F448513

General Info

Members Datasets Scaffolds Average Seq Length
460 230 920 136

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10248125|Ga0081538_102481251
Length 157
Sequence MDGAAVIRTRAWMPAELFSSPVFGRIDHIGVAVEDLDGAIALYEQRLGMPVQHRETVEEQGVEAVLLGVGESHVELLRPLGPDTAVGKFLARSGPGLHHVAYGTDDIQSAIDAARDAGLRLIDEEPRTGIRGSRVAFLHPKSTGGVLTELVEAPEGH

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
140 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
141 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
153 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
154 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
170 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.04
Metatranscriptomes 1.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0
Rhizoplane 9.13
Rhizosphere 88.48
Stem 0
Stem Tuber 0
Unclassified 4.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10248125 3300005981 Bacteria 681
2 CNBas_1003703 3300000531 Bacteria 857
3 JGI25407J50210_10000397 3300003373 Bacteria 8382
4 JGI25407J50210_10037571 3300003373 Archaea 1244
5 Ga0070658_10703456 3300005327 Bacteria 877
6 Ga0070676_10073244 3300005328 Bacteria 2061
7 Ga0070683_100020617 3300005329 Bacteria 5867
8 Ga0070683_100087310 3300005329 Bacteria 2925
9 Ga0070683_100287314 3300005329 Bacteria 1564
10 Ga0070683_100804817 3300005329 Bacteria 901
11 Ga0070683_101122981 3300005329 Bacteria 755
12 Ga0070670_100449258 3300005331 Unclassified 1142
13 Ga0070680_100001121 3300005336 Bacteria 19256
14 Ga0070680_100338727 3300005336 Unclassified 1278
15 Ga0070680_100403347 3300005336 Bacteria 1165
16 Ga0070682_100234995 3300005337 Bacteria 1313
17 Ga0070682_100660183 3300005337 Bacteria 833
18 Ga0068868_101456943 3300005338 Bacteria 640
19 Ga0070660_100162738 3300005339 Bacteria 1799
20 Ga0070660_100364662 3300005339 Bacteria 1191
21 Ga0070660_100884450 3300005339 Bacteria 753
22 Ga0070689_100243560 3300005340 Bacteria 1482
23 Ga0070691_10049643 3300005341 Bacteria 2000
24 Ga0070661_100334572 3300005344 Bacteria 1185
25 Ga0070692_10070091 3300005345 Bacteria 1866
26 Ga0070692_10143470 3300005345 Bacteria 1354
27 Ga0070668_100060014 3300005347 Bacteria 2944
28 Ga0070668_100315060 3300005347 Bacteria 1316
29 Ga0070668_100365624 3300005347 Bacteria 1224
30 Ga0070669_100591651 3300005353 Bacteria 929
31 Ga0070669_101363728 3300005353 Bacteria 615
32 Ga0070675_100749870 3300005354 Bacteria 891
33 Ga0070674_100008150 3300005356 Bacteria 6217
34 Ga0070674_100474439 3300005356 Archaea 1037
35 Ga0070659_100075853 3300005366 Bacteria 2680
36 Ga0070659_100314110 3300005366 Bacteria 1309
37 Ga0070659_100430321 3300005366 Bacteria 1117
38 Ga0070659_100468100 3300005366 Bacteria 1071
39 Ga0070659_101204142 3300005366 Bacteria 670
40 Ga0070709_11189702 3300005434 Bacteria 612
41 Ga0070714_100282197 3300005435 Unclassified 1543
42 Ga0070713_100056715 3300005436 Bacteria 3258
43 Ga0070710_10292470 3300005437 Bacteria 1061
44 Ga0070710_10402369 3300005437 Bacteria 918
45 Ga0070710_10971061 3300005437 Unclassified 617
46 Ga0070700_100187573 3300005441 Bacteria 1443
47 Ga0070694_101367923 3300005444 Bacteria 597
48 Ga0070708_100668561 3300005445 Bacteria 978
49 Ga0070663_100279240 3300005455 Bacteria 1330
50 Ga0070663_100442513 3300005455 Bacteria 1070
51 Ga0070678_101181934 3300005456 Bacteria 709
52 Ga0070662_100127289 3300005457 Bacteria 1959
53 Ga0070681_10027234 3300005458 Bacteria 5748
54 Ga0070681_10052105 3300005458 Bacteria 4081
55 Ga0070681_10716011 3300005458 Unclassified 917
56 Ga0068867_100577402 3300005459 Bacteria 977
57 Ga0070679_100249778 3300005530 Bacteria 1730
58 Ga0070679_100288576 3300005530 Bacteria 1592
59 Ga0070684_100010901 3300005535 Bacteria 7223
60 Ga0070684_100059206 3300005535 Bacteria 3348
61 Ga0070684_100380831 3300005535 Bacteria 1299
62 Ga0070684_100626670 3300005535 Bacteria 1001
63 Ga0070684_100971855 3300005535 Bacteria 797
64 Ga0070684_101487874 3300005535 Bacteria 638
65 Ga0068853_100016003 3300005539 Bacteria 6168
66 Ga0070695_100336239 3300005545 Bacteria 1127
67 Ga0070696_100071557 3300005546 Bacteria 2441
68 Ga0070696_101297161 3300005546 Bacteria 618
69 Ga0070693_100138965 3300005547 Unclassified 1527
70 Ga0070693_100591402 3300005547 Bacteria 800
71 Ga0070665_100003484 3300005548 Bacteria 16763
72 Ga0070704_101489801 3300005549 Bacteria 622
73 Ga0068857_100383123 3300005577 Bacteria 1306
74 Ga0068854_100230092 3300005578 Bacteria 1471
75 Ga0068856_100040709 3300005614 Bacteria 4565
76 Ga0068856_100582155 3300005614 Bacteria 1140
77 Ga0068856_100605233 3300005614 Bacteria 1117
78 Ga0068852_100112230 3300005616 Bacteria 2480
79 Ga0068859_101529764 3300005617 Bacteria 737
80 Ga0068864_100269108 3300005618 Bacteria 1587
81 Ga0068864_101105464 3300005618 Bacteria 789
82 Ga0068863_101971701 3300005841 Bacteria 594
