga0070695_100697522 Ga0070695_1006975223 116
122 3300005546 Ga0070696_100626754 Ga0070696_1006267543 116
123 3300005546 Ga0070696_100667217 Ga0070696_1006672172 116
124 3300005547 Ga0070693_100080237 Ga0070693_1000802372 116
125 3300005549 Ga0070704_100131166 Ga0070704_1001311663 116
126 3300005549 Ga0070704_101800975 Ga0070704_1018009751 116
127 3300005563 Ga0068855_100179722 Ga0068855_1001797221 116
128 3300005577 Ga0068857_100526419 Ga0068857_1005264192 116
129 3300005614 Ga0068856_100128641 Ga0068856_1001286414 116
130 3300005615 Ga0070702_100428896 Ga0070702_1004288963 116
131 3300005616 Ga0068852_101709380 Ga0068852_1017093802 116
132 3300005617 Ga0068859_100430124 Ga0068859_1004301243 116
133 3300005618 Ga0068864_100032337 Ga0068864_1000323375 116
134 3300005618 Ga0068864_100508935 Ga0068864_1005089353 116
135 3300005718 Ga0068866_10590094 Ga0068866_105900942 116
136 3300005719 Ga0068861_101197025 Ga0068861_1011970252 116
137 3300005719 Ga0068861_101354859 Ga0068861_1013548592 116
138 3300005719 Ga0068861_101812223 Ga0068861_1018122232 116
139 3300005840 Ga0068870_10547554 Ga0068870_105475543 116
140 3300005840 Ga0068870_11263939 Ga0068870_112639392 116
141 3300005841 Ga0068863_100439365 Ga0068863_1004393653 116
142 3300005842 Ga0068858_100161792 Ga0068858_1001617922 116
143 3300005843 Ga0068860_100059351 Ga0068860_1000593514 116
144 3300005844 Ga0068862_100611572 Ga0068862_1006115722 116
145 3300005844 Ga0068862_100738819 Ga0068862_1007388193 116
146 3300005844 Ga0068862_100903138 Ga0068862_1009031382 116
147 3300006051 Ga0075364_10457104 Ga0075364_104571042 116
148 3300006173 Ga0070716_100123324 Ga0070716_1001233243 116
149 3300006177 Ga0075362_10213550 Ga0075362_102135503 116
150 3300006237 Ga0097621_100005707 Ga0097621_1000057078 116
151 3300006358 Ga0068871_100137412 Ga0068871_1001374124 116
152 3300006358 Ga0068871_101699237 Ga0068871_1016992372 116
153 3300006358 Ga0068871_102208549 Ga0068871_1022085491 116
154 3300006844 Ga0075428_100910824 Ga0075428_1009108242 116
155 3300006846 Ga0075430_100176511 Ga0075430_1001765112 116
156 3300006846 Ga0075430_100266117 Ga0075430_1002661173 116
157 3300006846 Ga0075430_100271574 Ga0075430_1002715743 116
158 3300006847 Ga0075431_100032779 Ga0075431_1000327797 116
159 3300006847 Ga0075431_100256808 Ga0075431_1002568082 116
160 3300006847 Ga0075431_100401122 Ga0075431_1004011223 116
161 3300006847 Ga0075431_100599729 Ga0075431_1005997292 116
162 3300006852 Ga0075433_10081675 Ga0075433_100816755 116
163 3300006852 Ga0075433_11518190 Ga0075433_115181902 116
164 3300006852 Ga0075433_11739548 Ga0075433_117395482 116
165 3300006871 Ga0075434_100000108 Ga0075434_1000001083 116
166 3300006871 Ga0075434_100017797 Ga0075434_1000177977 116
167 3300006871 Ga0075434_101875256 Ga0075434_1018752562 116
168 3300006871 Ga0075434_102483388 Ga0075434_1024833882 116
169 3300006880 Ga0075429_100241145 Ga0075429_1002411453 116
170 3300006880 Ga0075429_100287165 Ga0075429_1002871653 116
171 3300006880 Ga0075429_101432455 Ga0075429_1014324552 116
172 3300006881 Ga0068865_100351947 Ga0068865_1003519472 116
