F448549
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 460 | 272 | 460 | 118 |
Family's Representative Sequence
| Representative Sequence | 3300014326|Ga0157380_10385273|Ga0157380_103852733 |
| Length | 105 |
| Sequence | MTDKIKLVAAVLLVALGIWGYYRLGDSALVLRILAWWSEPGKQFAVFAGEAIEEVKKVVWPTRKETMQTTAAVFAFVVVMAVFLWLTDKTLEWALYDLILGWKKT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 55 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 69 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 132 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 135 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 136 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 137 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 138 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 139 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 140 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 141 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 142 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 143 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 144 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 145 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 146 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 148 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 149 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 150 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 151 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 152 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 153 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 154 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 156 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 157 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 158 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 159 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 160 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 161 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 162 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 165 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 166 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 167 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 168 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 169 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 170 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 171 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 172 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 173 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 174 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 175 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 176 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 177 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 178 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 179 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 180 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 181 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 182 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 183 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 223 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 224 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 225 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 226 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 245 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 246 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 247 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 248 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 249 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 254 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 257 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 258 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 271 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.09 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 98.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10309035 | 3300005289 | Bacteria | 865 |
| 2 | Ga0065707_10137559 | 3300005295 | Bacteria | 1798 |
| 3 | Ga0065707_10425700 | 3300005295 | Bacteria | 826 |
| 4 | Ga0065707_10536195 | 3300005295 | Bacteria | 728 |
| 5 | Ga0070676_10172435 | 3300005328 | Bacteria | 1400 |
| 6 | Ga0070680_100672180 | 3300005336 | Bacteria | 891 |
| 7 | Ga0070689_100113620 | 3300005340 | Bacteria | 2156 |
| 8 | Ga0070689_100142292 | 3300005340 | Bacteria | 1929 |
| 9 | Ga0070691_10035193 | 3300005341 | Bacteria | 2357 |
| 10 | Ga0070687_100005966 | 3300005343 | Bacteria | 4958 |
| 11 | Ga0070687_100133202 | 3300005343 | Bacteria | 1437 |
| 12 | Ga0070687_100484370 | 3300005343 | Bacteria | 829 |
| 13 | Ga0070687_100666855 | 3300005343 | Bacteria | 722 |
| 14 | Ga0070692_10175134 | 3300005345 | Bacteria | 1239 |
| 15 | Ga0070692_10192743 | 3300005345 | Bacteria | 1189 |
| 16 | Ga0070692_10384510 | 3300005345 | Bacteria | 881 |
| 17 | Ga0070668_100445338 | 3300005347 | Bacteria | 1112 |
| 18 | Ga0070669_100114736 | 3300005353 | Bacteria | 2048 |
| 19 | Ga0070675_100424377 | 3300005354 | Bacteria | 1189 |
| 20 | Ga0070675_101784280 | 3300005354 | Bacteria | 568 |
| 21 | Ga0070671_101539535 | 3300005355 | Bacteria | 589 |
| 22 | Ga0070674_100017599 | 3300005356 | Bacteria | 4501 |
| 23 | Ga0070674_101042765 | 3300005356 | Bacteria | 719 |
| 24 | Ga0070673_100142021 | 3300005364 | Bacteria | 2026 |
| 25 | Ga0070673_100340188 | 3300005364 | Bacteria | 1329 |
| 26 | Ga0070673_101583648 | 3300005364 | Bacteria | 619 |
| 27 | Ga0070659_101212141 | 3300005366 | Bacteria | 668 |
| 28 | Ga0070703_10119027 | 3300005406 | Bacteria | 956 |
| 29 | Ga0070703_10305496 | 3300005406 | Bacteria | 665 |
| 30 | Ga0070710_10015838 | 3300005437 | Bacteria | 3823 |
| 31 | Ga0070710_10336955 | 3300005437 | Bacteria | 995 |
| 32 | Ga0070701_10030684 | 3300005438 | Bacteria | 2661 |
| 33 | Ga0070701_10320777 | 3300005438 | Bacteria | 958 |
| 34 | Ga0070711_100838073 | 3300005439 | Bacteria | 782 |
| 35 | Ga0070705_100035743 | 3300005440 | Bacteria | 2787 |
| 36 | Ga0070705_100097301 | 3300005440 | Bacteria | 1849 |
| 37 | Ga0070705_101776196 | 3300005440 | Bacteria | 523 |
| 38 | Ga0070700_100291475 | 3300005441 | Bacteria | 1187 |
| 39 | Ga0070700_100580083 | 3300005441 | Bacteria | 875 |
| 40 | Ga0070700_100799019 | 3300005441 | Bacteria | 759 |
| 41 | Ga0070694_100033358 | 3300005444 | Bacteria | 3387 |
| 42 | Ga0070694_100117820 | 3300005444 | Bacteria | 1901 |
| 43 | Ga0070694_100942011 | 3300005444 | Bacteria | 714 |
| 44 | Ga0068867_100271201 | 3300005459 | Bacteria | 1387 |
| 45 | Ga0068867_100939204 | 3300005459 | Bacteria | 781 |
| 46 | Ga0070685_10143130 | 3300005466 | Bacteria | 1508 |
| 47 | Ga0070706_100876399 | 3300005467 | Bacteria | 830 |
| 48 | Ga0070707_100629477 | 3300005468 | Bacteria | 1035 |
| 49 | Ga0070698_100160741 | 3300005471 | Bacteria | 2190 |
| 50 | Ga0070699_100005128 | 3300005518 | Bacteria | 11520 |
| 51 | Ga0070679_100855777 | 3300005530 | Bacteria | 853 |
| 52 | Ga0070684_100261003 | 3300005535 | Bacteria | 1585 |
| 53 | Ga0070697_100254463 | 3300005536 | Bacteria | 1502 |
| 54 | Ga0070697_101564199 | 3300005536 | Bacteria | 590 |
| 55 | Ga0070672_101352083 | 3300005543 | Bacteria | 637 |
| 56 | Ga0070686_100012586 | 3300005544 | Bacteria | 4822 |
| 57 | Ga0070686_100381934 | 3300005544 | Bacteria | 1066 |
| 58 | Ga0070686_100525962 | 3300005544 | Bacteria | 921 |
| 59 | Ga0070686_100592300 | 3300005544 | Bacteria | 873 |
| 60 | Ga0070695_100035895 | 3300005545 | Bacteria | 3116 |
| 61 | Ga0070695_100697522 | 3300005545 | Bacteria | 805 |
| 62 | Ga0070696_100626754 | 3300005546 | Bacteria | 869 |
| 63 | Ga0070696_100667217 | 3300005546 | Bacteria | 844 |
| 64 | Ga0070696_101755681 | 3300005546 | Bacteria | 535 |
| 65 | Ga0070693_100080237 | 3300005547 | Bacteria | 1943 |
| 66 | Ga0070704_100131166 | 3300005549 | Bacteria | 1942 |
| 67 | Ga0070704_101800975 | 3300005549 | Bacteria | 566 |
| 68 | Ga0068855_100179722 | 3300005563 | Bacteria | 2393 |
| 69 | Ga0068857_100526419 | 3300005577 | Bacteria | 1111 |
| 70 | Ga0068856_100128641 | 3300005614 | Bacteria | 2536 |