83 Ga0081455_10004545 3300005937 Bacteria 15491
84 Ga0081455_10030078 3300005937 Bacteria 4940
85 Ga0081538_10000021 3300005981 Bacteria 138488
86 Ga0081538_10000114 3300005981 Bacteria 81354
87 Ga0081538_10000357 3300005981 Bacteria 51919
88 Ga0081538_10005670 3300005981 Bacteria 11177
89 Ga0081538_10007107 3300005981 Bacteria 9729
90 Ga0081538_10052215 3300005981 Bacteria 2445
91 Ga0081538_10080812 3300005981 Bacteria 1732
92 Ga0081538_10159292 3300005981 Unclassified 1006
93 Ga0081540_1000427 3300005983 Bacteria 41566
94 Ga0081539_10049498 3300005985 Bacteria 2384
95 Ga0081539_10363976 3300005985 Bacteria 606
96 Ga0070717_10026677 3300006028 Bacteria 4611
97 Ga0070717_10051558 3300006028 Bacteria 3387
98 Ga0070717_10944933 3300006028 Bacteria 785
99 Ga0075365_10309978 3300006038 Bacteria 1111
100 Ga0075365_10424053 3300006038 Bacteria 939
101 Ga0075363_100001750 3300006048 Bacteria 8463
102 Ga0075363_100047364 3300006048 Bacteria 2283
103 Ga0075364_10656331 3300006051 Bacteria 716
104 Ga0070716_100709111 3300006173 Bacteria 770
105 Ga0070712_100280037 3300006175 Bacteria 1343
106 Ga0075428_100061662 3300006844 Bacteria 4106
107 Ga0075428_100230551 3300006844 Bacteria 1998
108 Ga0075428_100318762 3300006844 Bacteria 1671
109 Ga0075428_100971360 3300006844 Bacteria 900
110 Ga0075430_100001252 3300006846 Bacteria 20440
111 Ga0075430_100279392 3300006846 Bacteria 1382
112 Ga0075430_100432352 3300006846 Bacteria 1086
113 Ga0075430_100483637 3300006846 Bacteria 1021
114 Ga0075431_100016621 3300006847 Bacteria 7469
115 Ga0075431_100041387 3300006847 Bacteria 4750
116 Ga0075431_100391855 3300006847 Bacteria 1391
117 Ga0075431_101597046 3300006847 Bacteria 610
118 Ga0075433_10007962 3300006852 Bacteria 8437
119 Ga0075429_100044214 3300006880 Bacteria 3875
120 Ga0075429_100188385 3300006880 Bacteria 1808
121 Ga0075429_100602306 3300006880 Bacteria 963
122 Ga0097620_101529575 3300006931 Bacteria 737
123 Ga0105240_10138358 3300009093 Bacteria 2914
124 Ga0111539_10018452 3300009094 Bacteria 8643
125 Ga0111539_10242239 3300009094 Bacteria 2099
126 Ga0111539_10547328 3300009094 Bacteria 1348
127 Ga0105245_10003185 3300009098 Bacteria 14671
128 Ga0105245_10513276 3300009098 Bacteria 1216
129 Ga0114129_10351666 3300009147 Bacteria 1952
130 Ga0114129_10433134 3300009147 Bacteria 1727
131 Ga0114129_10541474 3300009147 Bacteria 1515
132 Ga0114129_10577222 3300009147 Bacteria 1459
133 Ga0114129_10828605 3300009147 Unclassified 1178
134 Ga0114129_10927770 3300009147 Bacteria 1101
135 Ga0114129_12786165 3300009147 Bacteria 581
136 Ga0105243_10004998 3300009148 Bacteria 10392
137 Ga0105243_10173137 3300009148 Bacteria 1871
138 Ga0105243_11003842 3300009148 Bacteria 837
139 Ga0105241_11665896 3300009174 Bacteria 619
140 Ga0105242_10273351 3300009176 Bacteria 1531
141 Ga0105237_10073214 3300009545 Bacteria 3419
142 Ga0105238_10031073 3300009551 Bacteria 5437
143 Ga0105238_12257401 3300009551 Bacteria 579
144 Ga0105249_10063143 3300009553 Bacteria 3402
145 Ga0105239_10037471 3300010375 Bacteria 5315
146 Ga0105239_10322317 3300010375 Bacteria 1742
147 Ga0105239_11371088 3300010375 Bacteria 816
148 Ga0105246_10936479 3300011119 Bacteria 780
149 Ga0157371_10411480 3300013102 Bacteria 990
150 Ga0157370_10060307 3300013104 Bacteria 3602
151 Ga0157369_10089191 3300013105 Bacteria 3293
152 Ga0157369_10236559 3300013105 Bacteria 1908
153 Ga0157369_10896685 3300013105 Bacteria 909
154 Ga0157369_11427777 3300013105 Bacteria 704
155 Ga0157374_11689534 3300013296 Bacteria 658
156 Ga0163162_10025861 3300013306 Bacteria 5802
157 Ga0157372_10349425 3300013307 Bacteria 1723
158 Ga0157372_10936660 3300013307 Bacteria 1004
159 Ga0157372_11175644 3300013307 Bacteria 887
160 Ga0157372_11852023 3300013307 Unclassified 694
161 Ga0163163_10324014 3300014325 Bacteria 1594
162 Ga0163163_10395961 3300014325 Bacteria 1439
163 Ga0163163_12862931 3300014325 Bacteria 538
164 Ga0157380_10423624 3300014326 Bacteria 1270
165 Ga0157380_10870055 3300014326 Bacteria 925
166 Ga0157377_10609895 3300014745 Unclassified 780
167 Ga0157377_10811396 3300014745 Bacteria 691
168 Ga0157377_11173412 3300014745 Bacteria 593
169 Ga0197907_10349165 3300020069 Unclassified 776
170 Ga0197907_10635502 3300020069 Bacteria 838
171 Ga0206356_11844326 3300020070 Bacteria 3208
172 Ga0206354_10127329 3300020081 Unclassified 868
173 Ga0206354_11197991 3300020081 Bacteria 2668
174 Ga0206353_10306737 3300020082 Bacteria 733
175 Ga0206353_10647695 3300020082 Unclassified 1236
176 Ga0206353_11246324 3300020082 Bacteria 2313
177 Ga0224712_10163623 3300022467 Bacteria 994
178 Ga0207642_10038651 3300025899 Bacteria 2067
179 Ga0207645_10095485 3300025907 Bacteria 1914
180 Ga0207705_10881258 3300025909 Bacteria 694
181 Ga0207707_10021203 3300025912 Bacteria 5680