173 3300006914 Ga0075436_100004151 Ga0075436_1000041513 116
174 3300006914 Ga0075436_100005987 Ga0075436_1000059873 116
175 3300006914 Ga0075436_100312138 Ga0075436_1003121382 116
176 3300006914 Ga0075436_100364894 Ga0075436_1003648943 116
177 3300006914 Ga0075436_101077230 Ga0075436_1010772301 116
178 3300006931 Ga0097620_100430122 Ga0097620_1004301223 116
179 3300007076 Ga0075435_100002462 Ga0075435_1000024623 116
180 3300007076 Ga0075435_100111980 Ga0075435_1001119804 116
181 3300007076 Ga0075435_100181753 Ga0075435_1001817532 116
182 3300007076 Ga0075435_101180941 Ga0075435_1011809412 116
183 3300007265 Ga0099794_10009256 Ga0099794_100092563 116
184 3300007788 Ga0099795_10346561 Ga0099795_103465613 116
185 3300009094 Ga0111539_10163730 Ga0111539_101637303 116
186 3300009094 Ga0111539_10358423 Ga0111539_103584233 116
187 3300009094 Ga0111539_11172519 Ga0111539_111725192 116
188 3300009094 Ga0111539_11473155 Ga0111539_114731553 116
189 3300009094 Ga0111539_11944157 Ga0111539_119441571 116
190 3300009147 Ga0114129_10084574 Ga0114129_100845747 116
191 3300009147 Ga0114129_11070245 Ga0114129_110702453 116
192 3300009147 Ga0114129_11922223 Ga0114129_119222232 116
193 3300009148 Ga0105243_10167260 Ga0105243_101672603 116
194 3300009177 Ga0105248_10816755 Ga0105248_108167551 116
195 3300009177 Ga0105248_12225055 Ga0105248_122250553 116
196 3300009553 Ga0105249_10557105 Ga0105249_105571053 116
197 3300010159 Ga0099796_10096594 Ga0099796_100965942 116
198 3300010159 Ga0099796_10178310 Ga0099796_101783102 116
199 3300010375 Ga0105239_12092281 Ga0105239_120922812 116
200 3300011119 Ga0105246_11276690 Ga0105246_112766902 116
201 3300012483 Ga0157337_1008558 Ga0157337_10085582 116
202 3300013297 Ga0157378_10931828 Ga0157378_109318283 116
203 3300013306 Ga0163162_11571172 Ga0163162_115711722 116
204 3300013307 Ga0157372_13447944 Ga0157372_134479442 116
205 3300013308 Ga0157375_11094575 Ga0157375_110945753 116
206 3300014326 Ga0157380_10992944 Ga0157380_109929442 116
207 3300014326 Ga0157380_11526238 Ga0157380_115262382 116
208 3300014969 Ga0157376_10302294 Ga0157376_103022942 116
209 3300017792 Ga0163161_10115095 Ga0163161_101150954 116
210 3300025885 Ga0207653_10216465 Ga0207653_102164652 116
211 3300025898 Ga0207692_10046508 Ga0207692_100465084 116
212 3300025899 Ga0207642_10064024 Ga0207642_100640243 116
213 3300025907 Ga0207645_10074855 Ga0207645_100748553 116
214 3300025908 Ga0207643_10453797 Ga0207643_104537973 116
215 3300025916 Ga0207663_10654789 Ga0207663_106547893 116
216 3300025917 Ga0207660_10167916 Ga0207660_101679162 116
217 3300025917 Ga0207660_10424941 Ga0207660_104249412 116
218 3300025917 Ga0207660_11075558 Ga0207660_110755581 116
219 3300025918 Ga0207662_10486498 Ga0207662_104864982 116
220 3300025918 Ga0207662_11330625 Ga0207662_113306252 116
221 3300025921 Ga0207652_10967981 Ga0207652_109679812 116
222 3300025922 Ga0207646_10151294 Ga0207646_101512944 116
223 3300025923 Ga0207681_10009582 Ga0207681_100095827 116
224 3300025926 Ga0207659_10116488 Ga0207659_101164882 116