| 71 | Ga0070702_100428896 | 3300005615 | Bacteria | 953 |
| 72 | Ga0068852_101709380 | 3300005616 | Bacteria | 652 |
| 73 | Ga0068859_100430124 | 3300005617 | Bacteria | 1416 |
| 74 | Ga0068864_100032337 | 3300005618 | Bacteria | 4445 |
| 75 | Ga0068864_100508935 | 3300005618 | Bacteria | 1159 |
| 76 | Ga0068866_10590094 | 3300005718 | Bacteria | 748 |
| 77 | Ga0068861_101197025 | 3300005719 | Bacteria | 734 |
| 78 | Ga0068861_101354859 | 3300005719 | Bacteria | 693 |
| 79 | Ga0068861_101812223 | 3300005719 | Bacteria | 605 |
| 80 | Ga0068870_10547554 | 3300005840 | Bacteria | 779 |
| 81 | Ga0068870_11263939 | 3300005840 | Bacteria | 537 |
| 82 | Ga0068863_100439365 | 3300005841 | Bacteria | 1279 |
| 83 | Ga0068858_100161792 | 3300005842 | Bacteria | 2108 |
| 84 | Ga0068860_100059351 | 3300005843 | Bacteria | 3637 |
| 85 | Ga0068862_100340725 | 3300005844 | Bacteria | 1389 |
| 86 | Ga0068862_100611572 | 3300005844 | Bacteria | 1047 |
| 87 | Ga0068862_100738819 | 3300005844 | Bacteria | 956 |
| 88 | Ga0068862_100903138 | 3300005844 | Bacteria | 868 |
| 89 | Ga0075364_10457104 | 3300006051 | Bacteria | 872 |
| 90 | Ga0070716_100123324 | 3300006173 | Bacteria | 1626 |
| 91 | Ga0075362_10213550 | 3300006177 | Bacteria | 941 |
| 92 | Ga0075366_10242920 | 3300006195 | Bacteria | 1098 |
| 93 | Ga0097621_100005707 | 3300006237 | Bacteria | 8794 |
| 94 | Ga0068871_100137412 | 3300006358 | Bacteria | 2076 |
| 95 | Ga0068871_101699237 | 3300006358 | Bacteria | 599 |
| 96 | Ga0068871_102208549 | 3300006358 | Bacteria | 524 |
| 97 | Ga0075428_100910824 | 3300006844 | Bacteria | 932 |
| 98 | Ga0075430_100062166 | 3300006846 | Bacteria | 3137 |
| 99 | Ga0075430_100176511 | 3300006846 | Bacteria | 1777 |
| 100 | Ga0075430_100266117 | 3300006846 | Bacteria | 1419 |
| 101 | Ga0075430_100271574 | 3300006846 | Bacteria | 1403 |
| 102 | Ga0075430_100353996 | 3300006846 | Bacteria | 1212 |
| 103 | Ga0075431_100032779 | 3300006847 | Bacteria | 5354 |
| 104 | Ga0075431_100256808 | 3300006847 | Bacteria | 1774 |
| 105 | Ga0075431_100401122 | 3300006847 | Bacteria | 1372 |
| 106 | Ga0075431_100599729 | 3300006847 | Bacteria | 1085 |
| 107 | Ga0075433_10081675 | 3300006852 | Bacteria | 2850 |
| 108 | Ga0075433_11518190 | 3300006852 | Bacteria | 578 |
| 109 | Ga0075433_11739548 | 3300006852 | Bacteria | 536 |
| 110 | Ga0075434_100000108 | 3300006871 | Bacteria | 47506 |
| 111 | Ga0075434_100017797 | 3300006871 | Bacteria | 6854 |
| 112 | Ga0075434_101875256 | 3300006871 | Bacteria | 606 |
| 113 | Ga0075434_102483388 | 3300006871 | Bacteria | 520 |
| 114 | Ga0075429_100241145 | 3300006880 | Bacteria | 1583 |
| 115 | Ga0075429_100287165 | 3300006880 | Bacteria | 1440 |
| 116 | Ga0075429_101432455 | 3300006880 | Bacteria | 602 |
| 117 | Ga0068865_100351947 | 3300006881 | Bacteria | 1193 |
| 118 | Ga0075436_100004151 | 3300006914 | Bacteria | 9939 |
| 119 | Ga0075436_100005987 | 3300006914 | Bacteria | 8351 |
| 120 | Ga0075436_100312138 | 3300006914 | Bacteria | 1129 |
| 121 | Ga0075436_100364894 | 3300006914 | Bacteria | 1042 |
| 122 | Ga0075436_101077230 | 3300006914 | Bacteria | 604 |
| 123 | Ga0097620_100430122 | 3300006931 | Bacteria | 1416 |
| 124 | Ga0075435_100002462 | 3300007076 | Bacteria | 12302 |
| 125 | Ga0075435_100111980 | 3300007076 | Bacteria | 2270 |
| 126 | Ga0075435_100136068 | 3300007076 | Bacteria | 2058 |
| 127 | Ga0075435_100181753 | 3300007076 | Bacteria | 1777 |
| 128 | Ga0075435_101180941 | 3300007076 | Bacteria | 669 |
| 129 | Ga0099794_10009256 | 3300007265 | Bacteria | 4131 |
| 130 | Ga0099794_10407989 | 3300007265 | Bacteria | 710 |
| 131 | Ga0099795_10346561 | 3300007788 | Bacteria | 663 |
| 132 | Ga0111539_10163730 | 3300009094 | Bacteria | 2601 |
| 133 | Ga0111539_10358423 | 3300009094 | Bacteria | 1697 |
| 134 | Ga0111539_11172519 | 3300009094 | Bacteria | 892 |
| 135 | Ga0111539_11473155 | 3300009094 | Bacteria | 789 |
| 136 | Ga0111539_11944157 | 3300009094 | Bacteria | 682 |
| 137 | Ga0114129_10084574 | 3300009147 | Bacteria | 4404 |
| 138 | Ga0114129_10177943 | 3300009147 | Bacteria | 2896 |
| 139 | Ga0114129_11070245 | 3300009147 | Bacteria | 1011 |
| 140 | Ga0114129_11922223 | 3300009147 | Bacteria | 717 |
| 141 | Ga0105243_10167260 | 3300009148 | Bacteria | 1901 |
| 142 | Ga0105248_10816755 | 3300009177 | Bacteria | 1052 |
| 143 | Ga0105248_12225055 | 3300009177 | Bacteria | 624 |
| 144 | Ga0105249_10557105 | 3300009553 | Bacteria | 1197 |
| 145 | Ga0099796_10096594 | 3300010159 | Bacteria | 1106 |
| 146 | Ga0099796_10178310 | 3300010159 | Bacteria | 851 |
| 147 | Ga0105239_12092281 | 3300010375 | Bacteria | 658 |
| 148 | Ga0105246_11276690 | 3300011119 | Bacteria | 679 |
| 149 | Ga0157337_1008558 | 3300012483 | Bacteria | 755 |
| 150 | Ga0157378_10931828 | 3300013297 | Bacteria | 900 |
| 151 | Ga0163162_11571172 | 3300013306 | Bacteria | 750 |
| 152 | Ga0157372_13447944 | 3300013307 | Bacteria | 503 |
| 153 | Ga0157375_11094575 | 3300013308 | Bacteria | 933 |
| 154 | Ga0157380_10385273 | 3300014326 | Bacteria | 1324 |
| 155 | Ga0157380_10992944 | 3300014326 | Bacteria | 872 |
| 156 | Ga0157380_11526238 | 3300014326 | Bacteria | 722 |
| 157 | Ga0157376_10302294 | 3300014969 | Bacteria | 1515 |
| 158 | Ga0163161_10115095 | 3300017792 | Bacteria | 2015 |
| 159 | Ga0207653_10216465 | 3300025885 | Bacteria | 726 |
| 160 | Ga0207653_10266777 | 3300025885 | Bacteria | 659 |
| 161 | Ga0207692_10046508 | 3300025898 | Bacteria | 2176 |
| 162 | Ga0207642_10064024 | 3300025899 | Bacteria | 1722 |
| 163 | Ga0207645_10074855 | 3300025907 | Bacteria | 2168 |
| 164 | Ga0207643_10453797 | 3300025908 | Bacteria | 816 |
| 165 | Ga0207684_10284392 | 3300025910 | Bacteria | 1426 |
| 166 | Ga0207663_10654789 | 3300025916 | Bacteria | 829 |
| 167 | Ga0207660_10167916 | 3300025917 | Bacteria | 1697 |
| 168 | Ga0207660_10424941 | 3300025917 | Bacteria | 1072 |
| 169 | Ga0207660_11075558 | 3300025917 | Bacteria | 656 |
| 170 | Ga0207662_10486498 | 3300025918 | Bacteria | 848 |
| 171 | Ga0207662_11330625 | 3300025918 | Bacteria | 510 |
| 172 | Ga0207652_10967981 | 3300025921 | Bacteria | 749 |
| 173 | Ga0207646_10151294 | 3300025922 | Bacteria | 2093 |
| 174 | Ga0207681_10009582 | 3300025923 | Bacteria | 5919 |
| 175 | Ga0207659_10116488 | 3300025926 | Bacteria | 2040 |
| 176 | Ga0207690_10507641 | 3300025932 | Bacteria | 976 |
| 177 | Ga0207686_10811840 | 3300025934 | Bacteria | 750 |
| 178 | Ga0207709_10002389 | 3300025935 | Bacteria | 11836 |
| 179 | Ga0207709_11066297 | 3300025935 | Bacteria | 662 |
| 180 | Ga0207670_10379116 | 3300025936 | Bacteria | 1126 |
| 181 | Ga0207670_11305766 | 3300025936 | Bacteria | 615 |
| 182 | Ga0207704_10052138 | 3300025938 | Bacteria | 2478 |
| 183 | Ga0207665_10240081 | 3300025939 | Bacteria | 1335 |
| 184 | Ga0207691_10024076 | 3300025940 | Bacteria | 5726 |
| 185 | Ga0207711_10678408 | 3300025941 | Bacteria | 961 |
| 186 | Ga0207689_10763726 | 3300025942 | Bacteria | 816 |
| 187 | Ga0207651_10227969 | 3300025960 | Bacteria | 1510 |
| 188 | Ga0207651_11577334 | 3300025960 | Bacteria | 591 |
| 189 | Ga0207712_10526495 | 3300025961 | Bacteria | 1014 |
| 190 | Ga0207668_10190354 | 3300025972 | Bacteria | 1625 |
| 191 | Ga0207640_10332722 | 3300025981 | Bacteria | 1214 |
| 192 | Ga0207703_10994816 | 3300026035 | Bacteria | 804 |
| 193 | Ga0207708_10178451 | 3300026075 | Bacteria | 1685 |
| 194 | Ga0207708_11033115 | 3300026075 | Bacteria | 715 |
| 195 | Ga0207708_11100049 | 3300026075 | Bacteria | 693 |
| 196 | Ga0207641_10200741 | 3300026088 | Bacteria | 1838 |
| 197 | Ga0207648_10027500 | 3300026089 | Bacteria | 5049 |
| 198 | Ga0207648_11798249 | 3300026089 | Bacteria | 574 |
| 199 | Ga0207648_12102749 | 3300026089 | Bacteria | 525 |
| 200 | Ga0207676_10083750 | 3300026095 | Bacteria | 2598 |
| 201 | Ga0207674_10458793 | 3300026116 | Bacteria | 1232 |
| 202 | Ga0207675_100288940 | 3300026118 | Bacteria | 1595 |
| 203 | Ga0207675_100847813 | 3300026118 | Bacteria | 929 |
| 204 | Ga0207683_10419886 | 3300026121 | Bacteria | 1232 |
| 205 | Ga0207698_10355884 | 3300026142 | Bacteria | 1385 |
| 206 | Ga0209967_1011113 | 3300027364 | Bacteria | 1260 |
| 207 | Ga0209981_1000418 | 3300027378 | Bacteria | 5415 |
| 208 | Ga0210000_1020122 | 3300027462 | Bacteria | 1017 |