182 Ga0207707_10198370 3300025912 Bacteria 1750
183 Ga0207695_10230028 3300025913 Bacteria 1759
184 Ga0207671_10118847 3300025914 Bacteria 2019
185 Ga0207660_10006517 3300025917 Bacteria 7573
186 Ga0207660_10470455 3300025917 Unclassified 1018
187 Ga0207660_10650918 3300025917 Bacteria 859
188 Ga0207660_11066559 3300025917 Bacteria 659
189 Ga0207657_10008716 3300025919 Bacteria 10266
190 Ga0207657_10370114 3300025919 Bacteria 1129
191 Ga0207652_10106460 3300025921 Bacteria 2482
192 Ga0207652_10265906 3300025921 Bacteria 1547
193 Ga0207652_10884037 3300025921 Bacteria 790
194 Ga0207652_10956627 3300025921 Bacteria 754
195 Ga0207681_10572371 3300025923 Bacteria 931
196 Ga0207694_10062806 3300025924 Bacteria 2892
197 Ga0207650_10904164 3300025925 Bacteria 750
198 Ga0207687_10044656 3300025927 Bacteria 3059
199 Ga0207687_10657378 3300025927 Bacteria 887
200 Ga0207700_10048180 3300025928 Bacteria 3163
201 Ga0207664_10072670 3300025929 Bacteria 2773
202 Ga0207664_10652098 3300025929 Unclassified 946
203 Ga0207690_10093943 3300025932 Bacteria 2126
204 Ga0207690_10336955 3300025932 Bacteria 1189
205 Ga0207690_10355193 3300025932 Bacteria 1160
206 Ga0207706_10001808 3300025933 Bacteria 20997
207 Ga0207706_10672045 3300025933 Bacteria 886
208 Ga0207686_10075129 3300025934 Bacteria 2186
209 Ga0207709_10390025 3300025935 Bacteria 1062
210 Ga0207669_10015801 3300025937 Bacteria 3817
211 Ga0207665_10253850 3300025939 Bacteria 1300
212 Ga0207665_10445978 3300025939 Bacteria 992
213 Ga0207691_10359553 3300025940 Bacteria 1245
214 Ga0207691_10696264 3300025940 Bacteria 857
215 Ga0207661_10033047 3300025944 Bacteria 4012
216 Ga0207661_10205662 3300025944 Bacteria 1733
217 Ga0207661_10877051 3300025944 Bacteria 826
218 Ga0207712_10028967 3300025961 Bacteria 3710
219 Ga0207668_10106727 3300025972 Bacteria 2093
220 Ga0207668_10119868 3300025972 Bacteria 1990
221 Ga0207668_10148611 3300025972 Bacteria 1811
222 Ga0207668_10353596 3300025972 Bacteria 1229
223 Ga0207640_10108963 3300025981 Bacteria 1959
224 Ga0207639_10056347 3300026041 Bacteria 3012
225 Ga0207639_11285432 3300026041 Bacteria 687
226 Ga0207678_11029835 3300026067 Bacteria 729
227 Ga0207708_10089075 3300026075 Bacteria 2378
228 Ga0207702_10044047 3300026078 Bacteria 3750
229 Ga0207702_10212465 3300026078 Bacteria 1799
230 Ga0207702_10240623 3300026078 Bacteria 1695
231 Ga0207648_10524584 3300026089 Bacteria 1086
232 Ga0207648_11032192 3300026089 Archaea 770
233 Ga0207676_10857809 3300026095 Bacteria 889
234 Ga0207674_10252559 3300026116 Bacteria 1710
235 Ga0207674_10382018 3300026116 Bacteria 1362
236 Ga0207675_100000210 3300026118 Bacteria 54505
237 Ga0207675_100373858 3300026118 Bacteria 1400
238 Ga0207683_11043638 3300026121 Bacteria 759
239 Ga0207698_10106296 3300026142 Bacteria 2340
240 Ga0207698_10424325 3300026142 Bacteria 1277
241 Ga0209974_10032977 3300027876 Bacteria 1717
242 Ga0207428_10019830 3300027907 Bacteria 5728
243 Ga0268266_10012688 3300028379 Bacteria 7281
244 Ga0307408_100031718 3300031548 Bacteria 3681
245 Ga0307405_10018772 3300031731 Bacteria 3823
246 Ga0307405_10335926 3300031731 Bacteria 1160
247 Ga0307413_10132717 3300031824 Bacteria 1707
248 Ga0307410_10658876 3300031852 Bacteria 879
249 Ga0307410_10822111 3300031852 Bacteria 791
250 Ga0307410_11317792 3300031852 Bacteria 632
251 Ga0307406_10084808 3300031901 Bacteria 2116
252 Ga0307406_10089241 3300031901 Bacteria 2071
253 Ga0307406_10131302 3300031901 Bacteria 1759
254 Ga0307406_10213770 3300031901 Unclassified 1428
255 Ga0307406_10809545 3300031901 Bacteria 791
256 Ga0307407_10004113 3300031903 Bacteria 6122
257 Ga0307407_10200693 3300031903 Bacteria 1336
258 Ga0307412_10075908 3300031911 Bacteria 2307
259 Ga0307409_100053913 3300031995 Bacteria 3093
260 Ga0307409_100106628 3300031995 Bacteria 2339
261 Ga0307409_100196683 3300031995 Bacteria 1800
262 Ga0307409_100365624 3300031995 Bacteria 1366
263 Ga0307409_101800623 3300031995 Bacteria 641
264 Ga0307416_100022437 3300032002 Bacteria 4557
265 Ga0307416_100049171 3300032002 Bacteria 3351
266 Ga0307416_100065783 3300032002 Bacteria 2981
267 Ga0307416_100093014 3300032002 Bacteria 2596
268 Ga0307416_100321210 3300032002 Bacteria 1550
269 Ga0307416_101251989 3300032002 Bacteria 848
270 Ga0307414_10213790 3300032004 Bacteria 1578
271 Ga0307414_10810755 3300032004 Bacteria 854
272 Ga0307415_100068254 3300032126 Bacteria 2488
273 Ga0307415_100170628 3300032126 Bacteria 1696
274 Ga0307415_100625153 3300032126 Bacteria 962
275 Ga0307415_100667108 3300032126 Unclassified 934
276 Ga0373948_0175714 3300034817 Bacteria 547
277 Ga0373949_0018199 3300035090 Bacteria 1591
278 Ga0373952_0136624 3300035092 Bacteria 678
279 Ga0373960_0206604 3300035121 Bacteria 697
280 Ga0373961_0026956 3300035241 Bacteria 1574
281 Ga0395899_0297503 3300037312 Bacteria 1093