225 3300025932 Ga0207690_10507641 Ga0207690_105076413 116
226 3300025934 Ga0207686_10811840 Ga0207686_108118403 116
227 3300025935 Ga0207709_10002389 Ga0207709_100023892 116
228 3300025935 Ga0207709_11066297 Ga0207709_110662972 116
229 3300025936 Ga0207670_10379116 Ga0207670_103791163 116
230 3300025936 Ga0207670_11305766 Ga0207670_113057662 116
231 3300025938 Ga0207704_10052138 Ga0207704_100521382 116
232 3300025939 Ga0207665_10240081 Ga0207665_102400813 116
233 3300025940 Ga0207691_10024076 Ga0207691_100240763 116
234 3300025941 Ga0207711_10678408 Ga0207711_106784083 116
235 3300025942 Ga0207689_10763726 Ga0207689_107637263 116
236 3300025960 Ga0207651_10227969 Ga0207651_102279692 116
237 3300025960 Ga0207651_11577334 Ga0207651_115773342 116
238 3300025961 Ga0207712_10526495 Ga0207712_105264953 116
239 3300025972 Ga0207668_10190354 Ga0207668_101903543 116
240 3300025981 Ga0207640_10332722 Ga0207640_103327223 116
241 3300026035 Ga0207703_10994816 Ga0207703_109948162 116
242 3300026075 Ga0207708_10178451 Ga0207708_101784513 116
243 3300026075 Ga0207708_11033115 Ga0207708_110331153 116
244 3300026075 Ga0207708_11100049 Ga0207708_111000491 116
245 3300026088 Ga0207641_10200741 Ga0207641_102007414 116
246 3300026089 Ga0207648_10027500 Ga0207648_100275007 116
247 3300026089 Ga0207648_11798249 Ga0207648_117982492 116
248 3300026089 Ga0207648_12102749 Ga0207648_121027492 116
249 3300026095 Ga0207676_10083750 Ga0207676_100837505 116
250 3300026116 Ga0207674_10458793 Ga0207674_104587933 116
251 3300026118 Ga0207675_100288940 Ga0207675_1002889403 116
252 3300026118 Ga0207675_100847813 Ga0207675_1008478131 116
253 3300026121 Ga0207683_10419886 Ga0207683_104198862 116
254 3300026142 Ga0207698_10355884 Ga0207698_103558843 116
255 3300027364 Ga0209967_1011113 Ga0209967_10111133 116
256 3300027665 Ga0209983_1089930 Ga0209983_10899302 116
257 3300027671 Ga0209588_1044459 Ga0209588_10444593 116
258 3300027695 Ga0209966_1017909 Ga0209966_10179092 116
259 3300027907 Ga0207428_10044307 Ga0207428_100443073 116
260 3300027907 Ga0207428_10070569 Ga0207428_100705694 116
261 3300027907 Ga0207428_10130938 Ga0207428_101309383 116
262 3300027907 Ga0207428_10684680 Ga0207428_106846802 116
263 3300028380 Ga0268265_11274258 Ga0268265_112742583 116
264 3300028381 Ga0268264_10053231 Ga0268264_100532313 116
265 3300028381 Ga0268264_11696108 Ga0268264_116961082 116
266 3300028786 Ga0307517_10541244 Ga0307517_105412442 116
267 3300031239 Ga0265328_10295526 Ga0265328_102955261 116
268 3300031548 Ga0307408_100061611 Ga0307408_1000616115 116
269 3300031548 Ga0307408_101330855 Ga0307408_1013308552 116
270 3300031824 Ga0307413_10588004 Ga0307413_105880043 116
271 3300031901 Ga0307406_11151292 Ga0307406_111512922 116
272 3300032002 Ga0307416_100621845 Ga0307416_1006218452 116
273 3300032002 Ga0307416_102566924 Ga0307416_1025669242 116
274 3300032005 Ga0307411_10261676 Ga0307411_102616763 116
275 3300034818 Ga0373950_0047224 Ga0373950_0047224_156_506 116
276 3300034819 Ga0373958_0090102 Ga0373958_0090102_119_475 116
277 3300035091 Ga0373951_0025490 Ga0373951_0025490_415_771 116
278 3300035111 Ga0373923_0348873 Ga0373923_0348873_222_575 116
279 3300035111 Ga0373923_0625016 Ga0373923_0625016_82_435 116
280 3300035114 Ga0373939_0263416 Ga0373939_0263416_23_376 116
281 3300035115 Ga0373941_0196245 Ga0373941_0196245_91_441 116
282 3300035115 Ga0373941_0450100 Ga0373941_0450100_37_411 116
283 3300035117 Ga0373953_0015021 Ga0373953_0015021_2393_2746 116
284 3300035117 Ga0373953_0182170 Ga0373953_0182170_280_633 116
285 3300035118 Ga0373954_0000137 Ga0373954_0000137_3200_3553 116
286 3300035118 Ga0373954_0012198 Ga0373954_0012198_2163_2516 116
287 3300035119 Ga0373956_0042978 Ga0373956_0042978_1592_1945 116
288 3300035119 Ga0373956_0149732 Ga0373956_0149732_450_803 116
289 3300035121 Ga0373960_0329403 Ga0373960_0329403_71_427 116
290 3300035170 Ga0373943_0377574 Ga0373943_0377574_115_492 116
291 3300035171 Ga0373946_0017017 Ga0373946_0017017_1144_1521 116
292 3300035172 Ga0373955_0016001 Ga0373955_0016001_274_627 116
293 3300035207 Ga0373942_0136684 Ga0373942_0136684_238_594 116
294 3300035207 Ga0373942_0138459 Ga0373942_0138459_22_396 116
295 3300035241 Ga0373961_0102166 Ga0373961_0102166_529_885 116
296 3300035242 Ga0373962_0156465 Ga0373962_0156465_73_429 116
297 3300035410 Ga0373924_0590758 Ga0373924_0590758_90_443 116
298 3300035691 Ga0373931_0054464 Ga0373931_0054464_222_575 116
299 3300035691 Ga0373931_0055426 Ga0373931_0055426_99_476 116
300 3300035692 Ga0373935_0120999 Ga0373935_0120999_221_574 116
301 3300035692 Ga0373935_0282219 Ga0373935_0282219_483_860 116
302 3300035692 Ga0373935_1119274 Ga0373935_1119274_32_385 116
303 3300035695 Ga0373927_0161386 Ga0373927_0161386_768_1145 116
304 3300035724 Ga0373933_0080339 Ga0373933_0080339_1385_1738 116
305 3300035724 Ga0373933_0145439 Ga0373933_0145439_698_1090 116
306 3300035724 Ga0373933_0175374 Ga0373933_0175374_299_652 116
307 3300036401 Ga0373937_0003113 Ga0373937_0003113_119_472 116
308 3300036401 Ga0373937_0016478 Ga0373937_0016478_2976_3329 116
309 3300036401 Ga0373937_0321729 Ga0373937_0321729_269_622 116
310 3300037068 Ga0373925_0340469 Ga0373925_0340469_648_1025 116
311 3300039438 Ga0436360_0212210 Ga0436360_0212210_18_410 116
312 3300041406 Ga0439439_0089909 Ga0439439_0089909_443_793 116
313 3300041411 Ga0439466_0106342 Ga0439466_0106342_502_855 116
314 3300041501 Ga0451845_0241010 Ga0451845_0241010_214_567 116
315 3300041999 Ga0439433_0009905 Ga0439433_0009905_1627_1980 116
316 3300042001 Ga0439441_000269 Ga0439441_000269_4701_5075 116
317 3300042001 Ga0439441_103888 Ga0439441_103888_155_508 116
318 3300042003 Ga0439443_033187 Ga0439443_033187_133_513 116
319 3300042156 Ga0439446_0025965 Ga0439446_0025965_79_432 116
320 3300042156 Ga0439446_0118209 Ga0439446_0118209_277_627 116
321 3300042156 Ga0439446_0365942 Ga0439446_0365942_31_381 116
322 3300042435 Ga0439434_0016539 Ga0439434_0016539_1577_1930 116
323 3300042436 Ga0439435_0005383 Ga0439435_0005383_232_585 116
324 3300042436 Ga0439435_0140830 Ga0439435_0140830_144_521 116
325 3300042876 Ga0451577_0129911 Ga0451577_0129911_1149_1526 116