| 209 | Ga0209999_1010072 | 3300027543 | Bacteria | 1707 |
| 210 | Ga0209970_1037616 | 3300027614 | Bacteria | 855 |
| 211 | Ga0209983_1089930 | 3300027665 | Bacteria | 691 |
| 212 | Ga0209588_1044459 | 3300027671 | Bacteria | 1436 |
| 213 | Ga0209971_1137408 | 3300027682 | Bacteria | 602 |
| 214 | Ga0209966_1014089 | 3300027695 | Bacteria | 1488 |
| 215 | Ga0209966_1017909 | 3300027695 | Bacteria | 1353 |
| 216 | Ga0209974_10014768 | 3300027876 | Bacteria | 2594 |
| 217 | Ga0207428_10044307 | 3300027907 | Bacteria | 3590 |
| 218 | Ga0207428_10070569 | 3300027907 | Bacteria | 2746 |
| 219 | Ga0207428_10130938 | 3300027907 | Bacteria | 1919 |
| 220 | Ga0207428_10684680 | 3300027907 | Bacteria | 734 |
| 221 | Ga0268265_11274258 | 3300028380 | Bacteria | 734 |
| 222 | Ga0268264_10053231 | 3300028381 | Bacteria | 3376 |
| 223 | Ga0268264_11696108 | 3300028381 | Bacteria | 642 |
| 224 | Ga0307517_10541244 | 3300028786 | Bacteria | 584 |
| 225 | Ga0265328_10295526 | 3300031239 | Bacteria | 625 |
| 226 | Ga0307408_100061611 | 3300031548 | Bacteria | 2739 |
| 227 | Ga0307408_101330855 | 3300031548 | Bacteria | 674 |
| 228 | Ga0307413_10588004 | 3300031824 | Bacteria | 909 |
| 229 | Ga0307406_11151292 | 3300031901 | Bacteria | 672 |
| 230 | Ga0307416_100621845 | 3300032002 | Bacteria | 1162 |
| 231 | Ga0307416_102566924 | 3300032002 | Bacteria | 607 |
| 232 | Ga0307411_10261676 | 3300032005 | Bacteria | 1366 |
| 233 | Ga0373950_0047224 | 3300034818 | Bacteria | 838 |
| 234 | Ga0373958_0090102 | 3300034819 | Bacteria | 706 |
| 235 | Ga0373951_0025490 | 3300035091 | Bacteria | 1374 |
| 236 | Ga0373923_0348873 | 3300035111 | Bacteria | 706 |
| 237 | Ga0373923_0625016 | 3300035111 | Bacteria | 531 |
| 238 | Ga0373939_0263416 | 3300035114 | Bacteria | 675 |
| 239 | Ga0373941_0196245 | 3300035115 | Bacteria | 765 |
| 240 | Ga0373941_0450100 | 3300035115 | Bacteria | 540 |
| 241 | Ga0373953_0015021 | 3300035117 | Bacteria | 2797 |
| 242 | Ga0373953_0182170 | 3300035117 | Bacteria | 906 |
| 243 | Ga0373954_0000137 | 3300035118 | Bacteria | 25393 |
| 244 | Ga0373954_0012198 | 3300035118 | Bacteria | 3821 |
| 245 | Ga0373956_0042978 | 3300035119 | Bacteria | 2011 |
| 246 | Ga0373956_0149732 | 3300035119 | Bacteria | 1098 |
| 247 | Ga0373960_0329403 | 3300035121 | Bacteria | 574 |
| 248 | Ga0373943_0377574 | 3300035170 | Bacteria | 815 |
| 249 | Ga0373946_0017017 | 3300035171 | Bacteria | 2776 |
| 250 | Ga0373955_0016001 | 3300035172 | Bacteria | 3684 |
| 251 | Ga0373942_0136684 | 3300035207 | Bacteria | 777 |
| 252 | Ga0373942_0138459 | 3300035207 | Bacteria | 773 |
| 253 | Ga0373942_0288194 | 3300035207 | Bacteria | 567 |
| 254 | Ga0373961_0102166 | 3300035241 | Bacteria | 929 |
| 255 | Ga0373962_0156465 | 3300035242 | Bacteria | 749 |
| 256 | Ga0373924_0590758 | 3300035410 | Bacteria | 501 |
| 257 | Ga0373931_0054464 | 3300035691 | Bacteria | 2138 |
| 258 | Ga0373931_0055426 | 3300035691 | Bacteria | 2121 |
| 259 | Ga0373935_0120999 | 3300035692 | Bacteria | 1749 |
| 260 | Ga0373935_0282219 | 3300035692 | Bacteria | 1169 |
| 261 | Ga0373935_1119274 | 3300035692 | Bacteria | 586 |
| 262 | Ga0373927_0161386 | 3300035695 | Bacteria | 1468 |
| 263 | Ga0373933_0080339 | 3300035724 | Bacteria | 1998 |
| 264 | Ga0373933_0145439 | 3300035724 | Bacteria | 1499 |
| 265 | Ga0373933_0175374 | 3300035724 | Bacteria | 1365 |
| 266 | Ga0373937_0003113 | 3300036401 | Bacteria | 13870 |
| 267 | Ga0373937_0016478 | 3300036401 | Bacteria | 6565 |
| 268 | Ga0373937_0321729 | 3300036401 | Bacteria | 1463 |
| 269 | Ga0373925_0340469 | 3300037068 | Bacteria | 1216 |
| 270 | Ga0436360_0212210 | 3300039438 | Bacteria | 864 |
| 271 | Ga0439439_0089909 | 3300041406 | Bacteria | 838 |
| 272 | Ga0439453_0008422 | 3300041408 | Bacteria | 1657 |
| 273 | Ga0439466_0106342 | 3300041411 | Bacteria | 872 |
| 274 | Ga0451845_0241010 | 3300041501 | Bacteria | 599 |
| 275 | Ga0439433_0009905 | 3300041999 | Bacteria | 2081 |
| 276 | Ga0439441_000269 | 3300042001 | Bacteria | 5099 |
| 277 | Ga0439441_103888 | 3300042001 | Bacteria | 639 |
| 278 | Ga0439443_031463 | 3300042003 | Bacteria | 876 |
| 279 | Ga0439443_033187 | 3300042003 | Bacteria | 858 |
| 280 | Ga0450894_010093 | 3300042131 | Bacteria | 1224 |
| 281 | Ga0450896_012491 | 3300042133 | Bacteria | 1202 |
| 282 | Ga0439446_0025965 | 3300042156 | Bacteria | 1676 |
| 283 | Ga0439446_0118209 | 3300042156 | Bacteria | 851 |
| 284 | Ga0439446_0365942 | 3300042156 | Bacteria | 516 |
| 285 | Ga0439434_0016539 | 3300042435 | Bacteria | 2204 |
| 286 | Ga0439435_0005383 | 3300042436 | Bacteria | 2813 |
| 287 | Ga0439435_0140830 | 3300042436 | Bacteria | 768 |
| 288 | Ga0439444_0002683 | 3300042437 | Bacteria | 2456 |
| 289 | Ga0439460_0085373 | 3300042461 | Bacteria | 996 |
| 290 | Ga0451577_0129911 | 3300042876 | Bacteria | 2259 |
| 291 | Ga0451577_0250739 | 3300042876 | Bacteria | 1602 |
| 292 | Ga0453683_0520145 | 3300044673 | Bacteria | 773 |
| 293 | Ga0453683_0776731 | 3300044673 | Bacteria | 630 |
| 294 | Ga0453684_0200323 | 3300044712 | Bacteria | 2328 |
| 295 | Ga0451576_0061023 | 3300045051 | Bacteria | 3932 |
| 296 | Ga0451576_0147230 | 3300045051 | Bacteria | 2455 |
| 297 | Ga0451576_0708232 | 3300045051 | Bacteria | 1058 |
| 298 | Ga0451576_0811624 | 3300045051 | Bacteria | 982 |
| 299 | Ga0495592_0001459 | 3300046454 | Bacteria | 16431 |
| 300 | Ga0495629_0213398 | 3300046459 | Bacteria | 1333 |
| 301 | Ga0495641_0177712 | 3300046461 | Bacteria | 953 |
| 302 | Ga0495651_0168529 | 3300046462 | Bacteria | 1562 |
| 303 | Ga0495653_0894807 | 3300046463 | Bacteria | 529 |
| 304 | Ga0495662_0081887 | 3300046476 | Bacteria | 1570 |
| 305 | Ga0495664_0420339 | 3300046477 | Bacteria | 802 |
| 306 | Ga0495594_0748127 | 3300046499 | Bacteria | 552 |
| 307 | Ga0495608_0014358 | 3300046511 | Bacteria | 5496 |
| 308 | Ga0495618_0369164 | 3300046514 | Bacteria | 882 |
| 309 | Ga0495628_0007233 | 3300046516 | Bacteria | 9614 |
| 310 | Ga0495628_0195791 | 3300046516 | Bacteria | 1525 |
| 311 | Ga0495630_0106327 | 3300046517 | Bacteria | 2125 |
| 312 | Ga0495630_0283251 | 3300046517 | Bacteria | 1266 |
| 313 | Ga0495630_0589669 | 3300046517 | Bacteria | 852 |
| 314 | Ga0495632_0458747 | 3300046519 | Bacteria | 552 |
| 315 | Ga0495663_0104184 | 3300046525 | Bacteria | 937 |
| 316 | Ga0495666_0064350 | 3300046526 | Bacteria | 1750 |
| 317 | Ga0495652_0078729 | 3300046529 | Bacteria | 2727 |
| 318 | Ga0495640_0001548 | 3300046533 | Bacteria | 18112 |
| 319 | Ga0495586_0000357 | 3300046535 | Bacteria | 28588 |
| 320 | Ga0495587_0025483 | 3300046536 | Bacteria | 3614 |
| 321 | Ga0495598_0101589 | 3300046537 | Bacteria | 952 |
| 322 | Ga0495621_0081966 | 3300046539 | Bacteria | 1204 |
| 323 | Ga0495621_0131079 | 3300046539 | Bacteria | 975 |
| 324 | Ga0495621_0420243 | 3300046539 | Bacteria | 569 |
| 325 | Ga0495645_0460621 | 3300046543 | Bacteria | 800 |
| 326 | Ga0495667_0670782 | 3300046559 | Bacteria | 643 |
| 327 | Ga0495634_0073672 | 3300046642 | Bacteria | 2245 |
| 328 | Ga0495634_0526811 | 3300046642 | Bacteria | 691 |
| 329 | Ga0495635_0449496 | 3300046663 | Bacteria | 852 |
| 330 | Ga0495635_1095244 | 3300046663 | Bacteria | 504 |
| 331 | Ga0495659_0215660 | 3300046664 | Bacteria | 791 |
| 332 | Ga0495657_0030714 | 3300046675 | Bacteria | 3760 |
| 333 | Ga0495599_0289701 | 3300046678 | Bacteria | 990 |
| 334 | Ga0495646_0210927 | 3300046680 | Bacteria | 1054 |
| 335 | Ga0495658_0465116 | 3300046683 | Bacteria | 808 |
| 336 | Ga0495669_0165969 | 3300046684 | Bacteria | 1049 |
| 337 | Ga0495613_0017571 | 3300046689 | Bacteria | 5327 |
| 338 | Ga0495600_0205758 | 3300046809 | Bacteria | 1262 |
| 339 | Ga0495581_0335891 | 3300047315 | Bacteria | 882 |
| 340 | Ga0495604_0038956 | 3300047317 | Bacteria | 3737 |
| 341 | Ga0495604_0255365 | 3300047317 | Bacteria | 1193 |
| 342 | Ga0495674_1138385 | 3300047319 | Bacteria | 592 |
| 343 | Ga0495680_0001930 | 3300047322 | Bacteria | 21801 |
| 344 | Ga0495680_0380887 | 3300047322 | Bacteria | 977 |
| 345 | Ga0495684_0502971 | 3300047471 | Bacteria | 833 |
| 346 | Ga0495593_0192147 | 3300047673 | Bacteria | 1027 |
| 347 | Ga0501291_098278 | 3300049514 | Bacteria | 607 |