282 Ga0395900_0026491 3300037418 Bacteria 5936
283 Ga0395898_0003638 3300037466 Bacteria 17131
284 Ga0395898_0065457 3300037466 Bacteria 3524
285 Ga0395898_1127699 3300037466 Bacteria 717
286 Ga0395905_0008956 3300037471 Bacteria 9823
287 Ga0395901_0008668 3300038443 Bacteria 10275
288 Ga0395901_0044330 3300038443 Bacteria 4613
289 Ga0395901_0048378 3300038443 Bacteria 4416
290 Ga0395901_0478292 3300038443 Bacteria 1271
291 Ga0395901_1794318 3300038443 Bacteria 563
292 Ga0436365_0249881 3300039437 Bacteria 22069
293 Ga0436363_0661859 3300039450 Bacteria 1447
294 Ga0436362_0396615 3300039453 Bacteria 2624
295 Ga0436362_0889345 3300039453 Bacteria 1869
296 Ga0439458_0116189 3300042157 Bacteria 702
297 Ga0439444_0021237 3300042437 Unclassified 1148
298 Ga0439440_0024645 3300042993 Bacteria 1381
299 Ga0466969_0056449 3300044656 Bacteria 1917
300 Ga0466966_0467849 3300044684 Bacteria 758
301 Ga0466963_0028080 3300044694 Bacteria 3609
302 Ga0466963_0283923 3300044694 Bacteria 1164
303 Ga0466963_0381338 3300044694 Bacteria 994
304 Ga0466963_1059835 3300044694 Bacteria 570
305 Ga0466963_1126772 3300044694 Bacteria 552
306 Ga0466964_0237996 3300044706 Bacteria 892
307 Ga0466964_0424659 3300044706 Bacteria 700
308 Ga0466968_0019172 3300044735 Bacteria 2752
309 Ga0466970_0060337 3300044765 Bacteria 2031
310 Ga0466957_0294569 3300044842 Bacteria 1089
311 Ga0466960_0277139 3300044901 Bacteria 939
312 Ga0466960_0496710 3300044901 Bacteria 714
313 Ga0466960_0920920 3300044901 Bacteria 534
314 Ga0466959_0015825 3300045049 Bacteria 5503
315 Ga0466959_0022065 3300045049 Bacteria 4702
316 Ga0466959_0122597 3300045049 Bacteria 1846
317 Ga0466958_0094931 3300045836 Bacteria 1848
318 Ga0466958_0218764 3300045836 Bacteria 1215
319 Ga0466967_0038536 3300045976 Bacteria 4100
320 Ga0466967_0067506 3300045976 Bacteria 3190
321 Ga0466967_0155107 3300045976 Bacteria 2144
322 Ga0466967_0206478 3300045976 Bacteria 1862
323 Ga0466967_0242842 3300045976 Bacteria 1718
324 Ga0466967_0312636 3300045976 Bacteria 1514
325 Ga0466967_0368190 3300045976 Bacteria 1393
326 Ga0466967_1341897 3300045976 Bacteria 712
327 Ga0495592_0118314 3300046454 Bacteria 1867
328 Ga0495590_0085575 3300046457 Bacteria 1113
329 Ga0495590_0372938 3300046457 Bacteria 545
330 Ga0495664_0234301 3300046477 Bacteria 1111
331 Ga0495584_0467633 3300046491 Bacteria 642
332 Ga0495596_0058721 3300046500 Bacteria 1500
333 Ga0495596_0077910 3300046500 Bacteria 1287
334 Ga0495596_0422186 3300046500 Bacteria 520
335 Ga0495608_0000163 3300046511 Bacteria 47170
336 Ga0495637_0284079 3300046520 Bacteria 590
337 Ga0495644_0243311 3300046523 Bacteria 698
338 Ga0495663_0130544 3300046525 Bacteria 847
339 Ga0495663_0250118 3300046525 Bacteria 629
340 Ga0495652_0208131 3300046529 Bacteria 1479
341 Ga0495609_0448702 3300046538 Unclassified 513
342 Ga0495668_0107861 3300046616 Bacteria 1523
343 Ga0495668_0218422 3300046616 Bacteria 1044
344 Ga0495668_0601027 3300046616 Bacteria 608
345 Ga0495661_0439059 3300046665 Bacteria 630
346 Ga0495669_0452851 3300046684 Bacteria 623
347 Ga0495589_0216551 3300046794 Bacteria 901
348 Ga0495672_0004560 3300047320 Bacteria 11265
349 Ga0495672_0322706 3300047320 Bacteria 725
350 Ga0495626_0405476 3300048091 Bacteria 527
351 Ga0496100_0138915 3300048903 Bacteria 1720
352 Ga0496100_0920212 3300048903 Bacteria 687
353 Ga0496101_0634031 3300048904 Bacteria 845
354 Ga0496102_0024261 3300048905 Bacteria 5391
355 Ga0496102_0217032 3300048905 Bacteria 1803
356 Ga0496102_0344198 3300048905 Bacteria 1404
357 Ga0496103_0535499 3300048906 Bacteria 748
358 Ga0496104_0009434 3300048907 Bacteria 8679
359 Ga0496104_0072381 3300048907 Bacteria 3278
360 Ga0496105_0022314 3300048908 Bacteria 5127
361 Ga0496105_0023487 3300048908 Bacteria 5002
362 Ga0496106_0020764 3300048909 Bacteria 4874
363 Ga0496107_0066759 3300048910 Bacteria 2608
364 Ga0496108_0001096 3300048911 Bacteria 21133
365 Ga0496108_0009702 3300048911 Bacteria 7801
366 Ga0496108_0307260 3300048911 Bacteria 1382
367 Ga0496109_0000548 3300048912 Bacteria 31758
368 Ga0496109_0003954 3300048912 Bacteria 12371
369 Ga0496109_0205046 3300048912 Bacteria 1854
370 Ga0496109_0286217 3300048912 Bacteria 1553
371 Ga0496110_0005407 3300048913 Bacteria 10017
372 Ga0496110_0181953 3300048913 Bacteria 1908
373 Ga0496110_0619084 3300048913 Bacteria 981
374 Ga0496110_1180373 3300048913 Unclassified 674
375 Ga0496110_1452415 3300048913 Unclassified 595
376 Ga0496111_0086468 3300048914 Bacteria 2294
377 Ga0496111_0111976 3300048914 Bacteria 2010
378 Ga0496111_0356005 3300048914 Unclassified 1083
379 Ga0496111_0357816 3300048914 Bacteria 1080
380 Ga0496111_0436110 3300048914 Bacteria 967
381 Ga0496112_0016292 3300048915 Bacteria 6959
382 Ga0496112_0081129 3300048915 Bacteria 3208