326 3300042876 Ga0451577_0250739 Ga0451577_0250739_729_1082 116
327 3300044673 Ga0453683_0520145 Ga0453683_0520145_193_546 116
328 3300044673 Ga0453683_0776731 Ga0453683_0776731_109_462 116
329 3300044712 Ga0453684_0200323 Ga0453684_0200323_306_659 116
330 3300045051 Ga0451576_0061023 Ga0451576_0061023_3344_3721 116
331 3300045051 Ga0451576_0147230 Ga0451576_0147230_1988_2341 116
332 3300045051 Ga0451576_0708232 Ga0451576_0708232_580_978 116
333 3300045051 Ga0451576_0811624 Ga0451576_0811624_64_417 116
334 3300046454 Ga0495592_0001459 Ga0495592_0001459_8101_8454 116
335 3300046459 Ga0495629_0213398 Ga0495629_0213398_254_607 116
336 3300046461 Ga0495641_0177712 Ga0495641_0177712_306_659 116
337 3300046462 Ga0495651_0168529 Ga0495651_0168529_174_527 116
338 3300046463 Ga0495653_0894807 Ga0495653_0894807_29_382 116
339 3300046476 Ga0495662_0081887 Ga0495662_0081887_1001_1354 116
340 3300046477 Ga0495664_0420339 Ga0495664_0420339_439_792 116
341 3300046499 Ga0495594_0748127 Ga0495594_0748127_173_532 116
342 3300046511 Ga0495608_0014358 Ga0495608_0014358_4093_4446 116
343 3300046514 Ga0495618_0369164 Ga0495618_0369164_263_616 116
344 3300046516 Ga0495628_0007233 Ga0495628_0007233_9018_9371 116
345 3300046516 Ga0495628_0195791 Ga0495628_0195791_801_1193 116
346 3300046517 Ga0495630_0106327 Ga0495630_0106327_1592_1945 116
347 3300046517 Ga0495630_0283251 Ga0495630_0283251_685_1038 116
348 3300046517 Ga0495630_0589669 Ga0495630_0589669_230_583 116
349 3300046519 Ga0495632_0458747 Ga0495632_0458747_48_446 116
350 3300046525 Ga0495663_0104184 Ga0495663_0104184_318_668 116
351 3300046526 Ga0495666_0064350 Ga0495666_0064350_61_414 116
352 3300046529 Ga0495652_0078729 Ga0495652_0078729_196_549 116
353 3300046533 Ga0495640_0001548 Ga0495640_0001548_8432_8785 116
354 3300046535 Ga0495586_0000357 Ga0495586_0000357_247_600 116
355 3300046536 Ga0495587_0025483 Ga0495587_0025483_122_475 116
356 3300046537 Ga0495598_0101589 Ga0495598_0101589_303_680 116
357 3300046539 Ga0495621_0081966 Ga0495621_0081966_788_1141 116
358 3300046539 Ga0495621_0420243 Ga0495621_0420243_77_427 116
359 3300046543 Ga0495645_0460621 Ga0495645_0460621_219_572 116
360 3300046559 Ga0495667_0670782 Ga0495667_0670782_44_397 116
361 3300046642 Ga0495634_0073672 Ga0495634_0073672_243_596 116
362 3300046642 Ga0495634_0526811 Ga0495634_0526811_94_447 116
363 3300046663 Ga0495635_0449496 Ga0495635_0449496_58_411 116
364 3300046663 Ga0495635_1095244 Ga0495635_1095244_95_448 116
365 3300046664 Ga0495659_0215660 Ga0495659_0215660_287_664 116
366 3300046675 Ga0495657_0030714 Ga0495657_0030714_2677_3030 116
367 3300046678 Ga0495599_0289701 Ga0495599_0289701_356_709 116
368 3300046680 Ga0495646_0210927 Ga0495646_0210927_500_853 116
369 3300046683 Ga0495658_0465116 Ga0495658_0465116_137_490 116
370 3300046684 Ga0495669_0165969 Ga0495669_0165969_307_657 116
371 3300046689 Ga0495613_0017571 Ga0495613_0017571_4750_5103 116
372 3300046809 Ga0495600_0205758 Ga0495600_0205758_879_1232 116
373 3300047315 Ga0495581_0335891 Ga0495581_0335891_143_496 116
374 3300047317 Ga0495604_0038956 Ga0495604_0038956_3234_3587 116