| 348 | Ga0501296_006584 | 3300049519 | Bacteria | 1320 |
| 349 | Ga0501298_076232 | 3300049521 | Bacteria | 731 |
| 350 | Ga0501299_005557 | 3300049522 | Bacteria | 1942 |
| 351 | Ga0501031_0718074 | 3300049568 | Bacteria | 641 |
| 352 | Ga0501033_0777888 | 3300049570 | Bacteria | 648 |
| 353 | Ga0501033_0849660 | 3300049570 | Bacteria | 615 |
| 354 | Ga0501037_0622345 | 3300049573 | Bacteria | 723 |
| 355 | Ga0501038_0245188 | 3300049574 | Bacteria | 1421 |
| 356 | Ga0501038_0699915 | 3300049574 | Bacteria | 759 |
| 357 | Ga0501039_0030765 | 3300049575 | Bacteria | 4139 |
| 358 | Ga0501039_0130232 | 3300049575 | Bacteria | 1974 |
| 359 | Ga0501039_1169730 | 3300049575 | Bacteria | 595 |
| 360 | Ga0501040_0773707 | 3300049576 | Bacteria | 694 |
| 361 | Ga0501041_0265831 | 3300049577 | Bacteria | 1079 |
| 362 | Ga0501041_0548576 | 3300049577 | Bacteria | 736 |
| 363 | Ga0501042_0105145 | 3300049578 | Bacteria | 2031 |
| 364 | Ga0501042_0955291 | 3300049578 | Bacteria | 624 |
| 365 | Ga0501043_0281767 | 3300049579 | Bacteria | 1274 |
| 366 | Ga0501046_0000238 | 3300049580 | Bacteria | 56798 |
| 367 | Ga0501046_0084965 | 3300049580 | Bacteria | 2440 |
| 368 | Ga0501046_0086061 | 3300049580 | Bacteria | 2423 |
| 369 | Ga0501048_0154133 | 3300049582 | Bacteria | 1625 |
| 370 | Ga0501048_0651750 | 3300049582 | Bacteria | 756 |
| 371 | Ga0501048_1061674 | 3300049582 | Bacteria | 583 |
| 372 | Ga0501068_0507591 | 3300049584 | Bacteria | 782 |
| 373 | Ga0501071_0188483 | 3300049587 | Bacteria | 1546 |
| 374 | Ga0501071_0663697 | 3300049587 | Bacteria | 802 |
| 375 | Ga0501072_0096730 | 3300049588 | Bacteria | 2346 |
| 376 | Ga0501072_0107939 | 3300049588 | Bacteria | 2214 |
| 377 | Ga0501074_0224238 | 3300049590 | Bacteria | 1338 |
| 378 | Ga0501074_0419630 | 3300049590 | Bacteria | 949 |
| 379 | Ga0501075_0003230 | 3300049591 | Bacteria | 10903 |
| 380 | Ga0501075_0933550 | 3300049591 | Bacteria | 659 |
| 381 | Ga0501075_1050314 | 3300049591 | Bacteria | 619 |
| 382 | Ga0501076_0007714 | 3300049592 | Bacteria | 7839 |
| 383 | Ga0501076_0849561 | 3300049592 | Bacteria | 753 |
| 384 | Ga0501076_1270672 | 3300049592 | Bacteria | 605 |
| 385 | Ga0501077_0014839 | 3300049593 | Bacteria | 4898 |
| 386 | Ga0501077_1019510 | 3300049593 | Bacteria | 532 |
| 387 | Ga0501209_064244 | 3300049656 | Bacteria | 1031 |
| 388 | Ga0501216_135352 | 3300049660 | Bacteria | 575 |
| 389 | Ga0501227_026990 | 3300049665 | Bacteria | 1357 |
| 390 | Ga0501249_095269 | 3300049679 | Bacteria | 709 |
| 391 | Ga0501261_057237 | 3300049690 | Bacteria | 654 |
| 392 | Ga0501079_0106150 | 3300049741 | Bacteria | 2179 |
| 393 | Ga0501080_0106951 | 3300049742 | Bacteria | 2592 |
| 394 | Ga0501080_0913129 | 3300049742 | Bacteria | 765 |
| 395 | Ga0501080_1478419 | 3300049742 | Bacteria | 578 |
| 396 | Ga0501081_0163800 | 3300049743 | Bacteria | 1603 |
| 397 | Ga0501081_0277480 | 3300049743 | Bacteria | 1226 |
| 398 | Ga0501083_0192113 | 3300049744 | Bacteria | 1332 |
| 399 | Ga0501264_032185 | 3300049761 | Bacteria | 608 |
| 400 | Ga0501035_0228062 | 3300049822 | Bacteria | 1588 |
| 401 | Ga0501035_1385755 | 3300049822 | Bacteria | 539 |
| 402 | Ga0501045_0045519 | 3300049824 | Bacteria | 3194 |
| 403 | Ga0501045_0172440 | 3300049824 | Bacteria | 1611 |
| 404 | Ga0501045_0860039 | 3300049824 | Bacteria | 667 |
| 405 | Ga0501045_1057677 | 3300049824 | Bacteria | 594 |
| 406 | nmdc:mga03683_126992_c1 | 3300050489 | Bacteria | 1138 |
| 407 | nmdc:mga0k408_390882_c1 | 3300050493 | Bacteria | 828 |
| 408 | nmdc:mga05p37_1021482_c1 | 3300050507 | Bacteria | 876 |
| 409 | nmdc:mga05p37_1520294_c1 | 3300050507 | Bacteria | 665 |
| 410 | nmdc:mga05p37_2016436_c1 | 3300050507 | Bacteria | 545 |
| 411 | nmdc:mga05p37_280386_c1 | 3300050507 | Bacteria | 1988 |
| 412 | nmdc:mga09592_1228898_c1 | 3300050508 | Bacteria | 618 |
| 413 | nmdc:mga09592_1320053_c1 | 3300050508 | Bacteria | 592 |
| 414 | nmdc:mga09592_439004_c1 | 3300050508 | Bacteria | 1127 |
| 415 | nmdc:mga09592_819059_c1 | 3300050508 | Bacteria | 787 |
| 416 | nmdc:mga09592_868937_c1 | 3300050508 | Bacteria | 760 |
| 417 | nmdc:mga0qj67_20252_c1 | 3300050509 | Bacteria | 5091 |
| 418 | nmdc:mga0qj67_204684_c1 | 3300050509 | Bacteria | 1603 |
| 419 | nmdc:mga0qj67_818481_c1 | 3300050509 | Bacteria | 737 |
| 420 | nmdc:mga0qj67_97052_c1 | 3300050509 | Bacteria | 2373 |
| 421 | nmdc:mga06r32_1018954_c1 | 3300050510 | Bacteria | 780 |
| 422 | nmdc:mga06r32_120453_c1 | 3300050510 | Bacteria | 2588 |
| 423 | nmdc:mga06r32_1487463_c1 | 3300050510 | Bacteria | 618 |
| 424 | nmdc:mga06r32_153333_c1 | 3300050510 | Bacteria | 2284 |
| 425 | nmdc:mga06r32_308993_c1 | 3300050510 | Bacteria | 1567 |
| 426 | nmdc:mga08y16_144611_c1 | 3300050511 | Bacteria | 2472 |
| 427 | nmdc:mga08y16_1542684_c1 | 3300050511 | Bacteria | 624 |
| 428 | nmdc:mga08y16_175248_c1 | 3300050511 | Bacteria | 2227 |
| 429 | nmdc:mga08y16_210128_c1 | 3300050511 | Bacteria | 2016 |
| 430 | nmdc:mga08y16_2178356_c1 | 3300050511 | Bacteria | 501 |
| 431 | nmdc:mga08y16_56120_c1 | 3300050511 | Bacteria | 4117 |
| 432 | nmdc:mga0n895_141626_c1 | 3300050512 | Bacteria | 2433 |
| 433 | nmdc:mga0n895_4257_c1 | 3300050512 | Bacteria | 11707 |
| 434 | nmdc:mga0n895_84_c1 | 3300050512 | Bacteria | 54345 |
| 435 | nmdc:mga0rr50_1118570_c1 | 3300050513 | Bacteria | 670 |
| 436 | nmdc:mga0rr50_1637_c1 | 3300050513 | Bacteria | 12325 |
| 437 | nmdc:mga0rr50_221923_c1 | 3300050513 | Bacteria | 1561 |
| 438 | nmdc:mga0rr50_337094_c1 | 3300050513 | Bacteria | 1267 |
| 439 | nmdc:mga0rr50_61571_c1 | 3300050513 | Bacteria | 2828 |
| 440 | nmdc:mga0rr50_63068_c1 | 3300050513 | Bacteria | 2798 |
| 441 | nmdc:mga0rr50_729090_c1 | 3300050513 | Bacteria | 846 |
| 442 | nmdc:mga08x19_19968_c1 | 3300050514 | Bacteria | 4121 |
| 443 | nmdc:mga08x19_31088_c1 | 3300050514 | Bacteria | 3357 |
| 444 | nmdc:mga08x19_640_c1 | 3300050514 | Bacteria | 22635 |
| 445 | nmdc:mga08x19_849093_c1 | 3300050514 | Bacteria | 649 |
| 446 | nmdc:mga08x19_96464_c1 | 3300050514 | Bacteria | 1957 |
| 447 | nmdc:mga0a205_1228040_c1 | 3300050515 | Bacteria | 597 |
| 448 | nmdc:mga0a205_570406_c1 | 3300050515 | Bacteria | 986 |
| 449 | nmdc:mga0a205_828995_c1 | 3300050515 | Bacteria | 772 |
| 450 | nmdc:mga0a205_8513_c1 | 3300050515 | Bacteria | 9328 |
| 451 | Ga0495601_0038212 | 3300053077 | Bacteria | 3001 |
| 452 | Ga0495595_0135716 | 3300053084 | Bacteria | 1205 |
| 453 | Ga0501084_0123948 | 3300054114 | Bacteria | 2173 |
| 454 | Ga0501084_0693018 | 3300054114 | Bacteria | 859 |
| 455 | Ga0590071_061863 | 3300059421 | Bacteria | 916 |
| 456 | Ga0590071_102095 | 3300059421 | Bacteria | 723 |
| 457 | Ga0590071_119310 | 3300059421 | Bacteria | 673 |
| 458 | Ga0501082_0470367 | 3300060353 | Bacteria | 1098 |
| 459 | Ga0530510_0006411 | 3300061734 | Bacteria | 8196 |
| 460 | Ga0530510_1103955 | 3300061734 | Bacteria | 608 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300007265 | Ga0099794_10407989 | Ga0099794_104079892 | 100 |
| 2 | 3300059421 | Ga0590071_119310 | Ga0590071_119310_123_497 | 101 |
| 3 | 3300025910 | Ga0207684_10284392 | Ga0207684_102843923 | 103 |
| 4 | 3300014326 | Ga0157380_10385273 | Ga0157380_103852733 | 104 |
| 5 | 3300035207 | Ga0373942_0288194 | Ga0373942_0288194_63_446 | 104 |
| 6 | 3300046539 | Ga0495621_0131079 | Ga0495621_0131079_475_834 | 105 |
| 7 | 3300005406 | Ga0070703_10305496 | Ga0070703_103054962 | 106 |
| 8 | 3300005459 | Ga0068867_100939204 | Ga0068867_1009392041 | 106 |
| 9 | 3300005544 | Ga0070686_100592300 | Ga0070686_1005923003 | 106 |
| 10 | 3300005844 | Ga0068862_100340725 | Ga0068862_1003407253 | 106 |
| 11 | 3300006846 | Ga0075430_100353996 | Ga0075430_1003539962 | 106 |
| 12 | 3300009147 | Ga0114129_10177943 | Ga0114129_101779433 | 106 |
| 13 | 3300025885 | Ga0207653_10266777 | Ga0207653_102667772 | 106 |
| 14 | 3300027462 | Ga0210000_1020122 | Ga0210000_10201222 | 106 |
| 15 | 3300027543 | Ga0209999_1010072 | Ga0209999_10100722 | 106 |
| 16 | 3300027614 | Ga0209970_1037616 | Ga0209970_10376162 | 106 |
| 17 | 3300027695 | Ga0209966_1014089 | Ga0209966_10140893 | 106 |
| 18 | 3300027876 | Ga0209974_10014768 | Ga0209974_100147684 | 106 |
| 19 | 3300041408 | Ga0439453_0008422 | Ga0439453_0008422_261_611 | 106 |