383 Ga0496112_0163901 3300048915 Bacteria 2189
384 Ga0496112_0237678 3300048915 Bacteria 1775
385 Ga0496112_0356594 3300048915 Bacteria 1405
386 Ga0496112_0429113 3300048915 Bacteria 1260
387 Ga0496112_0621863 3300048915 Bacteria 1011
388 Ga0496112_1273038 3300048915 Bacteria 651
389 Ga0496113_0011920 3300048916 Bacteria 5828
390 Ga0496113_0126634 3300048916 Bacteria 2001
391 Ga0496113_0155060 3300048916 Bacteria 1808
392 Ga0496113_0361995 3300048916 Bacteria 1164
393 Ga0496124_0115076 3300048927 Bacteria 2159
394 Ga0501031_0233952 3300049568 Bacteria 1195
395 Ga0501037_0384683 3300049573 Bacteria 964
396 Ga0501037_0502985 3300049573 Archaea 822
397 Ga0501038_0245820 3300049574 Bacteria 1419
398 Ga0501039_0564947 3300049575 Bacteria 892
399 Ga0501040_0059592 3300049576 Archaea 2623
400 Ga0501040_0944148 3300049576 Archaea 625
401 Ga0501041_0047849 3300049577 Bacteria 2604
402 Ga0501041_0112415 3300049577 Bacteria 1690
403 Ga0501041_0183624 3300049577 Bacteria 1310
404 Ga0501042_0109418 3300049578 Bacteria 1990
405 Ga0501048_0196415 3300049582 Bacteria 1430
406 Ga0501048_0426858 3300049582 Archaea 948
407 Ga0501067_0231373 3300049583 Bacteria 1029
408 Ga0501067_0325743 3300049583 Archaea 856
409 Ga0501069_0968668 3300049585 Bacteria 519
410 Ga0501072_0007876 3300049588 Bacteria 8092
411 Ga0501072_0591668 3300049588 Bacteria 875
412 Ga0501072_0619882 3300049588 Bacteria 852
413 Ga0501075_0038315 3300049591 Bacteria 3583
414 Ga0501075_0087812 3300049591 Archaea 2357
415 Ga0501075_0706839 3300049591 Archaea 768
416 Ga0501076_0309148 3300049592 Bacteria 1296
417 Ga0501076_0417292 3300049592 Archaea 1104
418 Ga0501076_1370990 3300049592 Bacteria 581
419 Ga0501076_1634224 3300049592 Bacteria 529
420 Ga0501077_0487117 3300049593 Bacteria 790
421 Ga0501077_1118186 3300049593 Archaea 507
422 Ga0501079_0148023 3300049741 Bacteria 1830
423 Ga0501079_0234023 3300049741 Archaea 1435
424 Ga0501079_0452164 3300049741 Archaea 1009
425 Ga0501080_0737972 3300049742 Archaea 867
426 Ga0501081_0080488 3300049743 Bacteria 2280
427 Ga0501081_0108792 3300049743 Archaea 1966
428 Ga0501083_0678999 3300049744 Archaea 670
429 Ga0501271_035503 3300049768 Bacteria 632
430 Ga0501045_0014244 3300049824 Bacteria 5636
431 Ga0501045_0020731 3300049824 Bacteria 4697
432 nmdc:mga03n38_36959_c1 3300050490 Bacteria 2103
433 nmdc:mga03n38_828702_c1 3300050490 Bacteria 540
434 nmdc:mga0yw44_54786_c1 3300050492 Bacteria 2425
435 nmdc:mga05p37_399078_c1 3300050507 Bacteria 1606
436 nmdc:mga05p37_399823_c1 3300050507 Bacteria 1604
437 nmdc:mga05p37_638623_c1 3300050507 Bacteria 1194
438 nmdc:mga09592_145380_c1 3300050508 Bacteria 2044
439 nmdc:mga09592_90208_c1 3300050508 Bacteria 2618
440 nmdc:mga0qj67_1209354_c1 3300050509 Bacteria 588
441 nmdc:mga0qj67_44194_c1 3300050509 Bacteria 3510
442 nmdc:mga06r32_125293_c1 3300050510 Bacteria 2537
443 nmdc:mga06r32_1629797_c1 3300050510 Bacteria 583
444 nmdc:mga06r32_224608_c1 3300050510 Bacteria 1866
445 nmdc:mga06r32_57192_c1 3300050510 Bacteria 3746
446 nmdc:mga06r32_866599_c1 3300050510 Archaea 861
447 nmdc:mga08y16_1119338_c1 3300050511 Bacteria 762
448 nmdc:mga08y16_21850_c1 3300050511 Bacteria 6752
449 nmdc:mga08y16_233044_c1 3300050511 Bacteria 1904
450 nmdc:mga0a205_1101509_c1 3300050515 Bacteria 641
451 Ga0495601_0119080 3300053077 Bacteria 1714
452 Ga0495601_0219863 3300053077 Bacteria 1241
453 Ga0495655_0057059 3300053083 Bacteria 1053
454 Ga0495655_0115565 3300053083 Bacteria 811
455 Ga0501084_0180901 3300054114 Bacteria 1780
456 Ga0501084_0217853 3300054114 Bacteria 1611
457 Ga0501084_0636552 3300054114 Archaea 900
458 Ga0466962_0046189 3300061719 Bacteria 2081
459 Ga0530510_0107236 3300061734 Archaea 2044
460 Ga0530510_0126432 3300061734 Bacteria 1879
461 Ga0081538_10248125
462 CNBas_1003703
463 JGI25407J50210_10000397
464 JGI25407J50210_10037571
465 Ga0070658_10703456
466 Ga0070676_10073244
467 Ga0070683_100020617
468 Ga0070683_100087310
469 Ga0070683_100287314
470 Ga0070683_100804817
471 Ga0070683_101122981
472 Ga0070670_100449258
473 Ga0070680_100001121
474 Ga0070680_100338727
475 Ga0070680_100403347
476 Ga0070682_100234995
477 Ga0070682_100660183
478 Ga0068868_101456943
479 Ga0070660_100162738
480 Ga0070660_100364662
481 Ga0070660_100884450
482 Ga0070689_100243560
483 Ga0070691_10049643
484 Ga0070661_100334572
485 Ga0070692_10070091
486 Ga0070692_10143470
487 Ga0070668_100060014
488 Ga0070668_100315060
489 Ga0070668_100365624
490 Ga0070669_100591651
491 Ga0070669_101363728
492 Ga0070675_100749870
493 Ga0070674_100008150
494 Ga0070674_100474439
495 Ga0070659_100075853
496 Ga0070659_100314110
497 Ga0070659_100430321
498 Ga0070659_100468100
499 Ga0070659_101204142
500 Ga0070709_11189702
501 Ga0070714_100282197
502 Ga0070713_100056715
503 Ga0070710_10292470
504 Ga0070710_10402369