375 3300047317 Ga0495604_0255365 Ga0495604_0255365_178_531 116
376 3300047319 Ga0495674_1138385 Ga0495674_1138385_93_446 116
377 3300047322 Ga0495680_0001930 Ga0495680_0001930_10575_10928 116
378 3300047322 Ga0495680_0380887 Ga0495680_0380887_378_731 116
379 3300047471 Ga0495684_0502971 Ga0495684_0502971_127_480 116
380 3300047673 Ga0495593_0192147 Ga0495593_0192147_203_556 116
381 3300049514 Ga0501291_098278 Ga0501291_098278_232_582 116
382 3300049521 Ga0501298_076232 Ga0501298_076232_90_440 116
383 3300049522 Ga0501299_005557 Ga0501299_005557_750_1100 116
384 3300049570 Ga0501033_0777888 Ga0501033_0777888_198_548 116
385 3300049574 Ga0501038_0245188 Ga0501038_0245188_882_1232 116
386 3300049575 Ga0501039_0030765 Ga0501039_0030765_457_807 116
387 3300049575 Ga0501039_1169730 Ga0501039_1169730_86_436 116
388 3300049576 Ga0501040_0773707 Ga0501040_0773707_282_632 116
389 3300049577 Ga0501041_0548576 Ga0501041_0548576_165_515 116
390 3300049578 Ga0501042_0955291 Ga0501042_0955291_139_489 116
391 3300049580 Ga0501046_0084965 Ga0501046_0084965_225_575 116
392 3300049582 Ga0501048_0154133 Ga0501048_0154133_1215_1565 116
393 3300049582 Ga0501048_0651750 Ga0501048_0651750_349_699 116
394 3300049582 Ga0501048_1061674 Ga0501048_1061674_109_459 116
395 3300049584 Ga0501068_0507591 Ga0501068_0507591_415_765 116
396 3300049587 Ga0501071_0188483 Ga0501071_0188483_1052_1402 116
397 3300049588 Ga0501072_0107939 Ga0501072_0107939_156_506 116
398 3300049590 Ga0501074_0224238 Ga0501074_0224238_598_960 116
399 3300049591 Ga0501075_0003230 Ga0501075_0003230_3187_3537 116
400 3300049592 Ga0501076_0007714 Ga0501076_0007714_460_810 116
401 3300049592 Ga0501076_0849561 Ga0501076_0849561_128_478 116
402 3300049593 Ga0501077_0014839 Ga0501077_0014839_2833_3183 116
403 3300049660 Ga0501216_135352 Ga0501216_135352_175_525 116
404 3300049665 Ga0501227_026990 Ga0501227_026990_241_591 116
405 3300049679 Ga0501249_095269 Ga0501249_095269_98_448 116
406 3300049690 Ga0501261_057237 Ga0501261_057237_261_611 116
407 3300049742 Ga0501080_0106951 Ga0501080_0106951_1991_2341 116
408 3300049742 Ga0501080_0913129 Ga0501080_0913129_219_581 116
409 3300049743 Ga0501081_0163800 Ga0501081_0163800_928_1278 116
410 3300049743 Ga0501081_0277480 Ga0501081_0277480_221_571 116
411 3300049744 Ga0501083_0192113 Ga0501083_0192113_923_1273 116
412 3300049761 Ga0501264_032185 Ga0501264_032185_56_406 116
413 3300049822 Ga0501035_0228062 Ga0501035_0228062_294_644 116
414 3300049824 Ga0501045_0045519 Ga0501045_0045519_1423_1773 116
415 3300049824 Ga0501045_0860039 Ga0501045_0860039_205_555 116
416 3300049824 Ga0501045_1057677 Ga0501045_1057677_112_462 116
417 3300050489 nmdc:mga03683_126992_c1 nmdc:mga03683_126992_c1_556_912 116
418 3300050507 nmdc:mga05p37_1520294_c1 nmdc:mga05p37_1520294_c1_161_517 116
419 3300050507 nmdc:mga05p37_2016436_c1 nmdc:mga05p37_2016436_c1_185_535 116
420 3300050507 nmdc:mga05p37_280386_c1 nmdc:mga05p37_280386_c1_79_432 116
421 3300050508 nmdc:mga09592_1228898_c1 nmdc:mga09592_1228898_c1_243_596 116
422 3300050508 nmdc:mga09592_1320053_c1 nmdc:mga09592_1320053_c1_101_454 116
423 3300050508 nmdc:mga09592_819059_c1 nmdc:mga09592_819059_c1_85_438 116
424 3300050508 nmdc:mga09592_868937_c1 nmdc:mga09592_868937_c1_352_702 116
425 3300050509 nmdc:mga0qj67_204684_c1 nmdc:mga0qj67_204684_c1_68_421 116
426 3300050509 nmdc:mga0qj67_818481_c1 nmdc:mga0qj67_818481_c1_151_501 116
427 3300050509 nmdc:mga0qj67_97052_c1 nmdc:mga0qj67_97052_c1_1803_2153 116
428 3300050510 nmdc:mga06r32_1018954_c1 nmdc:mga06r32_1018954_c1_319_669 116
429 3300050510 nmdc:mga06r32_120453_c1 nmdc:mga06r32_120453_c1_2135_2485 116
430 3300050510 nmdc:mga06r32_153333_c1 nmdc:mga06r32_153333_c1_1692_2045 116
431 3300050510 nmdc:mga06r32_308993_c1 nmdc:mga06r32_308993_c1_412_762 116
432 3300050511 nmdc:mga08y16_144611_c1 nmdc:mga08y16_144611_c1_957_1307 116
433 3300050511 nmdc:mga08y16_1542684_c1 nmdc:mga08y16_1542684_c1_39_389 116
434 3300050511 nmdc:mga08y16_175248_c1 nmdc:mga08y16_175248_c1_1344_1697 116
435 3300050511 nmdc:mga08y16_210128_c1 nmdc:mga08y16_210128_c1_917_1267 116
436 3300050511 nmdc:mga08y16_2178356_c1 nmdc:mga08y16_2178356_c1_80_454 116
437 3300050511 nmdc:mga08y16_56120_c1 nmdc:mga08y16_56120_c1_2118_2495 116
438 3300050512 nmdc:mga0n895_141626_c1 nmdc:mga0n895_141626_c1_1942_2295 116
439 3300050512 nmdc:mga0n895_4257_c1 nmdc:mga0n895_4257_c1_231_608 116
440 3300050512 nmdc:mga0n895_84_c1 nmdc:mga0n895_84_c1_53730_54083 116
441 3300050513 nmdc:mga0rr50_1118570_c1 nmdc:mga0rr50_1118570_c1_165_524 116
442 3300050513 nmdc:mga0rr50_1637_c1 nmdc:mga0rr50_1637_c1_239_616 116
443 3300050513 nmdc:mga0rr50_221923_c1 nmdc:mga0rr50_221923_c1_989_1345 116
444 3300050513 nmdc:mga0rr50_61571_c1 nmdc:mga0rr50_61571_c1_2213_2566 116
445 3300050513 nmdc:mga0rr50_63068_c1 nmdc:mga0rr50_63068_c1_958_1314 116
446 3300050513 nmdc:mga0rr50_729090_c1 nmdc:mga0rr50_729090_c1_459_812 116
447 3300050514 nmdc:mga08x19_19968_c1 nmdc:mga08x19_19968_c1_3316_3693 116
448 3300050514 nmdc:mga08x19_31088_c1 nmdc:mga08x19_31088_c1_126_482 116
449 3300050514 nmdc:mga08x19_640_c1 nmdc:mga08x19_640_c1_9374_9730 116
450 3300050514 nmdc:mga08x19_849093_c1 nmdc:mga08x19_849093_c1_99_455 116
451 3300050514 nmdc:mga08x19_96464_c1 nmdc:mga08x19_96464_c1_1150_1506 116
452 3300050515 nmdc:mga0a205_1228040_c1 nmdc:mga0a205_1228040_c1_206_559 116
453 3300050515 nmdc:mga0a205_570406_c1 nmdc:mga0a205_570406_c1_364_717 116
454 3300050515 nmdc:mga0a205_828995_c1 nmdc:mga0a205_828995_c1_303_659 116
455 3300050515 nmdc:mga0a205_8513_c1 nmdc:mga0a205_8513_c1_239_616 116
456 3300053077 Ga0495601_0038212 Ga0495601_0038212_1828_2181 116
457 3300053084 Ga0495595_0135716 Ga0495595_0135716_91_444 116
458 3300054114 Ga0501084_0123948 Ga0501084_0123948_409_759 116
459 3300059421 Ga0590071_061863 Ga0590071_061863_533_886 116
460 3300061734 Ga0530510_0006411 Ga0530510_0006411_219_569 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00584

SecE

SecE/Sec61-gamma subunits of protein translocation complex

45

100

0.96

Feature Viewer

pLDDT pTM Quality
86.3 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map