| 20 | 3300042003 | Ga0439443_031463 | Ga0439443_031463_258_608 | 106 |
| 21 | 3300042437 | Ga0439444_0002683 | Ga0439444_0002683_1864_2214 | 106 |
| 22 | 3300042461 | Ga0439460_0085373 | Ga0439460_0085373_498_848 | 106 |
| 23 | 3300050507 | nmdc:mga05p37_1021482_c1 | nmdc:mga05p37_1021482_c1_230_580 | 106 |
| 24 | 3300050508 | nmdc:mga09592_439004_c1 | nmdc:mga09592_439004_c1_351_701 | 106 |
| 25 | 3300050510 | nmdc:mga06r32_1487463_c1 | nmdc:mga06r32_1487463_c1_128_478 | 106 |
| 26 | 3300006195 | Ga0075366_10242920 | Ga0075366_102429202 | 107 |
| 27 | 3300027378 | Ga0209981_1000418 | Ga0209981_10004183 | 107 |
| 28 | 3300049824 | Ga0501045_0172440 | Ga0501045_0172440_1060_1416 | 107 |
| 29 | 3300050493 | nmdc:mga0k408_390882_c1 | nmdc:mga0k408_390882_c1_315_668 | 107 |
| 30 | 3300006846 | Ga0075430_100062166 | Ga0075430_1000621663 | 109 |
| 31 | 3300007076 | Ga0075435_100136068 | Ga0075435_1001360683 | 109 |
| 32 | 3300049742 | Ga0501080_1478419 | Ga0501080_1478419_109_462 | 109 |
| 33 | 3300050509 | nmdc:mga0qj67_20252_c1 | nmdc:mga0qj67_20252_c1_2061_2420 | 109 |
| 34 | 3300050513 | nmdc:mga0rr50_337094_c1 | nmdc:mga0rr50_337094_c1_747_1127 | 109 |
| 35 | 3300005345 | Ga0070692_10175134 | Ga0070692_101751342 | 110 |
| 36 | 3300005444 | Ga0070694_100033358 | Ga0070694_1000333586 | 110 |
| 37 | 3300005545 | Ga0070695_100035895 | Ga0070695_1000358954 | 110 |
| 38 | 3300005546 | Ga0070696_101755681 | Ga0070696_1017556811 | 110 |
| 39 | 3300049577 | Ga0501041_0265831 | Ga0501041_0265831_390_767 | 111 |
| 40 | 3300027682 | Ga0209971_1137408 | Ga0209971_11374082 | 114 |
| 41 | 3300042131 | Ga0450894_010093 | Ga0450894_010093_526_900 | 114 |
| 42 | 3300042133 | Ga0450896_012491 | Ga0450896_012491_198_572 | 114 |
| 43 | 3300049568 | Ga0501031_0718074 | Ga0501031_0718074_122_499 | 114 |
| 44 | 3300049570 | Ga0501033_0849660 | Ga0501033_0849660_146_523 | 114 |
| 45 | 3300049573 | Ga0501037_0622345 | Ga0501037_0622345_245_592 | 114 |
| 46 | 3300049574 | Ga0501038_0699915 | Ga0501038_0699915_213_590 | 114 |
| 47 | 3300049575 | Ga0501039_0130232 | Ga0501039_0130232_213_590 | 114 |
| 48 | 3300049578 | Ga0501042_0105145 | Ga0501042_0105145_290_667 | 114 |
| 49 | 3300049579 | Ga0501043_0281767 | Ga0501043_0281767_101_478 | 114 |
| 50 | 3300049580 | Ga0501046_0000238 | Ga0501046_0000238_33108_33458 | 114 |
| 51 | 3300049580 | Ga0501046_0086061 | Ga0501046_0086061_1840_2217 | 114 |
| 52 | 3300049587 | Ga0501071_0663697 | Ga0501071_0663697_211_588 | 114 |
| 53 | 3300049588 | Ga0501072_0096730 | Ga0501072_0096730_1782_2159 | 114 |
| 54 | 3300049590 | Ga0501074_0419630 | Ga0501074_0419630_511_888 | 114 |
| 55 | 3300049591 | Ga0501075_0933550 | Ga0501075_0933550_129_506 | 114 |
| 56 | 3300049592 | Ga0501076_1270672 | Ga0501076_1270672_137_514 | 114 |
| 57 | 3300049593 | Ga0501077_1019510 | Ga0501077_1019510_52_426 | 114 |
| 58 | 3300049741 | Ga0501079_0106150 | Ga0501079_0106150_682_1059 | 114 |
| 59 | 3300049822 | Ga0501035_1385755 | Ga0501035_1385755_109_486 | 114 |
| 60 | 3300054114 | Ga0501084_0693018 | Ga0501084_0693018_224_601 | 114 |
| 61 | 3300059421 | Ga0590071_102095 | Ga0590071_102095_93_467 | 114 |
| 62 | 3300060353 | Ga0501082_0470367 | Ga0501082_0470367_258_635 | 114 |
| 63 | 3300061734 | Ga0530510_1103955 | Ga0530510_1103955_120_497 | 114 |
| 64 | 3300005295 | Ga0065707_10425700 | Ga0065707_104257002 | 115 |
| 65 | 3300049519 | Ga0501296_006584 | Ga0501296_006584_875_1222 | 115 |
| 66 | 3300049591 | Ga0501075_1050314 | Ga0501075_1050314_159_506 | 115 |
| 67 | 3300049656 | Ga0501209_064244 | Ga0501209_064244_524_871 | 115 |
| 68 | 3300005289 | Ga0065704_10309035 | Ga0065704_103090352 | 116 |
| 69 | 3300005295 | Ga0065707_10137559 | Ga0065707_101375593 | 116 |
| 70 | 3300005295 | Ga0065707_10536195 | Ga0065707_105361952 | 116 |
| 71 | 3300005328 | Ga0070676_10172435 | Ga0070676_101724352 | 116 |
| 72 | 3300005336 | Ga0070680_100672180 | Ga0070680_1006721802 | 116 |
| 73 | 3300005340 | Ga0070689_100113620 | Ga0070689_1001136204 | 116 |
| 74 | 3300005340 | Ga0070689_100142292 | Ga0070689_1001422924 | 116 |
| 75 | 3300005341 | Ga0070691_10035193 | Ga0070691_100351933 | 116 |
| 76 | 3300005343 | Ga0070687_100005966 | Ga0070687_1000059667 | 116 |
| 77 | 3300005343 | Ga0070687_100133202 | Ga0070687_1001332022 | 116 |
| 78 | 3300005343 | Ga0070687_100484370 | Ga0070687_1004843703 | 116 |
| 79 | 3300005343 | Ga0070687_100666855 | Ga0070687_1006668552 | 116 |
| 80 | 3300005345 | Ga0070692_10192743 | Ga0070692_101927431 | 116 |
| 81 | 3300005345 | Ga0070692_10384510 | Ga0070692_103845103 | 116 |
| 82 | 3300005347 | Ga0070668_100445338 | Ga0070668_1004453382 | 116 |
| 83 | 3300005353 | Ga0070669_100114736 | Ga0070669_1001147364 | 116 |
| 84 | 3300005354 | Ga0070675_100424377 | Ga0070675_1004243772 | 116 |
| 85 | 3300005354 | Ga0070675_101784280 | Ga0070675_1017842802 | 116 |
| 86 | 3300005355 | Ga0070671_101539535 | Ga0070671_1015395352 | 116 |
| 87 | 3300005356 | Ga0070674_100017599 | Ga0070674_1000175996 | 116 |
| 88 | 3300005356 | Ga0070674_101042765 | Ga0070674_1010427652 | 116 |
| 89 | 3300005364 | Ga0070673_100142021 | Ga0070673_1001420212 | 116 |
| 90 | 3300005364 | Ga0070673_100340188 | Ga0070673_1003401883 | 116 |
| 91 | 3300005364 | Ga0070673_101583648 | Ga0070673_1015836481 | 116 |
| 92 | 3300005366 | Ga0070659_101212141 | Ga0070659_1012121412 | 116 |
| 93 | 3300005406 | Ga0070703_10119027 | Ga0070703_101190272 | 116 |
| 94 | 3300005437 | Ga0070710_10015838 | Ga0070710_100158382 | 116 |
| 95 | 3300005437 | Ga0070710_10336955 | Ga0070710_103369553 | 116 |
| 96 | 3300005438 | Ga0070701_10030684 | Ga0070701_100306843 | 116 |
| 97 | 3300005438 | Ga0070701_10320777 | Ga0070701_103207772 | 116 |
| 98 | 3300005439 | Ga0070711_100838073 | Ga0070711_1008380731 | 116 |
| 99 | 3300005440 | Ga0070705_100035743 | Ga0070705_1000357434 | 116 |
| 100 | 3300005440 | Ga0070705_100097301 | Ga0070705_1000973013 | 116 |
| 101 | 3300005440 | Ga0070705_101776196 | Ga0070705_1017761962 | 116 |
| 102 | 3300005441 | Ga0070700_100291475 | Ga0070700_1002914752 | 116 |
| 103 | 3300005441 | Ga0070700_100580083 | Ga0070700_1005800832 | 116 |
| 104 | 3300005441 | Ga0070700_100799019 | Ga0070700_1007990193 | 116 |
| 105 | 3300005444 | Ga0070694_100117820 | Ga0070694_1001178203 | 116 |
| 106 | 3300005444 | Ga0070694_100942011 | Ga0070694_1009420113 | 116 |
| 107 | 3300005459 | Ga0068867_100271201 | Ga0068867_1002712013 | 116 |
| 108 | 3300005466 | Ga0070685_10143130 | Ga0070685_101431303 | 116 |
| 109 | 3300005467 | Ga0070706_100876399 | Ga0070706_1008763991 | 116 |
| 110 | 3300005468 | Ga0070707_100629477 | Ga0070707_1006294772 | 116 |
| 111 | 3300005471 | Ga0070698_100160741 | Ga0070698_1001607414 | 116 |
| 112 | 3300005518 | Ga0070699_100005128 | Ga0070699_10000512813 | 116 |
| 113 | 3300005530 | Ga0070679_100855777 | Ga0070679_1008557773 | 116 |
| 114 | 3300005535 | Ga0070684_100261003 | Ga0070684_1002610032 | 116 |
| 115 | 3300005536 | Ga0070697_100254463 | Ga0070697_1002544632 | 116 |
| 116 | 3300005536 | Ga0070697_101564199 | Ga0070697_1015641991 | 116 |
| 117 | 3300005543 | Ga0070672_101352083 | Ga0070672_1013520831 | 116 |
| 118 | 3300005544 | Ga0070686_100012586 | Ga0070686_1000125862 | 116 |
| 119 | 3300005544 | Ga0070686_100381934 | Ga0070686_1003819343 | 116 |
| 120 | 3300005544 | Ga0070686_100525962 | Ga0070686_1005259622 | 116 |
| 121 | 3300005545 | Ga0070695_100697522 | Ga0070695_1006975223 | 116 |
| 122 | 3300005546 | Ga0070696_100626754 | Ga0070696_1006267543 | 116 |
| 123 | 3300005546 | Ga0070696_100667217 | Ga0070696_1006672172 | 116 |
| 124 | 3300005547 | Ga0070693_100080237 | Ga0070693_1000802372 | 116 |
| 125 | 3300005549 | Ga0070704_100131166 | Ga0070704_1001311663 | 116 |
| 126 | 3300005549 | Ga0070704_101800975 | Ga0070704_1018009751 | 116 |
| 127 | 3300005563 | Ga0068855_100179722 | Ga0068855_1001797221 | 116 |
| 128 | 3300005577 | Ga0068857_100526419 | Ga0068857_1005264192 | 116 |
| 129 | 3300005614 | Ga0068856_100128641 | Ga0068856_1001286414 | 116 |
| 130 | 3300005615 | Ga0070702_100428896 | Ga0070702_1004288963 | 116 |
| 131 | 3300005616 | Ga0068852_101709380 | Ga0068852_1017093802 | 116 |