505 Ga0070710_10971061
506 Ga0070700_100187573
507 Ga0070694_101367923
508 Ga0070708_100668561
509 Ga0070663_100279240
510 Ga0070663_100442513
511 Ga0070678_101181934
512 Ga0070662_100127289
513 Ga0070681_10027234
514 Ga0070681_10052105
515 Ga0070681_10716011
516 Ga0068867_100577402
517 Ga0070679_100249778
518 Ga0070679_100288576
519 Ga0070684_100010901
520 Ga0070684_100059206
521 Ga0070684_100380831
522 Ga0070684_100626670
523 Ga0070684_100971855
524 Ga0070684_101487874
525 Ga0068853_100016003
526 Ga0070695_100336239
527 Ga0070696_100071557
528 Ga0070696_101297161
529 Ga0070693_100138965
530 Ga0070693_100591402
531 Ga0070665_100003484
532 Ga0070704_101489801
533 Ga0068857_100383123
534 Ga0068854_100230092
535 Ga0068856_100040709
536 Ga0068856_100582155
537 Ga0068856_100605233
538 Ga0068852_100112230
539 Ga0068859_101529764
540 Ga0068864_100269108
541 Ga0068864_101105464
542 Ga0068863_101971701
543 Ga0081455_10004545
544 Ga0081455_10030078
545 Ga0081538_10000021
546 Ga0081538_10000114
547 Ga0081538_10000357
548 Ga0081538_10005670
549 Ga0081538_10007107
550 Ga0081538_10052215
551 Ga0081538_10080812
552 Ga0081538_10159292
553 Ga0081540_1000427
554 Ga0081539_10049498
555 Ga0081539_10363976
556 Ga0070717_10026677
557 Ga0070717_10051558
558 Ga0070717_10944933
559 Ga0075365_10309978
560 Ga0075365_10424053
561 Ga0075363_100001750
562 Ga0075363_100047364
563 Ga0075364_10656331
564 Ga0070716_100709111
565 Ga0070712_100280037
566 Ga0075428_100061662
567 Ga0075428_100230551
568 Ga0075428_100318762
569 Ga0075428_100971360
570 Ga0075430_100001252
571 Ga0075430_100279392
572 Ga0075430_100432352
573 Ga0075430_100483637
574 Ga0075431_100016621
575 Ga0075431_100041387
576 Ga0075431_100391855
577 Ga0075431_101597046
578 Ga0075433_10007962
579 Ga0075429_100044214
580 Ga0075429_100188385
581 Ga0075429_100602306
582 Ga0097620_101529575
583 Ga0105240_10138358
584 Ga0111539_10018452
585 Ga0111539_10242239
586 Ga0111539_10547328
587 Ga0105245_10003185
588 Ga0105245_10513276
589 Ga0114129_10351666
590 Ga0114129_10433134
591 Ga0114129_10541474
592 Ga0114129_10577222
593 Ga0114129_10828605
594 Ga0114129_10927770
595 Ga0114129_12786165
596 Ga0105243_10004998
597 Ga0105243_10173137
598 Ga0105243_11003842
599 Ga0105241_11665896
600 Ga0105242_10273351
601 Ga0105237_10073214
602 Ga0105238_10031073
603 Ga0105238_12257401
604 Ga0105249_10063143
605 Ga0105239_10037471
606 Ga0105239_10322317
607 Ga0105239_11371088
608 Ga0105246_10936479
609 Ga0157371_10411480
610 Ga0157370_10060307
611 Ga0157369_10089191
612 Ga0157369_10236559
613 Ga0157369_10896685
614 Ga0157369_11427777
615 Ga0157374_11689534
616 Ga0163162_10025861
617 Ga0157372_10349425
618 Ga0157372_10936660
619 Ga0157372_11175644
620 Ga0157372_11852023
621 Ga0163163_10324014
622 Ga0163163_10395961
623 Ga0163163_12862931
624 Ga0157380_10423624
625 Ga0157380_10870055
626 Ga0157377_10609895
627 Ga0157377_10811396
628 Ga0157377_11173412
629 Ga0197907_10349165
630 Ga0197907_10635502
631 Ga0206356_11844326
632 Ga0206354_10127329
633 Ga0206354_11197991
634 Ga0206353_10306737
635 Ga0206353_10647695
636 Ga0206353_11246324
637 Ga0224712_10163623
638 Ga0207642_10038651
639 Ga0207645_10095485
640 Ga0207705_10881258
641 Ga0207707_10021203
642 Ga0207707_10198370
643 Ga0207695_10230028
644 Ga0207671_10118847
645 Ga0207660_10006517
646 Ga0207660_10470455
647 Ga0207660_10650918
648 Ga0207660_11066559
649 Ga0207657_10008716
650 Ga0207657_10370114
651 Ga0207652_10106460
652 Ga0207652_10265906
653 Ga0207652_10884037
654 Ga0207652_10956627
655 Ga0207681_10572371
656 Ga0207694_10062806
657 Ga0207650_10904164
658 Ga0207687_10044656
659 Ga0207687_10657378
660 Ga0207700_10048180
661 Ga0207664_10072670
662 Ga0207664_10652098
663 Ga0207690_10093943
664 Ga0207690_10336955
665 Ga0207690_10355193
666 Ga0207706_10001808
667 Ga0207706_10672045
668 Ga0207686_10075129
669 Ga0207709_10390025
670 Ga0207669_10015801
671 Ga0207665_10253850
672 Ga0207665_10445978
673 Ga0207691_10359553
674 Ga0207691_10696264
675 Ga0207661_10033047
676 Ga0207661_10205662
677 Ga0207661_10877051
678 Ga0207712_10028967
679 Ga0207668_10106727
680 Ga0207668_10119868
681 Ga0207668_10148611
682 Ga0207668_10353596
683 Ga0207640_10108963
684 Ga0207639_10056347
685 Ga0207639_11285432
686 Ga0207678_11029835
687 Ga0207708_10089075
688 Ga0207702_10044047
689 Ga0207702_10212465
690 Ga0207702_10240623
691 Ga0207648_10524584
692 Ga0207648_11032192
693 Ga0207676_10857809
694 Ga0207674_10252559
695 Ga0207674_10382018
696 Ga0207675_100000210
697 Ga0207675_100373858
698 Ga0207683_11043638
699 Ga0207698_10106296
700 Ga0207698_10424325
701 Ga0209974_10032977
702 Ga0207428_10019830
703 Ga0268266_10012688
704 Ga0307408_100031718
705 Ga0307405_10018772
706 Ga0307405_10335926
707 Ga0307413_10132717
708 Ga0307410_10658876
709 Ga0307410_10822111
710 Ga0307410_11317792