| 132 | 3300005617 | Ga0068859_100430124 | Ga0068859_1004301243 | 116 |
| 133 | 3300005618 | Ga0068864_100032337 | Ga0068864_1000323375 | 116 |
| 134 | 3300005618 | Ga0068864_100508935 | Ga0068864_1005089353 | 116 |
| 135 | 3300005718 | Ga0068866_10590094 | Ga0068866_105900942 | 116 |
| 136 | 3300005719 | Ga0068861_101197025 | Ga0068861_1011970252 | 116 |
| 137 | 3300005719 | Ga0068861_101354859 | Ga0068861_1013548592 | 116 |
| 138 | 3300005719 | Ga0068861_101812223 | Ga0068861_1018122232 | 116 |
| 139 | 3300005840 | Ga0068870_10547554 | Ga0068870_105475543 | 116 |
| 140 | 3300005840 | Ga0068870_11263939 | Ga0068870_112639392 | 116 |
| 141 | 3300005841 | Ga0068863_100439365 | Ga0068863_1004393653 | 116 |
| 142 | 3300005842 | Ga0068858_100161792 | Ga0068858_1001617922 | 116 |
| 143 | 3300005843 | Ga0068860_100059351 | Ga0068860_1000593514 | 116 |
| 144 | 3300005844 | Ga0068862_100611572 | Ga0068862_1006115722 | 116 |
| 145 | 3300005844 | Ga0068862_100738819 | Ga0068862_1007388193 | 116 |
| 146 | 3300005844 | Ga0068862_100903138 | Ga0068862_1009031382 | 116 |
| 147 | 3300006051 | Ga0075364_10457104 | Ga0075364_104571042 | 116 |
| 148 | 3300006173 | Ga0070716_100123324 | Ga0070716_1001233243 | 116 |
| 149 | 3300006177 | Ga0075362_10213550 | Ga0075362_102135503 | 116 |
| 150 | 3300006237 | Ga0097621_100005707 | Ga0097621_1000057078 | 116 |
| 151 | 3300006358 | Ga0068871_100137412 | Ga0068871_1001374124 | 116 |
| 152 | 3300006358 | Ga0068871_101699237 | Ga0068871_1016992372 | 116 |
| 153 | 3300006358 | Ga0068871_102208549 | Ga0068871_1022085491 | 116 |
| 154 | 3300006844 | Ga0075428_100910824 | Ga0075428_1009108242 | 116 |
| 155 | 3300006846 | Ga0075430_100176511 | Ga0075430_1001765112 | 116 |
| 156 | 3300006846 | Ga0075430_100266117 | Ga0075430_1002661173 | 116 |
| 157 | 3300006846 | Ga0075430_100271574 | Ga0075430_1002715743 | 116 |
| 158 | 3300006847 | Ga0075431_100032779 | Ga0075431_1000327797 | 116 |
| 159 | 3300006847 | Ga0075431_100256808 | Ga0075431_1002568082 | 116 |
| 160 | 3300006847 | Ga0075431_100401122 | Ga0075431_1004011223 | 116 |
| 161 | 3300006847 | Ga0075431_100599729 | Ga0075431_1005997292 | 116 |
| 162 | 3300006852 | Ga0075433_10081675 | Ga0075433_100816755 | 116 |
| 163 | 3300006852 | Ga0075433_11518190 | Ga0075433_115181902 | 116 |
| 164 | 3300006852 | Ga0075433_11739548 | Ga0075433_117395482 | 116 |
| 165 | 3300006871 | Ga0075434_100000108 | Ga0075434_1000001083 | 116 |
| 166 | 3300006871 | Ga0075434_100017797 | Ga0075434_1000177977 | 116 |
| 167 | 3300006871 | Ga0075434_101875256 | Ga0075434_1018752562 | 116 |
| 168 | 3300006871 | Ga0075434_102483388 | Ga0075434_1024833882 | 116 |
| 169 | 3300006880 | Ga0075429_100241145 | Ga0075429_1002411453 | 116 |
| 170 | 3300006880 | Ga0075429_100287165 | Ga0075429_1002871653 | 116 |
| 171 | 3300006880 | Ga0075429_101432455 | Ga0075429_1014324552 | 116 |
| 172 | 3300006881 | Ga0068865_100351947 | Ga0068865_1003519472 | 116 |
| 173 | 3300006914 | Ga0075436_100004151 | Ga0075436_1000041513 | 116 |
| 174 | 3300006914 | Ga0075436_100005987 | Ga0075436_1000059873 | 116 |
| 175 | 3300006914 | Ga0075436_100312138 | Ga0075436_1003121382 | 116 |
| 176 | 3300006914 | Ga0075436_100364894 | Ga0075436_1003648943 | 116 |
| 177 | 3300006914 | Ga0075436_101077230 | Ga0075436_1010772301 | 116 |
| 178 | 3300006931 | Ga0097620_100430122 | Ga0097620_1004301223 | 116 |
| 179 | 3300007076 | Ga0075435_100002462 | Ga0075435_1000024623 | 116 |
| 180 | 3300007076 | Ga0075435_100111980 | Ga0075435_1001119804 | 116 |
| 181 | 3300007076 | Ga0075435_100181753 | Ga0075435_1001817532 | 116 |
| 182 | 3300007076 | Ga0075435_101180941 | Ga0075435_1011809412 | 116 |
| 183 | 3300007265 | Ga0099794_10009256 | Ga0099794_100092563 | 116 |
| 184 | 3300007788 | Ga0099795_10346561 | Ga0099795_103465613 | 116 |
| 185 | 3300009094 | Ga0111539_10163730 | Ga0111539_101637303 | 116 |
| 186 | 3300009094 | Ga0111539_10358423 | Ga0111539_103584233 | 116 |
| 187 | 3300009094 | Ga0111539_11172519 | Ga0111539_111725192 | 116 |
| 188 | 3300009094 | Ga0111539_11473155 | Ga0111539_114731553 | 116 |
| 189 | 3300009094 | Ga0111539_11944157 | Ga0111539_119441571 | 116 |
| 190 | 3300009147 | Ga0114129_10084574 | Ga0114129_100845747 | 116 |
| 191 | 3300009147 | Ga0114129_11070245 | Ga0114129_110702453 | 116 |
| 192 | 3300009147 | Ga0114129_11922223 | Ga0114129_119222232 | 116 |
| 193 | 3300009148 | Ga0105243_10167260 | Ga0105243_101672603 | 116 |
| 194 | 3300009177 | Ga0105248_10816755 | Ga0105248_108167551 | 116 |
| 195 | 3300009177 | Ga0105248_12225055 | Ga0105248_122250553 | 116 |
| 196 | 3300009553 | Ga0105249_10557105 | Ga0105249_105571053 | 116 |
| 197 | 3300010159 | Ga0099796_10096594 | Ga0099796_100965942 | 116 |
| 198 | 3300010159 | Ga0099796_10178310 | Ga0099796_101783102 | 116 |
| 199 | 3300010375 | Ga0105239_12092281 | Ga0105239_120922812 | 116 |
| 200 | 3300011119 | Ga0105246_11276690 | Ga0105246_112766902 | 116 |
| 201 | 3300012483 | Ga0157337_1008558 | Ga0157337_10085582 | 116 |
| 202 | 3300013297 | Ga0157378_10931828 | Ga0157378_109318283 | 116 |
| 203 | 3300013306 | Ga0163162_11571172 | Ga0163162_115711722 | 116 |
| 204 | 3300013307 | Ga0157372_13447944 | Ga0157372_134479442 | 116 |
| 205 | 3300013308 | Ga0157375_11094575 | Ga0157375_110945753 | 116 |
| 206 | 3300014326 | Ga0157380_10992944 | Ga0157380_109929442 | 116 |
| 207 | 3300014326 | Ga0157380_11526238 | Ga0157380_115262382 | 116 |
| 208 | 3300014969 | Ga0157376_10302294 | Ga0157376_103022942 | 116 |
| 209 | 3300017792 | Ga0163161_10115095 | Ga0163161_101150954 | 116 |
| 210 | 3300025885 | Ga0207653_10216465 | Ga0207653_102164652 | 116 |
| 211 | 3300025898 | Ga0207692_10046508 | Ga0207692_100465084 | 116 |
| 212 | 3300025899 | Ga0207642_10064024 | Ga0207642_100640243 | 116 |
| 213 | 3300025907 | Ga0207645_10074855 | Ga0207645_100748553 | 116 |
| 214 | 3300025908 | Ga0207643_10453797 | Ga0207643_104537973 | 116 |
| 215 | 3300025916 | Ga0207663_10654789 | Ga0207663_106547893 | 116 |
| 216 | 3300025917 | Ga0207660_10167916 | Ga0207660_101679162 | 116 |
| 217 | 3300025917 | Ga0207660_10424941 | Ga0207660_104249412 | 116 |
| 218 | 3300025917 | Ga0207660_11075558 | Ga0207660_110755581 | 116 |
| 219 | 3300025918 | Ga0207662_10486498 | Ga0207662_104864982 | 116 |
| 220 | 3300025918 | Ga0207662_11330625 | Ga0207662_113306252 | 116 |
| 221 | 3300025921 | Ga0207652_10967981 | Ga0207652_109679812 | 116 |
| 222 | 3300025922 | Ga0207646_10151294 | Ga0207646_101512944 | 116 |
| 223 | 3300025923 | Ga0207681_10009582 | Ga0207681_100095827 | 116 |
| 224 | 3300025926 | Ga0207659_10116488 | Ga0207659_101164882 | 116 |
| 225 | 3300025932 | Ga0207690_10507641 | Ga0207690_105076413 | 116 |
| 226 | 3300025934 | Ga0207686_10811840 | Ga0207686_108118403 | 116 |
| 227 | 3300025935 | Ga0207709_10002389 | Ga0207709_100023892 | 116 |
| 228 | 3300025935 | Ga0207709_11066297 | Ga0207709_110662972 | 116 |
| 229 | 3300025936 | Ga0207670_10379116 | Ga0207670_103791163 | 116 |
| 230 | 3300025936 | Ga0207670_11305766 | Ga0207670_113057662 | 116 |
| 231 | 3300025938 | Ga0207704_10052138 | Ga0207704_100521382 | 116 |
| 232 | 3300025939 | Ga0207665_10240081 | Ga0207665_102400813 | 116 |
| 233 | 3300025940 | Ga0207691_10024076 | Ga0207691_100240763 | 116 |
| 234 | 3300025941 | Ga0207711_10678408 | Ga0207711_106784083 | 116 |
| 235 | 3300025942 | Ga0207689_10763726 | Ga0207689_107637263 | 116 |
| 236 | 3300025960 | Ga0207651_10227969 | Ga0207651_102279692 | 116 |
| 237 | 3300025960 | Ga0207651_11577334 | Ga0207651_115773342 | 116 |
| 238 | 3300025961 | Ga0207712_10526495 | Ga0207712_105264953 | 116 |
| 239 | 3300025972 | Ga0207668_10190354 | Ga0207668_101903543 | 116 |
| 240 | 3300025981 | Ga0207640_10332722 | Ga0207640_103327223 | 116 |
| 241 | 3300026035 | Ga0207703_10994816 | Ga0207703_109948162 | 116 |
| 242 | 3300026075 | Ga0207708_10178451 | Ga0207708_101784513 | 116 |
| 243 | 3300026075 | Ga0207708_11033115 | Ga0207708_110331153 | 116 |
| 244 | 3300026075 | Ga0207708_11100049 | Ga0207708_111000491 | 116 |
| 245 | 3300026088 | Ga0207641_10200741 | Ga0207641_102007414 | 116 |
| 246 | 3300026089 | Ga0207648_10027500 | Ga0207648_100275007 | 116 |
| 247 | 3300026089 | Ga0207648_11798249 | Ga0207648_117982492 | 116 |
| 248 | 3300026089 | Ga0207648_12102749 | Ga0207648_121027492 | 116 |
| 249 | 3300026095 | Ga0207676_10083750 | Ga0207676_100837505 | 116 |
| 250 | 3300026116 | Ga0207674_10458793 | Ga0207674_104587933 | 116 |
| 251 | 3300026118 | Ga0207675_100288940 | Ga0207675_1002889403 | 116 |
| 252 | 3300026118 | Ga0207675_100847813 | Ga0207675_1008478131 | 116 |
| 253 | 3300026121 | Ga0207683_10419886 | Ga0207683_104198862 | 116 |
| 254 | 3300026142 | Ga0207698_10355884 | Ga0207698_103558843 | 116 |
| 255 | 3300027364 | Ga0209967_1011113 | Ga0209967_10111133 | 116 |
| 256 | 3300027665 | Ga0209983_1089930 | Ga0209983_10899302 | 116 |
| 257 | 3300027671 | Ga0209588_1044459 | Ga0209588_10444593 | 116 |
| 258 | 3300027695 | Ga0209966_1017909 | Ga0209966_10179092 | 116 |
| 259 | 3300027907 | Ga0207428_10044307 | Ga0207428_100443073 | 116 |
| 260 | 3300027907 | Ga0207428_10070569 | Ga0207428_100705694 | 116 |
| 261 | 3300027907 | Ga0207428_10130938 | Ga0207428_101309383 | 116 |
| 262 | 3300027907 | Ga0207428_10684680 | Ga0207428_106846802 | 116 |
| 263 | 3300028380 | Ga0268265_11274258 | Ga0268265_112742583 | 116 |
| 264 | 3300028381 | Ga0268264_10053231 | Ga0268264_100532313 | 116 |
| 265 | 3300028381 | Ga0268264_11696108 | Ga0268264_116961082 | 116 |
| 266 | 3300028786 | Ga0307517_10541244 | Ga0307517_105412442 | 116 |
| 267 | 3300031239 | Ga0265328_10295526 | Ga0265328_102955261 | 116 |
| 268 | 3300031548 | Ga0307408_100061611 | Ga0307408_1000616115 | 116 |
| 269 | 3300031548 | Ga0307408_101330855 | Ga0307408_1013308552 | 116 |
| 270 | 3300031824 | Ga0307413_10588004 | Ga0307413_105880043 | 116 |
| 271 | 3300031901 | Ga0307406_11151292 | Ga0307406_111512922 | 116 |
| 272 | 3300032002 | Ga0307416_100621845 | Ga0307416_1006218452 | 116 |
| 273 | 3300032002 | Ga0307416_102566924 | Ga0307416_1025669242 | 116 |
| 274 | 3300032005 | Ga0307411_10261676 | Ga0307411_102616763 | 116 |
| 275 | 3300034818 | Ga0373950_0047224 | Ga0373950_0047224_156_506 | 116 |
| 276 | 3300034819 | Ga0373958_0090102 | Ga0373958_0090102_119_475 | 116 |
| 277 | 3300035091 | Ga0373951_0025490 | Ga0373951_0025490_415_771 | 116 |
| 278 | 3300035111 | Ga0373923_0348873 | Ga0373923_0348873_222_575 | 116 |
| 279 | 3300035111 | Ga0373923_0625016 | Ga0373923_0625016_82_435 | 116 |
| 280 | 3300035114 | Ga0373939_0263416 | Ga0373939_0263416_23_376 | 116 |
| 281 | 3300035115 | Ga0373941_0196245 | Ga0373941_0196245_91_441 | 116 |
| 282 | 3300035115 | Ga0373941_0450100 | Ga0373941_0450100_37_411 | 116 |
| 283 | 3300035117 | Ga0373953_0015021 | Ga0373953_0015021_2393_2746 | 116 |
| 284 | 3300035117 | Ga0373953_0182170 | Ga0373953_0182170_280_633 | 116 |
| 285 | 3300035118 | Ga0373954_0000137 | Ga0373954_0000137_3200_3553 | 116 |
| 286 | 3300035118 | Ga0373954_0012198 | Ga0373954_0012198_2163_2516 | 116 |
| 287 | 3300035119 | Ga0373956_0042978 | Ga0373956_0042978_1592_1945 | 116 |
| 288 | 3300035119 | Ga0373956_0149732 | Ga0373956_0149732_450_803 | 116 |
| 289 | 3300035121 | Ga0373960_0329403 | Ga0373960_0329403_71_427 | 116 |
| 290 | 3300035170 | Ga0373943_0377574 | Ga0373943_0377574_115_492 | 116 |
| 291 | 3300035171 | Ga0373946_0017017 | Ga0373946_0017017_1144_1521 | 116 |
| 292 | 3300035172 | Ga0373955_0016001 | Ga0373955_0016001_274_627 | 116 |
| 293 | 3300035207 | Ga0373942_0136684 | Ga0373942_0136684_238_594 | 116 |
| 294 | 3300035207 | Ga0373942_0138459 | Ga0373942_0138459_22_396 | 116 |
| 295 | 3300035241 | Ga0373961_0102166 | Ga0373961_0102166_529_885 | 116 |
| 296 | 3300035242 | Ga0373962_0156465 | Ga0373962_0156465_73_429 | 116 |
| 297 | 3300035410 | Ga0373924_0590758 | Ga0373924_0590758_90_443 | 116 |
| 298 | 3300035691 | Ga0373931_0054464 | Ga0373931_0054464_222_575 | 116 |
| 299 | 3300035691 | Ga0373931_0055426 | Ga0373931_0055426_99_476 | 116 |
| 300 | 3300035692 | Ga0373935_0120999 | Ga0373935_0120999_221_574 | 116 |
| 301 | 3300035692 | Ga0373935_0282219 | Ga0373935_0282219_483_860 | 116 |
| 302 | 3300035692 | Ga0373935_1119274 | Ga0373935_1119274_32_385 | 116 |
| 303 | 3300035695 | Ga0373927_0161386 | Ga0373927_0161386_768_1145 | 116 |
| 304 | 3300035724 | Ga0373933_0080339 | Ga0373933_0080339_1385_1738 | 116 |
| 305 | 3300035724 | Ga0373933_0145439 | Ga0373933_0145439_698_1090 | 116 |
| 306 | 3300035724 | Ga0373933_0175374 | Ga0373933_0175374_299_652 | 116 |
| 307 | 3300036401 | Ga0373937_0003113 | Ga0373937_0003113_119_472 | 116 |
| 308 | 3300036401 | Ga0373937_0016478 | Ga0373937_0016478_2976_3329 | 116 |
| 309 | 3300036401 | Ga0373937_0321729 | Ga0373937_0321729_269_622 | 116 |
| 310 | 3300037068 | Ga0373925_0340469 | Ga0373925_0340469_648_1025 | 116 |
| 311 | 3300039438 | Ga0436360_0212210 | Ga0436360_0212210_18_410 | 116 |
| 312 | 3300041406 | Ga0439439_0089909 | Ga0439439_0089909_443_793 | 116 |
| 313 | 3300041411 | Ga0439466_0106342 | Ga0439466_0106342_502_855 | 116 |
| 314 | 3300041501 | Ga0451845_0241010 | Ga0451845_0241010_214_567 | 116 |
| 315 | 3300041999 | Ga0439433_0009905 | Ga0439433_0009905_1627_1980 | 116 |
| 316 | 3300042001 | Ga0439441_000269 | Ga0439441_000269_4701_5075 | 116 |
| 317 | 3300042001 | Ga0439441_103888 | Ga0439441_103888_155_508 | 116 |
| 318 | 3300042003 | Ga0439443_033187 | Ga0439443_033187_133_513 | 116 |
| 319 | 3300042156 | Ga0439446_0025965 | Ga0439446_0025965_79_432 | 116 |
| 320 | 3300042156 | Ga0439446_0118209 | Ga0439446_0118209_277_627 | 116 |
| 321 | 3300042156 | Ga0439446_0365942 | Ga0439446_0365942_31_381 | 116 |
| 322 | 3300042435 | Ga0439434_0016539 | Ga0439434_0016539_1577_1930 | 116 |
| 323 | 3300042436 | Ga0439435_0005383 | Ga0439435_0005383_232_585 | 116 |
| 324 | 3300042436 | Ga0439435_0140830 | Ga0439435_0140830_144_521 | 116 |
| 325 | 3300042876 | Ga0451577_0129911 | Ga0451577_0129911_1149_1526 | 116 |
| 326 | 3300042876 | Ga0451577_0250739 | Ga0451577_0250739_729_1082 | 116 |
| 327 | 3300044673 | Ga0453683_0520145 | Ga0453683_0520145_193_546 | 116 |
| 328 | 3300044673 | Ga0453683_0776731 | Ga0453683_0776731_109_462 | 116 |
| 329 | 3300044712 | Ga0453684_0200323 | Ga0453684_0200323_306_659 | 116 |
| 330 | 3300045051 | Ga0451576_0061023 | Ga0451576_0061023_3344_3721 | 116 |
| 331 | 3300045051 | Ga0451576_0147230 | Ga0451576_0147230_1988_2341 | 116 |
| 332 | 3300045051 | Ga0451576_0708232 | Ga0451576_0708232_580_978 | 116 |
| 333 | 3300045051 | Ga0451576_0811624 | Ga0451576_0811624_64_417 | 116 |
| 334 | 3300046454 | Ga0495592_0001459 | Ga0495592_0001459_8101_8454 | 116 |
| 335 | 3300046459 | Ga0495629_0213398 | Ga0495629_0213398_254_607 | 116 |
| 336 | 3300046461 | Ga0495641_0177712 | Ga0495641_0177712_306_659 | 116 |
| 337 | 3300046462 | Ga0495651_0168529 | Ga0495651_0168529_174_527 | 116 |
| 338 | 3300046463 | Ga0495653_0894807 | Ga0495653_0894807_29_382 | 116 |
| 339 | 3300046476 | Ga0495662_0081887 | Ga0495662_0081887_1001_1354 | 116 |
| 340 | 3300046477 | Ga0495664_0420339 | Ga0495664_0420339_439_792 | 116 |
| 341 | 3300046499 | Ga0495594_0748127 | Ga0495594_0748127_173_532 | 116 |
| 342 | 3300046511 | Ga0495608_0014358 | Ga0495608_0014358_4093_4446 | 116 |
| 343 | 3300046514 | Ga0495618_0369164 | Ga0495618_0369164_263_616 | 116 |
| 344 | 3300046516 | Ga0495628_0007233 | Ga0495628_0007233_9018_9371 | 116 |
| 345 | 3300046516 | Ga0495628_0195791 | Ga0495628_0195791_801_1193 | 116 |
| 346 | 3300046517 | Ga0495630_0106327 | Ga0495630_0106327_1592_1945 | 116 |
| 347 | 3300046517 | Ga0495630_0283251 | Ga0495630_0283251_685_1038 | 116 |
| 348 | 3300046517 | Ga0495630_0589669 | Ga0495630_0589669_230_583 | 116 |
| 349 | 3300046519 | Ga0495632_0458747 | Ga0495632_0458747_48_446 | 116 |
| 350 | 3300046525 | Ga0495663_0104184 | Ga0495663_0104184_318_668 | 116 |
| 351 | 3300046526 | Ga0495666_0064350 | Ga0495666_0064350_61_414 | 116 |
| 352 | 3300046529 | Ga0495652_0078729 | Ga0495652_0078729_196_549 | 116 |
| 353 | 3300046533 | Ga0495640_0001548 | Ga0495640_0001548_8432_8785 | 116 |
| 354 | 3300046535 | Ga0495586_0000357 | Ga0495586_0000357_247_600 | 116 |
| 355 | 3300046536 | Ga0495587_0025483 | Ga0495587_0025483_122_475 | 116 |
| 356 | 3300046537 | Ga0495598_0101589 | Ga0495598_0101589_303_680 | 116 |
| 357 | 3300046539 | Ga0495621_0081966 | Ga0495621_0081966_788_1141 | 116 |
| 358 | 3300046539 | Ga0495621_0420243 | Ga0495621_0420243_77_427 | 116 |