711 Ga0307406_10084808
712 Ga0307406_10089241
713 Ga0307406_10131302
714 Ga0307406_10213770
715 Ga0307406_10809545
716 Ga0307407_10004113
717 Ga0307407_10200693
718 Ga0307412_10075908
719 Ga0307409_100053913
720 Ga0307409_100106628
721 Ga0307409_100196683
722 Ga0307409_100365624
723 Ga0307409_101800623
724 Ga0307416_100022437
725 Ga0307416_100049171
726 Ga0307416_100065783
727 Ga0307416_100093014
728 Ga0307416_100321210
729 Ga0307416_101251989
730 Ga0307414_10213790
731 Ga0307414_10810755
732 Ga0307415_100068254
733 Ga0307415_100170628
734 Ga0307415_100625153
735 Ga0307415_100667108
736 Ga0373948_0175714
737 Ga0373949_0018199
738 Ga0373952_0136624
739 Ga0373960_0206604
740 Ga0373961_0026956
741 Ga0395899_0297503
742 Ga0395900_0026491
743 Ga0395898_0003638
744 Ga0395898_0065457
745 Ga0395898_1127699
746 Ga0395905_0008956
747 Ga0395901_0008668
748 Ga0395901_0044330
749 Ga0395901_0048378
750 Ga0395901_0478292
751 Ga0395901_1794318
752 Ga0436365_0249881
753 Ga0436363_0661859
754 Ga0436362_0396615
755 Ga0436362_0889345
756 Ga0439458_0116189
757 Ga0439444_0021237
758 Ga0439440_0024645
759 Ga0466969_0056449
760 Ga0466966_0467849
761 Ga0466963_0028080
762 Ga0466963_0283923
763 Ga0466963_0381338
764 Ga0466963_1059835
765 Ga0466963_1126772
766 Ga0466964_0237996
767 Ga0466964_0424659
768 Ga0466968_0019172
769 Ga0466970_0060337
770 Ga0466957_0294569
771 Ga0466960_0277139
772 Ga0466960_0496710
773 Ga0466960_0920920
774 Ga0466959_0015825
775 Ga0466959_0022065
776 Ga0466959_0122597
777 Ga0466958_0094931
778 Ga0466958_0218764
779 Ga0466967_0038536
780 Ga0466967_0067506
781 Ga0466967_0155107
782 Ga0466967_0206478
783 Ga0466967_0242842
784 Ga0466967_0312636
785 Ga0466967_0368190
786 Ga0466967_1341897
787 Ga0495592_0118314
788 Ga0495590_0085575
789 Ga0495590_0372938
790 Ga0495664_0234301
791 Ga0495584_0467633
792 Ga0495596_0058721
793 Ga0495596_0077910
794 Ga0495596_0422186
795 Ga0495608_0000163
796 Ga0495637_0284079
797 Ga0495644_0243311
798 Ga0495663_0130544
799 Ga0495663_0250118
800 Ga0495652_0208131
801 Ga0495609_0448702
802 Ga0495668_0107861
803 Ga0495668_0218422
804 Ga0495668_0601027
805 Ga0495661_0439059
806 Ga0495669_0452851
807 Ga0495589_0216551
808 Ga0495672_0004560
809 Ga0495672_0322706
810 Ga0495626_0405476
811 Ga0496100_0138915
812 Ga0496100_0920212
813 Ga0496101_0634031
814 Ga0496102_0024261
815 Ga0496102_0217032
816 Ga0496102_0344198
817 Ga0496103_0535499
818 Ga0496104_0009434
819 Ga0496104_0072381
820 Ga0496105_0022314
821 Ga0496105_0023487
822 Ga0496106_0020764
823 Ga0496107_0066759
824 Ga0496108_0001096
825 Ga0496108_0009702
826 Ga0496108_0307260
827 Ga0496109_0000548
828 Ga0496109_0003954
829 Ga0496109_0205046
830 Ga0496109_0286217
831 Ga0496110_0005407
832 Ga0496110_0181953
833 Ga0496110_0619084
834 Ga0496110_1180373
835 Ga0496110_1452415
836 Ga0496111_0086468
837 Ga0496111_0111976
838 Ga0496111_0356005
839 Ga0496111_0357816
840 Ga0496111_0436110
841 Ga0496112_0016292
842 Ga0496112_0081129
843 Ga0496112_0163901
844 Ga0496112_0237678
845 Ga0496112_0356594
846 Ga0496112_0429113
847 Ga0496112_0621863
848 Ga0496112_1273038
849 Ga0496113_0011920
850 Ga0496113_0126634
851 Ga0496113_0155060
852 Ga0496113_0361995
853 Ga0496124_0115076
854 Ga0501031_0233952
855 Ga0501037_0384683
856 Ga0501037_0502985
857 Ga0501038_0245820
858 Ga0501039_0564947
859 Ga0501040_0059592
860 Ga0501040_0944148
861 Ga0501041_0047849
862 Ga0501041_0112415
863 Ga0501041_0183624
864 Ga0501042_0109418
865 Ga0501048_0196415
866 Ga0501048_0426858
867 Ga0501067_0231373
868 Ga0501067_0325743
869 Ga0501069_0968668
870 Ga0501072_0007876
871 Ga0501072_0591668
872 Ga0501072_0619882
873 Ga0501075_0038315
874 Ga0501075_0087812
875 Ga0501075_0706839
876 Ga0501076_0309148
877 Ga0501076_0417292
878 Ga0501076_1370990
879 Ga0501076_1634224
880 Ga0501077_0487117
881 Ga0501077_1118186
882 Ga0501079_0148023
883 Ga0501079_0234023
884 Ga0501079_0452164
885 Ga0501080_0737972
886 Ga0501081_0080488
887 Ga0501081_0108792
888 Ga0501083_0678999
889 Ga0501271_035503
890 Ga0501045_0014244
891 Ga0501045_0020731
892 nmdc:mga03n38_36959_c1
893 nmdc:mga03n38_828702_c1
894 nmdc:mga0yw44_54786_c1
895 nmdc:mga05p37_399078_c1
896 nmdc:mga05p37_399823_c1
897 nmdc:mga05p37_638623_c1
898 nmdc:mga09592_145380_c1
899 nmdc:mga09592_90208_c1
900 nmdc:mga0qj67_1209354_c1
901 nmdc:mga0qj67_44194_c1
902 nmdc:mga06r32_125293_c1
903 nmdc:mga06r32_1629797_c1
904 nmdc:mga06r32_224608_c1
905 nmdc:mga06r32_57192_c1
906 nmdc:mga06r32_866599_c1
907 nmdc:mga08y16_1119338_c1
908 nmdc:mga08y16_21850_c1
909 nmdc:mga08y16_233044_c1
910 nmdc:mga0a205_1101509_c1
911 Ga0495601_0119080
912 Ga0495601_0219863
913 Ga0495655_0057059
914 Ga0495655_0115565
915 Ga0501084_0180901
916 Ga0501084_0217853
917 Ga0501084_0636552
918 Ga0466962_0046189
919 Ga0530510_0107236
920 Ga0530510_0126432

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

27

137

0.98

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

25

150

0.89

PF13468

Glyoxalase_3

Glyoxalase-like domain

26

153

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.9761 4 136
6bu2-assembly1.cif.gz_A crystal structure of methylmalonyl-coa epimerase from mycobacterium tuberculosis 0.9658 2 132
6xbs-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (e43q) in complex with 2-nitronate-propionyl-coa 0.9537 1 133
6xbt-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (q60a) in complex with 2-nitronate-propionyl-coa 0.9528 1 133
6xbr-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (e43l) in complex with 2-nitronate-propionyl-coa 0.952 1 134
ID Description Score Start End Superfamily
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.984 4 132 3.10.180.10
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9706 2 132 3.10.180.10
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9477 4 132 3.10.180.10
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9291 2 132 3.10.180.10
6qh4A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.903 2 132 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7V9MI44-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 0.9993 1 134 GO:0004493
GO:0046491
GO:0046872
AF-A0A7V8W8Q0-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 0.9988 30 134 GO:0004493
GO:0046491
GO:0046872
AF-A0A7V8VJC5-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 0.9983 1 136 GO:0004493
GO:0046491
GO:0046872
AF-A0A7V9GVF9-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 0.9963 1 134 GO:0004493
GO:0046491
GO:0046872
AF-A0A7V9PNI7-F1-model_v4 VOC family protein 0.9946 2 79 GO:0004493
GO:0046491
GO:0046872

Map