| 359 | 3300046543 | Ga0495645_0460621 | Ga0495645_0460621_219_572 | 116 |
| 360 | 3300046559 | Ga0495667_0670782 | Ga0495667_0670782_44_397 | 116 |
| 361 | 3300046642 | Ga0495634_0073672 | Ga0495634_0073672_243_596 | 116 |
| 362 | 3300046642 | Ga0495634_0526811 | Ga0495634_0526811_94_447 | 116 |
| 363 | 3300046663 | Ga0495635_0449496 | Ga0495635_0449496_58_411 | 116 |
| 364 | 3300046663 | Ga0495635_1095244 | Ga0495635_1095244_95_448 | 116 |
| 365 | 3300046664 | Ga0495659_0215660 | Ga0495659_0215660_287_664 | 116 |
| 366 | 3300046675 | Ga0495657_0030714 | Ga0495657_0030714_2677_3030 | 116 |
| 367 | 3300046678 | Ga0495599_0289701 | Ga0495599_0289701_356_709 | 116 |
| 368 | 3300046680 | Ga0495646_0210927 | Ga0495646_0210927_500_853 | 116 |
| 369 | 3300046683 | Ga0495658_0465116 | Ga0495658_0465116_137_490 | 116 |
| 370 | 3300046684 | Ga0495669_0165969 | Ga0495669_0165969_307_657 | 116 |
| 371 | 3300046689 | Ga0495613_0017571 | Ga0495613_0017571_4750_5103 | 116 |
| 372 | 3300046809 | Ga0495600_0205758 | Ga0495600_0205758_879_1232 | 116 |
| 373 | 3300047315 | Ga0495581_0335891 | Ga0495581_0335891_143_496 | 116 |
| 374 | 3300047317 | Ga0495604_0038956 | Ga0495604_0038956_3234_3587 | 116 |
| 375 | 3300047317 | Ga0495604_0255365 | Ga0495604_0255365_178_531 | 116 |
| 376 | 3300047319 | Ga0495674_1138385 | Ga0495674_1138385_93_446 | 116 |
| 377 | 3300047322 | Ga0495680_0001930 | Ga0495680_0001930_10575_10928 | 116 |
| 378 | 3300047322 | Ga0495680_0380887 | Ga0495680_0380887_378_731 | 116 |
| 379 | 3300047471 | Ga0495684_0502971 | Ga0495684_0502971_127_480 | 116 |
| 380 | 3300047673 | Ga0495593_0192147 | Ga0495593_0192147_203_556 | 116 |
| 381 | 3300049514 | Ga0501291_098278 | Ga0501291_098278_232_582 | 116 |
| 382 | 3300049521 | Ga0501298_076232 | Ga0501298_076232_90_440 | 116 |
| 383 | 3300049522 | Ga0501299_005557 | Ga0501299_005557_750_1100 | 116 |
| 384 | 3300049570 | Ga0501033_0777888 | Ga0501033_0777888_198_548 | 116 |
| 385 | 3300049574 | Ga0501038_0245188 | Ga0501038_0245188_882_1232 | 116 |
| 386 | 3300049575 | Ga0501039_0030765 | Ga0501039_0030765_457_807 | 116 |
| 387 | 3300049575 | Ga0501039_1169730 | Ga0501039_1169730_86_436 | 116 |
| 388 | 3300049576 | Ga0501040_0773707 | Ga0501040_0773707_282_632 | 116 |
| 389 | 3300049577 | Ga0501041_0548576 | Ga0501041_0548576_165_515 | 116 |
| 390 | 3300049578 | Ga0501042_0955291 | Ga0501042_0955291_139_489 | 116 |
| 391 | 3300049580 | Ga0501046_0084965 | Ga0501046_0084965_225_575 | 116 |
| 392 | 3300049582 | Ga0501048_0154133 | Ga0501048_0154133_1215_1565 | 116 |
| 393 | 3300049582 | Ga0501048_0651750 | Ga0501048_0651750_349_699 | 116 |
| 394 | 3300049582 | Ga0501048_1061674 | Ga0501048_1061674_109_459 | 116 |
| 395 | 3300049584 | Ga0501068_0507591 | Ga0501068_0507591_415_765 | 116 |
| 396 | 3300049587 | Ga0501071_0188483 | Ga0501071_0188483_1052_1402 | 116 |
| 397 | 3300049588 | Ga0501072_0107939 | Ga0501072_0107939_156_506 | 116 |
| 398 | 3300049590 | Ga0501074_0224238 | Ga0501074_0224238_598_960 | 116 |
| 399 | 3300049591 | Ga0501075_0003230 | Ga0501075_0003230_3187_3537 | 116 |
| 400 | 3300049592 | Ga0501076_0007714 | Ga0501076_0007714_460_810 | 116 |
| 401 | 3300049592 | Ga0501076_0849561 | Ga0501076_0849561_128_478 | 116 |
| 402 | 3300049593 | Ga0501077_0014839 | Ga0501077_0014839_2833_3183 | 116 |
| 403 | 3300049660 | Ga0501216_135352 | Ga0501216_135352_175_525 | 116 |
| 404 | 3300049665 | Ga0501227_026990 | Ga0501227_026990_241_591 | 116 |
| 405 | 3300049679 | Ga0501249_095269 | Ga0501249_095269_98_448 | 116 |
| 406 | 3300049690 | Ga0501261_057237 | Ga0501261_057237_261_611 | 116 |
| 407 | 3300049742 | Ga0501080_0106951 | Ga0501080_0106951_1991_2341 | 116 |
| 408 | 3300049742 | Ga0501080_0913129 | Ga0501080_0913129_219_581 | 116 |
| 409 | 3300049743 | Ga0501081_0163800 | Ga0501081_0163800_928_1278 | 116 |
| 410 | 3300049743 | Ga0501081_0277480 | Ga0501081_0277480_221_571 | 116 |
| 411 | 3300049744 | Ga0501083_0192113 | Ga0501083_0192113_923_1273 | 116 |
| 412 | 3300049761 | Ga0501264_032185 | Ga0501264_032185_56_406 | 116 |
| 413 | 3300049822 | Ga0501035_0228062 | Ga0501035_0228062_294_644 | 116 |
| 414 | 3300049824 | Ga0501045_0045519 | Ga0501045_0045519_1423_1773 | 116 |
| 415 | 3300049824 | Ga0501045_0860039 | Ga0501045_0860039_205_555 | 116 |
| 416 | 3300049824 | Ga0501045_1057677 | Ga0501045_1057677_112_462 | 116 |
| 417 | 3300050489 | nmdc:mga03683_126992_c1 | nmdc:mga03683_126992_c1_556_912 | 116 |
| 418 | 3300050507 | nmdc:mga05p37_1520294_c1 | nmdc:mga05p37_1520294_c1_161_517 | 116 |
| 419 | 3300050507 | nmdc:mga05p37_2016436_c1 | nmdc:mga05p37_2016436_c1_185_535 | 116 |
| 420 | 3300050507 | nmdc:mga05p37_280386_c1 | nmdc:mga05p37_280386_c1_79_432 | 116 |
| 421 | 3300050508 | nmdc:mga09592_1228898_c1 | nmdc:mga09592_1228898_c1_243_596 | 116 |
| 422 | 3300050508 | nmdc:mga09592_1320053_c1 | nmdc:mga09592_1320053_c1_101_454 | 116 |
| 423 | 3300050508 | nmdc:mga09592_819059_c1 | nmdc:mga09592_819059_c1_85_438 | 116 |
| 424 | 3300050508 | nmdc:mga09592_868937_c1 | nmdc:mga09592_868937_c1_352_702 | 116 |
| 425 | 3300050509 | nmdc:mga0qj67_204684_c1 | nmdc:mga0qj67_204684_c1_68_421 | 116 |
| 426 | 3300050509 | nmdc:mga0qj67_818481_c1 | nmdc:mga0qj67_818481_c1_151_501 | 116 |
| 427 | 3300050509 | nmdc:mga0qj67_97052_c1 | nmdc:mga0qj67_97052_c1_1803_2153 | 116 |
| 428 | 3300050510 | nmdc:mga06r32_1018954_c1 | nmdc:mga06r32_1018954_c1_319_669 | 116 |
| 429 | 3300050510 | nmdc:mga06r32_120453_c1 | nmdc:mga06r32_120453_c1_2135_2485 | 116 |
| 430 | 3300050510 | nmdc:mga06r32_153333_c1 | nmdc:mga06r32_153333_c1_1692_2045 | 116 |
| 431 | 3300050510 | nmdc:mga06r32_308993_c1 | nmdc:mga06r32_308993_c1_412_762 | 116 |
| 432 | 3300050511 | nmdc:mga08y16_144611_c1 | nmdc:mga08y16_144611_c1_957_1307 | 116 |
| 433 | 3300050511 | nmdc:mga08y16_1542684_c1 | nmdc:mga08y16_1542684_c1_39_389 | 116 |
| 434 | 3300050511 | nmdc:mga08y16_175248_c1 | nmdc:mga08y16_175248_c1_1344_1697 | 116 |
| 435 | 3300050511 | nmdc:mga08y16_210128_c1 | nmdc:mga08y16_210128_c1_917_1267 | 116 |
| 436 | 3300050511 | nmdc:mga08y16_2178356_c1 | nmdc:mga08y16_2178356_c1_80_454 | 116 |
| 437 | 3300050511 | nmdc:mga08y16_56120_c1 | nmdc:mga08y16_56120_c1_2118_2495 | 116 |
| 438 | 3300050512 | nmdc:mga0n895_141626_c1 | nmdc:mga0n895_141626_c1_1942_2295 | 116 |
| 439 | 3300050512 | nmdc:mga0n895_4257_c1 | nmdc:mga0n895_4257_c1_231_608 | 116 |
| 440 | 3300050512 | nmdc:mga0n895_84_c1 | nmdc:mga0n895_84_c1_53730_54083 | 116 |
| 441 | 3300050513 | nmdc:mga0rr50_1118570_c1 | nmdc:mga0rr50_1118570_c1_165_524 | 116 |
| 442 | 3300050513 | nmdc:mga0rr50_1637_c1 | nmdc:mga0rr50_1637_c1_239_616 | 116 |
| 443 | 3300050513 | nmdc:mga0rr50_221923_c1 | nmdc:mga0rr50_221923_c1_989_1345 | 116 |
| 444 | 3300050513 | nmdc:mga0rr50_61571_c1 | nmdc:mga0rr50_61571_c1_2213_2566 | 116 |
| 445 | 3300050513 | nmdc:mga0rr50_63068_c1 | nmdc:mga0rr50_63068_c1_958_1314 | 116 |
| 446 | 3300050513 | nmdc:mga0rr50_729090_c1 | nmdc:mga0rr50_729090_c1_459_812 | 116 |
| 447 | 3300050514 | nmdc:mga08x19_19968_c1 | nmdc:mga08x19_19968_c1_3316_3693 | 116 |
| 448 | 3300050514 | nmdc:mga08x19_31088_c1 | nmdc:mga08x19_31088_c1_126_482 | 116 |
| 449 | 3300050514 | nmdc:mga08x19_640_c1 | nmdc:mga08x19_640_c1_9374_9730 | 116 |
| 450 | 3300050514 | nmdc:mga08x19_849093_c1 | nmdc:mga08x19_849093_c1_99_455 | 116 |
| 451 | 3300050514 | nmdc:mga08x19_96464_c1 | nmdc:mga08x19_96464_c1_1150_1506 | 116 |
| 452 | 3300050515 | nmdc:mga0a205_1228040_c1 | nmdc:mga0a205_1228040_c1_206_559 | 116 |
| 453 | 3300050515 | nmdc:mga0a205_570406_c1 | nmdc:mga0a205_570406_c1_364_717 | 116 |
| 454 | 3300050515 | nmdc:mga0a205_828995_c1 | nmdc:mga0a205_828995_c1_303_659 | 116 |
| 455 | 3300050515 | nmdc:mga0a205_8513_c1 | nmdc:mga0a205_8513_c1_239_616 | 116 |
| 456 | 3300053077 | Ga0495601_0038212 | Ga0495601_0038212_1828_2181 | 116 |
| 457 | 3300053084 | Ga0495595_0135716 | Ga0495595_0135716_91_444 | 116 |
| 458 | 3300054114 | Ga0501084_0123948 | Ga0501084_0123948_409_759 | 116 |
| 459 | 3300059421 | Ga0590071_061863 | Ga0590071_061863_533_886 | 116 |
| 460 | 3300061734 | Ga0530510_0006411 | Ga0530510_0006411_219_569 | 116 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar