F448492

General Info

Members Datasets Scaffolds Average Seq Length
460 269 920 98

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_101133797|Ga0070668_1011337972
Length 105
Sequence MAIPAAAAAAYRAAAQIATTPGANSAIVPANIQGGNFSDFLSGAIKDSVNTMRQGEHAASQQVQGKANLVDVVQSVNAAELTLDTVVAVRDKVVQAYQSIMNMPI

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
129 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
130 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
133 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
138 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
139 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
155 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
156 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
157 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
158 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
159 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
166 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
172 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
173 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
174 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
184 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
228 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
229 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
230 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
231 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
232 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
233 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
234 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
235 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
236 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
237 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
238 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
239 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
240 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
241 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
242 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
243 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
244 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
245 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
246 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
247 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
248 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
249 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
250 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
251 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
252 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
253 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
254 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
255 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
256 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
257 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
258 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
259 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
260 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
261 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
262 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
263 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
264 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.91
Nodule 0
Rhizoplane 2.39
Rhizosphere 80.43
Stem 0
Stem Tuber 0
Unclassified 5.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_101133797 3300005347 Bacteria 707
2 JGI25165J46597_1000246 3300003214 Bacteria 73461
3 Ga0070658_10061431 3300005327 Bacteria 3061
4 Ga0070658_10085303 3300005327 Bacteria 2597
5 Ga0070658_11918340 3300005327 Bacteria 512
6 Ga0070676_10037107 3300005328 Bacteria 2810
7 Ga0070683_100671648 3300005329 Bacteria 992
8 Ga0070683_100831286 3300005329 Bacteria 886
9 Ga0068869_100026452 3300005334 Bacteria 4040
10 Ga0068869_100232025 3300005334 Unclassified 1467
11 Ga0070666_10046694 3300005335 Bacteria 2906
12 Ga0070666_10374855 3300005335 Bacteria 1021
13 Ga0070680_100120105 3300005336 Bacteria 2193
14 Ga0070680_100408508 3300005336 Bacteria 1158
15 Ga0070680_101310754 3300005336 Unclassified 627
16 Ga0068868_100308100 3300005338 Bacteria 1346
17 Ga0068868_101101320 3300005338 Bacteria 731
18 Ga0070660_100132921 3300005339 Bacteria 1992
19 Ga0070660_100871243 3300005339 Bacteria 759
20 Ga0070689_100248360 3300005340 Bacteria 1467
21 Ga0070691_10124438 3300005341 Bacteria 1301
22 Ga0070687_100555611 3300005343 Bacteria 782
23 Ga0070661_100282656 3300005344 Bacteria 1288
24 Ga0070661_101417193 3300005344 Bacteria 585
25 Ga0070669_100187259 3300005353 Bacteria 1622
26 Ga0070671_100730903 3300005355 Bacteria 860
27 Ga0070671_100756753 3300005355 Bacteria 845
28 Ga0070671_101075568 3300005355 Bacteria 706
29 Ga0070671_101106458 3300005355 Bacteria 696
30 Ga0070673_100058674 3300005364 Bacteria 3044
31 Ga0070673_100284978 3300005364 Bacteria 1450
32 Ga0070659_100087546 3300005366 Bacteria 2494
33 Ga0070713_100330454 3300005436 Bacteria 1410
34 Ga0070701_10045703 3300005438 Bacteria 2248
35 Ga0070711_100062173 3300005439 Bacteria 2602
36 Ga0070678_100132986 3300005456 Bacteria 1979
37 Ga0070678_102047939 3300005456 Bacteria 542
38 Ga0070681_10088956 3300005458 Bacteria 3039
39 Ga0070681_10260881 3300005458 Bacteria 1645
40 Ga0070681_10377688 3300005458 Bacteria 1328
41 Ga0068867_100001173 3300005459 Bacteria 17935
42 Ga0068867_100481415 3300005459 Bacteria 1064
43 Ga0070679_100060400 3300005530 Bacteria 3777
44 Ga0070679_100080350 3300005530 Bacteria 3250
45 Ga0070679_100459472 3300005530 Bacteria 1218
46 Ga0068853_100050973 3300005539 Bacteria 3562
47 Ga0068853_100459105 3300005539 Bacteria 1199
48 Ga0068853_101147966 3300005539 Bacteria 750
49 Ga0068853_101163784 3300005539 Bacteria 744
50 Ga0070672_101870799 3300005543 Bacteria 540
51 Ga0070693_101113644 3300005547 Bacteria 603
52 Ga0070665_100200995 3300005548 Bacteria 1993
53 Ga0070665_100273849 3300005548 Bacteria 1690
54 Ga0070665_101013291 3300005548 Bacteria 843
55 Ga0068855_100054076 3300005563 Bacteria 4721
56 Ga0068855_100090556 3300005563 Bacteria 3530
57 Ga0068855_100188472 3300005563 Bacteria 2328
58 Ga0068857_100048062 3300005577 Bacteria 3788
59 Ga0068857_100397499 3300005577 Bacteria 1282
60 Ga0068857_101865823 3300005577 Bacteria 589
61 Ga0068854_100284735 3300005578 Bacteria 1332
62 Ga0068856_100027274 3300005614 Bacteria 5573
63 Ga0068856_100184232 3300005614 Bacteria 2101
64 Ga0068856_100390691 3300005614 Bacteria 1411
65 Ga0070702_100088804 3300005615 Bacteria 1869
66 Ga0070702_100692056 3300005615 Bacteria 776
67 Ga0068852_101342161 3300005616 Bacteria 737
68 Ga0068859_101101417 3300005617 Bacteria 874
69 Ga0068864_100290766 3300005618 Bacteria 1528
70 Ga0068864_101001397 3300005618 Bacteria 829
71 Ga0068866_10010977 3300005718 Bacteria 3902
72 Ga0068866_11230080 3300005718 Bacteria 542
73 Ga0068861_100070556 3300005719 Bacteria 2705
74 Ga0068861_100518149 3300005719 Bacteria 1081
75 Ga0068870_10036035 3300005840 Bacteria 2543
76 Ga0068863_100480675 3300005841 Bacteria 1221
77 Ga0068858_100000040 3300005842 Bacteria 135911
78 Ga0068858_100032493 3300005842 Bacteria 4846
79 Ga0068858_100122718 3300005842 Bacteria 2431
80 Ga0081455_10172348 3300005937 Bacteria 1647
81 Ga0075368_10102818 3300006042 Bacteria 1174
82 Ga0075367_10017615 3300006178 Bacteria 3925
83 Ga0075369_10041860 3300006186 Bacteria 1962
84 Ga0075366_10009394 3300006195 Bacteria 5458
85 Ga0097621_100142589 3300006237 Bacteria 2048
86 Ga0097621_100159786 3300006237 Bacteria 1936
87 Ga0097621_100457519 3300006237 Bacteria 1150
88 Ga0097621_100930049 3300006237 Bacteria 811
89 Ga0075370_10509614 3300006353 Bacteria 726
90 Ga0068871_100027238 3300006358 Bacteria 4467
91 Ga0068871_100387897 3300006358 Bacteria 1242
92 Ga0068865_101986606 3300006881 Bacteria 528
93 Ga0097620_101101404 3300006931 Bacteria 874
94 Ga0105240_10000870 3300009093 Bacteria 54448
95 Ga0105240_10046409 3300009093 Bacteria 5505
96 Ga0105240_10060186 3300009093 Bacteria 4735
97 Ga0105240_10108379 3300009093 Bacteria 3365
98 Ga0105240_10374126 3300009093 Bacteria 1610
99 Ga0105240_10841478 3300009093 Bacteria 991
100 Ga0105240_11415904 3300009093 Unclassified 730
101 Ga0111539_10680699 3300009094 Bacteria 1197
102 Ga0105245_10018705 3300009098 Bacteria 6061
103 Ga0105245_10141132 3300009098 Bacteria 2269
104 Ga0105245_12214316 3300009098 Bacteria 603
105 Ga0105245_13037082 3300009098 Bacteria 520
106 Ga0105247_10044962 3300009101 Bacteria 2709
107 Ga0105243_10002806 3300009148 Bacteria 14474
108 Ga0105243_10452269 3300009148 Bacteria 1205
109 Ga0105241_10106936 3300009174 Bacteria 2233
110 Ga0105241_10220632 3300009174 Bacteria 1593
111 Ga0105241_12498760 3300009174 Unclassified 517
112 Ga0105242_10036412 3300009176 Bacteria 3948
113 Ga0105242_10361734 3300009176 Bacteria 1343
114 Ga0105248_10021016 3300009177 Bacteria 7233
115 Ga0105248_10028675 3300009177 Bacteria 6203
116 Ga0105248_12527888 3300009177 Unclassified 585
117 Ga0105237_10017524 3300009545 Bacteria 7423
118 Ga0105237_10355008 3300009545 Bacteria 1470
119 Ga0105237_10953631 3300009545 Bacteria 865
120 Ga0105237_12153878 3300009545 Bacteria 567
121 Ga0105238_10299011 3300009551 Bacteria 1593
122 Ga0105238_11024092 3300009551 Bacteria 847
123 Ga0105238_11357658 3300009551 Bacteria 737
124 Ga0105249_10291084 3300009553 Bacteria 1634
125 Ga0105249_10526028 3300009553 Bacteria 1231
126 Ga0105249_13465673 3300009553 Bacteria 508
127 Ga0105239_10071079 3300010375 Bacteria 3823
128 Ga0105239_10204468 3300010375 Bacteria 2213
129 Ga0105239_10682611 3300010375 Bacteria 1174
130 Ga0105239_10921639 3300010375 Bacteria 1003
131 Ga0105239_13183134 3300010375 Bacteria 534
132 Ga0105246_10154553 3300011119 Bacteria 1741
133 Ga0105246_10322102 3300011119 Bacteria 1256
134 Ga0157373_11166515 3300013100 Bacteria 580
135 Ga0157370_10103871 3300013104 Bacteria 2660
136 Ga0157370_10104550 3300013104 Bacteria 2650
137 Ga0157370_10109574 3300013104 Bacteria 2581
138 Ga0157369_10258731 3300013105 Bacteria 1815
139 Ga0157369_11029575 3300013105 Unclassified 843
140 Ga0157374_10863542 3300013296 Bacteria 922
141 Ga0157374_11046563 3300013296 Bacteria 836
142 Ga0157378_10133128 3300013297 Bacteria 2303
143 Ga0157378_10254756 3300013297 Bacteria 1681
144 Ga0157378_10668489 3300013297 Bacteria 1056
145 Ga0157378_11201793 3300013297 Bacteria 798
146 Ga0157378_12733200 3300013297 Bacteria 546
147 Ga0163162_10062649 3300013306 Bacteria 3760
148 Ga0163162_12410716 3300013306 Bacteria 605
149 Ga0157372_10051002 3300013307 Bacteria 4604
150 Ga0157372_10568963 3300013307 Bacteria 1321
151 Ga0157375_10521748 3300013308 Bacteria 1351
152 Ga0157375_12888486 3300013308 Bacteria 574
153 Ga0163163_10067857 3300014325 Bacteria 3547
154 Ga0163163_10313252 3300014325 Bacteria 1623
155 Ga0157380_12295721 3300014326 Unclassified 604
156 Ga0182008_10278407 3300014497 Bacteria 870
157 Ga0157377_10040621 3300014745 Bacteria 2577
158 Ga0157379_10017568 3300014968 Bacteria 6297
159 Ga0157379_11669968 3300014968 Bacteria 623
160 Ga0157376_10206716 3300014969 Bacteria 1810
161 Ga0157376_12881907 3300014969 Unclassified 521
162 Ga0163161_10721794 3300017792 Bacteria 831
163 Ga0213876_10000218 3300021384 Bacteria 57753
164 Ga0209563_107353 3300025230 Bacteria 1815
165 Ga0207427_104230 3300025231 Bacteria 2520
166 Ga0209148_1046335 3300025254 Bacteria 579
167 Ga0209233_1000006 3300025261 Bacteria 1473685
168 Ga0209233_1003288 3300025261 Bacteria 5730
169 Ga0209758_1000008 3300025297 Bacteria 1215263
170 Ga0207688_10045604 3300025901 Bacteria 2446
171 Ga0207680_10313068 3300025903 Bacteria 1096
172 Ga0207647_10115144 3300025904 Bacteria 1588
173 Ga0207645_10045774 3300025907 Bacteria 2796
174 Ga0207645_10076342 3300025907 Bacteria 2146
175 Ga0207643_10026616 3300025908 Bacteria 3202
176 Ga0207705_10077659 3300025909 Bacteria 2415
177 Ga0207705_10145787 3300025909 Bacteria 1771
178 Ga0207705_10322094 3300025909 Bacteria 1188
179 Ga0207705_10718168 3300025909 Bacteria 777
180 Ga0207705_10991141 3300025909 Bacteria 649
181 Ga0207654_10886297 3300025911 Bacteria 647
182 Ga0207707_10045286 3300025912 Bacteria 3834
183 Ga0207707_10318677 3300025912 Bacteria 1343
184 Ga0207707_10364798 3300025912 Bacteria 1243
185 Ga0207695_10006000 3300025913 Bacteria 15885
186 Ga0207695_10062331 3300025913 Bacteria 3850
187 Ga0207695_10073641 3300025913 Bacteria 3480
188 Ga0207695_10217056 3300025913 Bacteria 1821
189 Ga0207695_11089566 3300025913 Bacteria 679
190 Ga0207671_10235275 3300025914 Bacteria 1438
191 Ga0207663_10338364 3300025916 Bacteria 1136
192 Ga0207663_11300803 3300025916 Unclassified 586
193 Ga0207660_10570024 3300025917 Bacteria 921
194 Ga0207660_11243159 3300025917 Unclassified 605
195 Ga0207657_10016364 3300025919 Bacteria 7155
196 Ga0207649_11566283 3300025920 Unclassified 522
197 Ga0207652_10217186 3300025921 Bacteria 1722
198 Ga0207652_10584365 3300025921 Bacteria 1002
199 Ga0207652_10873052 3300025921 Bacteria 796
200 Ga0207652_11437640 3300025921 Bacteria 593
201 Ga0207652_11559295 3300025921 Bacteria 565
202 Ga0207694_10307915 3300025924 Bacteria 1305
203 Ga0207694_10613633 3300025924 Bacteria 915
204 Ga0207650_10297655 3300025925 Bacteria 1317
205 Ga0207650_10301467 3300025925 Bacteria 1309
206 Ga0207687_10024684 3300025927 Bacteria 4018
207 Ga0207687_10047806 3300025927 Bacteria 2967
208 Ga0207700_10480371 3300025928 Bacteria 1098
209 Ga0207644_10759727 3300025931 Bacteria 810
210 Ga0207644_10940151 3300025931 Bacteria 725
211 Ga0207644_11511225 3300025931 Bacteria 564
212 Ga0207690_10034642 3300025932 Bacteria 3255
213 Ga0207706_10272085 3300025933 Bacteria 1478
214 Ga0207706_11397798 3300025933 Bacteria 575
215 Ga0207686_10008333 3300025934 Bacteria 5594
216 Ga0207709_10004995 3300025935 Bacteria 7584
217 Ga0207709_10378786 3300025935 Bacteria 1076
218 Ga0207704_11026060 3300025938 Bacteria 698
219 Ga0207704_11754334 3300025938 Bacteria 534
220 Ga0207711_10041569 3300025941 Bacteria 3915
221 Ga0207711_10385979 3300025941 Bacteria 1300
222 Ga0207689_10019249 3300025942 Bacteria 5755
223 Ga0207689_10663748 3300025942 Bacteria 879
224 Ga0207667_10080202 3300025949 Bacteria 3382
225 Ga0207667_10774604 3300025949 Unclassified 957
226 Ga0207667_11465432 3300025949 Unclassified 654
227 Ga0207667_11748400 3300025949 Bacteria 587
228 Ga0207651_10040796 3300025960 Bacteria 3075
229 Ga0207651_10381028 3300025960 Bacteria 1195
230 Ga0207677_10042653 3300026023 Bacteria 3010
231 Ga0207677_10406149 3300026023 Bacteria 1156
232 Ga0207703_10000279 3300026035 Bacteria 56629
233 Ga0207639_10073330 3300026041 Bacteria 2683
234 Ga0207639_10457463 3300026041 Bacteria 1160
235 Ga0207678_11920573 3300026067 Bacteria 516
236 Ga0207702_10017818 3300026078 Bacteria 5880
237 Ga0207702_10537599 3300026078 Bacteria 1142
238 Ga0207702_10723035 3300026078 Bacteria 982
239 Ga0207702_10744832 3300026078 Bacteria 967
240 Ga0207641_11497262 3300026088 Bacteria 676
241 Ga0207648_10007994 3300026089 Bacteria 10315
242 Ga0207674_10331112 3300026116 Bacteria 1472
243 Ga0207674_11107501 3300026116 Bacteria 761
244 Ga0207675_100818985 3300026118 Bacteria 945
245 Ga0207683_10065013 3300026121 Bacteria 3215
246 Ga0207683_10139816 3300026121 Bacteria 2181
247 Ga0207683_11746194 3300026121 Bacteria 571
248 Ga0268266_10142614 3300028379 Bacteria 2151
249 Ga0268266_10268694 3300028379 Bacteria 1582
250 Ga0268265_10337341 3300028380 Bacteria 1371
251 Ga0265319_1195115 3300028563 Bacteria 622
252 Ga0265318_10247280 3300028577 Bacteria 651
253 Ga0307517_10302068 3300028786 Bacteria 897
254 Ga0265338_10445899 3300028800 Bacteria 917
255 Ga0265330_10304762 3300031235 Unclassified 672
256 Ga0265328_10328958 3300031239 Bacteria 593
257 Ga0265325_10209183 3300031241 Unclassified 897
258 Ga0265339_10028765 3300031249 Bacteria 3158
259 Ga0265331_10026888 3300031250 Bacteria 2889
260 Ga0307508_10560872 3300031616 Bacteria 741
261 Ga0307510_10013689 3300033180 Bacteria 9617
262 Ga0373926_0082792 3300035083 Bacteria 1188
263 Ga0373931_0905839 3300035691 Bacteria 593
264 Ga0373927_0000767 3300035695 Bacteria 24571
265 Ga0373947_0023269 3300035725 Bacteria 3602
266 Ga0373925_0126245 3300037068 Bacteria 1991
267 Ga0373925_0283647 3300037068 Bacteria 1334
268 Ga0395899_0000197 3300037312 Bacteria 88596
269 Ga0395899_0069012 3300037312 Bacteria 2590
270 Ga0395899_0078580 3300037312 Bacteria 2405
271 Ga0395900_0000006 3300037418 Bacteria 495364
272 Ga0395900_0055240 3300037418 Bacteria 4089
273 Ga0395900_0259201 3300037418 Bacteria 1737
274 Ga0395898_0002009 3300037466 Bacteria 25527
275 Ga0395898_0184615 3300037466 Bacteria 1993
276 Ga0395898_0311002 3300037466 Bacteria 1503
277 Ga0395905_0002813 3300037471 Bacteria 19070
278 Ga0395905_0019833 3300037471 Bacteria 6371
279 Ga0395905_0024566 3300037471 Bacteria 5687
280 Ga0395905_0044207 3300037471 Bacteria 4180
281 Ga0395905_1079040 3300037471 Bacteria 706
282 Ga0436364_1420699 3300037853 Bacteria 2352
283 Ga0395901_0000001 3300038443 Bacteria 800383
284 Ga0395901_0013379 3300038443 Bacteria 8338
285 Ga0395901_0059577 3300038443 Bacteria 3972
286 Ga0395901_0115692 3300038443 Bacteria 2817
287 Ga0395901_0577474 3300038443 Bacteria 1136
288 Ga0436365_0577642 3300039437 Bacteria 77516
289 Ga0436365_0765158 3300039437 Bacteria 784
290 Ga0436365_0840377 3300039437 Unclassified 563
291 Ga0436365_1314699 3300039437 Bacteria 883
292 Ga0436365_1603232 3300039437 Bacteria 1299
293 Ga0436360_0392929 3300039438 Bacteria 1494
294 Ga0436361_1163081 3300039447 Bacteria 527
295 Ga0436363_0256590 3300039450 Bacteria 1346
296 Ga0436362_0097630 3300039453 Bacteria 574
297 Ga0451787_110416 3300041441 Unclassified 1115
298 Ga0451793_0339017 3300041452 Unclassified 573
299 Ga0451800_0927983 3300041459 Bacteria 656
300 Ga0451804_0076586 3300041463 Unclassified 590
301 Ga0439459_0090276 3300042438 Bacteria 736
302 Ga0466972_0247324 3300044658 Bacteria 834
303 Ga0495590_0200180 3300046457 Bacteria 734
304 Ga0495629_0027842 3300046459 Bacteria 4015
305 Ga0495605_0156933 3300046474 Bacteria 1012
306 Ga0495583_0020691 3300046506 Bacteria 3401
307 Ga0495610_0029948 3300046512 Bacteria 2859
308 Ga0495616_0034380 3300046513 Unclassified 2633
309 Ga0495628_0740125 3300046516 Bacteria 692
310 Ga0495632_0205299 3300046519 Bacteria 896
311 Ga0495643_0090358 3300046522 Bacteria 1580
312 Ga0495652_0951995 3300046529 Bacteria 564
313 Ga0495654_0210740 3300046530 Bacteria 827
314 Ga0495609_0103544 3300046538 Bacteria 1232
315 Ga0495621_0152635 3300046539 Bacteria 909
316 Ga0495597_0001227 3300046542 Bacteria 19098
317 Ga0495622_0016461 3300046557 Bacteria 3444
318 Ga0495668_0025573 3300046616 Bacteria 3354
319 Ga0495668_0085566 3300046616 Bacteria 1729
320 Ga0495668_0580430 3300046616 Bacteria 619
321 Ga0495611_0064086 3300046648 Bacteria 1673
322 Ga0495611_0396239 3300046648 Bacteria 631
323 Ga0495625_0034519 3300046660 Bacteria 3732
324 Ga0495625_0100400 3300046660 Bacteria 1989
325 Ga0495625_0116216 3300046660 Bacteria 1825
326 Ga0495625_0234474 3300046660 Bacteria 1197
327 Ga0495625_0661551 3300046660 Bacteria 621
328 Ga0495669_0000270 3300046684 Bacteria 29764
329 Ga0495669_0018957 3300046684 Bacteria 2965
330 Ga0495649_0353609 3300046694 Bacteria 742
331 Ga0495672_0361023 3300047320 Bacteria 672
332 Ga0495687_132244 3300047443 Bacteria 881
333 Ga0495677_0137144 3300047445 Bacteria 938
334 Ga0495685_067709 3300047447 Bacteria 1199
335 Ga0495686_0214304 3300047472 Bacteria 1099
336 Ga0496101_0211676 3300048904 Bacteria 1502
337 Ga0496101_0999762 3300048904 Bacteria 658
338 Ga0496102_0086850 3300048905 Bacteria 2889
339 Ga0496104_0492596 3300048907 Bacteria 1137
340 Ga0496107_0395976 3300048910 Bacteria 1027
341 Ga0496115_0061783 3300048918 Bacteria 3021
342 Ga0496115_1300064 3300048918 Bacteria 542
343 Ga0496118_0015437 3300048921 Bacteria 7068
344 Ga0496119_0021576 3300048922 Bacteria 4648
345 Ga0496120_0157508 3300048923 Bacteria 1135
346 Ga0496121_0000130 3300048924 Bacteria 168094
347 Ga0495682_0327643 3300049460 Bacteria 540
348 Ga0501031_0001568 3300049568 Bacteria 14239
349 Ga0501032_0025928 3300049569 Bacteria 4037
350 Ga0501032_0689677 3300049569 Unclassified 648
351 Ga0501033_0014570 3300049570 Bacteria 5969
352 Ga0501033_0033403 3300049570 Bacteria 3862
353 Ga0501033_0075641 3300049570 Bacteria 2471
354 Ga0501034_0039127 3300049571 Bacteria 4803
355 Ga0501034_0060440 3300049571 Bacteria 3806
356 Ga0501034_0103809 3300049571 Bacteria 2836
357 Ga0501034_0449357 3300049571 Bacteria 1207
358 Ga0501034_1100010 3300049571 Bacteria 676
359 Ga0501036_0028286 3300049572 Bacteria 4737
360 Ga0501036_0059436 3300049572 Bacteria 3239
361 Ga0501037_0020311 3300049573 Bacteria 4903
362 Ga0501037_0672973 3300049573 Bacteria 690
363 Ga0501038_0036608 3300049574 Bacteria 4305
364 Ga0501039_0088985 3300049575 Bacteria 2405
365 Ga0501040_0554490 3300049576 Bacteria 829
366 Ga0501042_0054930 3300049578 Bacteria 2841
367 Ga0501043_0022056 3300049579 Bacteria 4996
368 Ga0501043_0083018 3300049579 Bacteria 2519
369 Ga0501046_0005425 3300049580 Bacteria 11394
370 Ga0501046_0178158 3300049580 Bacteria 1591
371 Ga0501047_0005046 3300049581 Bacteria 12389
372 Ga0501047_0008898 3300049581 Bacteria 9476
373 Ga0501047_0042905 3300049581 Bacteria 4370
374 Ga0501047_0051369 3300049581 Bacteria 3983
375 Ga0501047_0311627 3300049581 Bacteria 1414
376 Ga0501047_0886880 3300049581 Bacteria 705
377 Ga0501047_1161653 3300049581 Bacteria 585
378 Ga0501048_0008869 3300049582 Bacteria 7571
379 Ga0501067_0001812 3300049583 Bacteria 11746
380 Ga0501067_0114647 3300049583 Bacteria 1499
381 Ga0501069_0031266 3300049585 Bacteria 2926
382 Ga0501070_0032549 3300049586 Bacteria 4364
383 Ga0501070_0038993 3300049586 Bacteria 3964
384 Ga0501071_1220896 3300049587 Bacteria 581
385 Ga0501073_0008917 3300049589 Bacteria 7412
386 Ga0501073_0060921 3300049589 Bacteria 2634
387 Ga0501073_0189988 3300049589 Bacteria 1421
388 Ga0501074_0000651 3300049590 Bacteria 21601
389 Ga0501076_0363418 3300049592 Bacteria 1189
390 Ga0501076_0376516 3300049592 Bacteria 1167
391 Ga0501079_0000470 3300049741 Bacteria 26610
392 Ga0501083_0002083 3300049744 Bacteria 13757
393 Ga0501035_0097315 3300049822 Bacteria 2584
394 Ga0501035_0174450 3300049822 Bacteria 1855
395 Ga0501035_0229220 3300049822 Bacteria 1583
396 Ga0501044_0004206 3300049823 Bacteria 16172
397 Ga0501044_0064424 3300049823 Bacteria 3742
398 Ga0501044_0097176 3300049823 Bacteria 2966
399 Ga0501044_0431915 3300049823 Bacteria 1226
400 Ga0501044_0727315 3300049823 Bacteria 876
401 Ga0501044_1236173 3300049823 Unclassified 614
402 Ga0501045_0034717 3300049824 Bacteria 3662
403 nmdc:mga00v17_3947_c1 3300050491 Bacteria 7649
404 nmdc:mga0k408_25735_c1 3300050493 Bacteria 3334
405 nmdc:mga06z11_53687_c1 3300050494 Bacteria 2074
406 nmdc:mga07m45_190_c1 3300050496 Bacteria 24417
407 nmdc:mga08y16_1802525_c1 3300050511 Unclassified 565
408 nmdc:mga0sz30_40377_c1 3300050516 Bacteria 1961
409 Ga0500635_0000283 3300053080 Bacteria 18681
410 Ga0500578_0437144 3300053086 Bacteria 747
411 Ga0500647_0023825 3300053091 Bacteria 2875
412 Ga0500583_0079358 3300053092 Bacteria 1583
413 Ga0500651_0027265 3300053093 Bacteria 3592
414 Ga0500566_0022856 3300053094 Bacteria 3672
415 Ga0500566_0453733 3300053094 Unclassified 561
416 Ga0500650_0437614 3300053098 Bacteria 562
417 Ga0500555_141223 3300053103 Bacteria 593
418 Ga0500569_036358 3300053109 Bacteria 1417
419 Ga0500591_173616 3300053115 Bacteria 792
420 Ga0500592_053575 3300053116 Bacteria 657
421 Ga0500594_0046964 3300053118 Bacteria 1203
422 Ga0500595_014987 3300053119 Bacteria 2924
423 Ga0500595_015625 3300053119 Bacteria 2845
424 Ga0500597_279038 3300053120 Unclassified 674
425 Ga0500607_036232 3300053121 Bacteria 2695
426 Ga0500608_002286 3300053122 Bacteria 6937
427 Ga0500614_005148 3300053123 Bacteria 2746
428 Ga0500614_112051 3300053123 Bacteria 796
429 Ga0500642_0076922 3300053130 Bacteria 1527
430 Ga0500655_011060 3300053133 Bacteria 1633
431 Ga0500658_0063928 3300053134 Bacteria 1538
432 Ga0500559_0030323 3300053136 Bacteria 2318
433 Ga0500559_0047474 3300053136 Bacteria 1886
434 Ga0500568_0023563 3300053139 Bacteria 2618
435 Ga0500568_0026265 3300053139 Bacteria 2446
436 Ga0500573_0000026 3300053140 Bacteria 144363
437 Ga0500577_0030809 3300053142 Bacteria 1871
438 Ga0500577_0208720 3300053142 Bacteria 844
439 Ga0500588_0170124 3300053146 Bacteria 797
440 Ga0500590_029217 3300053148 Bacteria 2860
441 Ga0500619_022645 3300053154 Bacteria 1826
442 Ga0500620_188561 3300053155 Bacteria 708
443 Ga0500627_0207629 3300053158 Bacteria 877
444 Ga0500638_106995 3300053162 Bacteria 1296
445 Ga0500639_134217 3300053163 Bacteria 1168
446 Ga0500636_0012926 3300053177 Bacteria 4897
447 Ga0500636_0013372 3300053177 Bacteria 4819
448 Ga0500636_0293367 3300053177 Bacteria 805
449 Ga0500637_0243630 3300053178 Bacteria 1006
450 Ga0500637_0261121 3300053178 Bacteria 961
451 Ga0500576_154817 3300053725 Bacteria 850
452 Ga0500625_059432 3300053729 Bacteria 1740
453 Ga0500596_002458 3300053735 Bacteria 3650
454 Ga0500601_032648 3300053737 Bacteria 621
455 Ga0501084_0019927 3300054114 Bacteria 5590
456 Ga0500661_062801 3300055283 Bacteria 673
457 Ga0501082_0025837 3300060353 Bacteria 5062
458 Ga0501082_0037723 3300060353 Bacteria 4167
459 Ga0466962_0435939 3300061719 Bacteria 659
460 Ga0530510_1261368 3300061734 Bacteria 567
461 Ga0070668_101133797
462 JGI25165J46597_1000246
463 Ga0070658_10061431
464 Ga0070658_10085303
465 Ga0070658_11918340
466 Ga0070676_10037107
467 Ga0070683_100671648
468 Ga0070683_100831286
469 Ga0068869_100026452
470 Ga0068869_100232025
471 Ga0070666_10046694
472 Ga0070666_10374855
473 Ga0070680_100120105
474 Ga0070680_100408508
475 Ga0070680_101310754
476 Ga0068868_100308100
477 Ga0068868_101101320
478 Ga0070660_100132921
479 Ga0070660_100871243
480 Ga0070689_100248360
481 Ga0070691_10124438
482 Ga0070687_100555611
483 Ga0070661_100282656
484 Ga0070661_101417193
485 Ga0070669_100187259
486 Ga0070671_100730903
487 Ga0070671_100756753
488 Ga0070671_101075568
489 Ga0070671_101106458
490 Ga0070673_100058674
491 Ga0070673_100284978
492 Ga0070659_100087546
493 Ga0070713_100330454
494 Ga0070701_10045703
495 Ga0070711_100062173
496 Ga0070678_100132986
497 Ga0070678_102047939
498 Ga0070681_10088956
499 Ga0070681_10260881
500 Ga0070681_10377688
501 Ga0068867_100001173
502 Ga0068867_100481415
503 Ga0070679_100060400
504 Ga0070679_100080350
505 Ga0070679_100459472
506 Ga0068853_100050973
507 Ga0068853_100459105
508 Ga0068853_101147966
509 Ga0068853_101163784
510 Ga0070672_101870799
511 Ga0070693_101113644
512 Ga0070665_100200995
513 Ga0070665_100273849
514 Ga0070665_101013291
515 Ga0068855_100054076
516 Ga0068855_100090556
517 Ga0068855_100188472
518 Ga0068857_100048062
519 Ga0068857_100397499
520 Ga0068857_101865823
521 Ga0068854_100284735
522 Ga0068856_100027274
523 Ga0068856_100184232
524 Ga0068856_100390691
525 Ga0070702_100088804
526 Ga0070702_100692056
527 Ga0068852_101342161
528 Ga0068859_101101417
529 Ga0068864_100290766
530 Ga0068864_101001397
531 Ga0068866_10010977
532 Ga0068866_11230080
533 Ga0068861_100070556
534 Ga0068861_100518149
535 Ga0068870_10036035
536 Ga0068863_100480675
537 Ga0068858_100000040
538 Ga0068858_100032493
539 Ga0068858_100122718
540 Ga0081455_10172348
541 Ga0075368_10102818
542 Ga0075367_10017615
543 Ga0075369_10041860
544 Ga0075366_10009394
545 Ga0097621_100142589
546 Ga0097621_100159786
547 Ga0097621_100457519
548 Ga0097621_100930049
549 Ga0075370_10509614
550 Ga0068871_100027238
551 Ga0068871_100387897
552 Ga0068865_101986606
553 Ga0097620_101101404
554 Ga0105240_10000870
555 Ga0105240_10046409
556 Ga0105240_10060186
557 Ga0105240_10108379
558 Ga0105240_10374126
559 Ga0105240_10841478
560 Ga0105240_11415904
561 Ga0111539_10680699
562 Ga0105245_10018705
563 Ga0105245_10141132
564 Ga0105245_12214316
565 Ga0105245_13037082
566 Ga0105247_10044962
567 Ga0105243_10002806
568 Ga0105243_10452269
569 Ga0105241_10106936
570 Ga0105241_10220632
571 Ga0105241_12498760
572 Ga0105242_10036412
573 Ga0105242_10361734
574 Ga0105248_10021016
575 Ga0105248_10028675
576 Ga0105248_12527888
577 Ga0105237_10017524
578 Ga0105237_10355008
579 Ga0105237_10953631
580 Ga0105237_12153878
581 Ga0105238_10299011
582 Ga0105238_11024092
583 Ga0105238_11357658
584 Ga0105249_10291084
585 Ga0105249_10526028
586 Ga0105249_13465673
587 Ga0105239_10071079
588 Ga0105239_10204468
589 Ga0105239_10682611
590 Ga0105239_10921639
591 Ga0105239_13183134
592 Ga0105246_10154553
593 Ga0105246_10322102
594 Ga0157373_11166515
595 Ga0157370_10103871
596 Ga0157370_10104550
597 Ga0157370_10109574
598 Ga0157369_10258731
599 Ga0157369_11029575
600 Ga0157374_10863542
601 Ga0157374_11046563
602 Ga0157378_10133128
603 Ga0157378_10254756
604 Ga0157378_10668489
605 Ga0157378_11201793
606 Ga0157378_12733200
607 Ga0163162_10062649
608 Ga0163162_12410716
609 Ga0157372_10051002
610 Ga0157372_10568963
611 Ga0157375_10521748
612 Ga0157375_12888486
613 Ga0163163_10067857
614 Ga0163163_10313252
615 Ga0157380_12295721
616 Ga0182008_10278407
617 Ga0157377_10040621
618 Ga0157379_10017568
619 Ga0157379_11669968
620 Ga0157376_10206716
621 Ga0157376_12881907
622 Ga0163161_10721794
623 Ga0213876_10000218
624 Ga0209563_107353
625 Ga0207427_104230
626 Ga0209148_1046335
627 Ga0209233_1000006
628 Ga0209233_1003288
629 Ga0209758_1000008
630 Ga0207688_10045604
631 Ga0207680_10313068
632 Ga0207647_10115144
633 Ga0207645_10045774
634 Ga0207645_10076342
635 Ga0207643_10026616
636 Ga0207705_10077659
637 Ga0207705_10145787
638 Ga0207705_10322094
639 Ga0207705_10718168
640 Ga0207705_10991141
641 Ga0207654_10886297
642 Ga0207707_10045286
643 Ga0207707_10318677
644 Ga0207707_10364798
645 Ga0207695_10006000
646 Ga0207695_10062331
647 Ga0207695_10073641
648 Ga0207695_10217056
649 Ga0207695_11089566
650 Ga0207671_10235275
651 Ga0207663_10338364
652 Ga0207663_11300803
653 Ga0207660_10570024
654 Ga0207660_11243159
655 Ga0207657_10016364
656 Ga0207649_11566283
657 Ga0207652_10217186
658 Ga0207652_10584365
659 Ga0207652_10873052
660 Ga0207652_11437640
661 Ga0207652_11559295
662 Ga0207694_10307915
663 Ga0207694_10613633
664 Ga0207650_10297655
665 Ga0207650_10301467
666 Ga0207687_10024684
667 Ga0207687_10047806
668 Ga0207700_10480371
669 Ga0207644_10759727
670 Ga0207644_10940151
671 Ga0207644_11511225
672 Ga0207690_10034642
673 Ga0207706_10272085
674 Ga0207706_11397798
675 Ga0207686_10008333
676 Ga0207709_10004995
677 Ga0207709_10378786
678 Ga0207704_11026060
679 Ga0207704_11754334
680 Ga0207711_10041569
681 Ga0207711_10385979
682 Ga0207689_10019249
683 Ga0207689_10663748
684 Ga0207667_10080202
685 Ga0207667_10774604
686 Ga0207667_11465432
687 Ga0207667_11748400
688 Ga0207651_10040796
689 Ga0207651_10381028
690 Ga0207677_10042653
691 Ga0207677_10406149
692 Ga0207703_10000279
693 Ga0207639_10073330
694 Ga0207639_10457463
695 Ga0207678_11920573
696 Ga0207702_10017818
697 Ga0207702_10537599
698 Ga0207702_10723035
699 Ga0207702_10744832
700 Ga0207641_11497262
701 Ga0207648_10007994
702 Ga0207674_10331112
703 Ga0207674_11107501
704 Ga0207675_100818985
705 Ga0207683_10065013
706 Ga0207683_10139816
707 Ga0207683_11746194
708 Ga0268266_10142614
709 Ga0268266_10268694
710 Ga0268265_10337341
711 Ga0265319_1195115
712 Ga0265318_10247280
713 Ga0307517_10302068
714 Ga0265338_10445899
715 Ga0265330_10304762
716 Ga0265328_10328958
717 Ga0265325_10209183
718 Ga0265339_10028765
719 Ga0265331_10026888
720 Ga0307508_10560872
721 Ga0307510_10013689
722 Ga0373926_0082792
723 Ga0373931_0905839
724 Ga0373927_0000767
725 Ga0373947_0023269
726 Ga0373925_0126245
727 Ga0373925_0283647
728 Ga0395899_0000197
729 Ga0395899_0069012
730 Ga0395899_0078580
731 Ga0395900_0000006
732 Ga0395900_0055240
733 Ga0395900_0259201
734 Ga0395898_0002009
735 Ga0395898_0184615
736 Ga0395898_0311002
737 Ga0395905_0002813
738 Ga0395905_0019833
739 Ga0395905_0024566
740 Ga0395905_0044207
741 Ga0395905_1079040
742 Ga0436364_1420699
743 Ga0395901_0000001
744 Ga0395901_0013379
745 Ga0395901_0059577
746 Ga0395901_0115692
747 Ga0395901_0577474
748 Ga0436365_0577642
749 Ga0436365_0765158
750 Ga0436365_0840377
751 Ga0436365_1314699
752 Ga0436365_1603232
753 Ga0436360_0392929
754 Ga0436361_1163081
755 Ga0436363_0256590
756 Ga0436362_0097630
757 Ga0451787_110416
758 Ga0451793_0339017
759 Ga0451800_0927983
760 Ga0451804_0076586
761 Ga0439459_0090276
762 Ga0466972_0247324
763 Ga0495590_0200180
764 Ga0495629_0027842
765 Ga0495605_0156933
766 Ga0495583_0020691
767 Ga0495610_0029948
768 Ga0495616_0034380
769 Ga0495628_0740125
770 Ga0495632_0205299
771 Ga0495643_0090358
772 Ga0495652_0951995
773 Ga0495654_0210740
774 Ga0495609_0103544
775 Ga0495621_0152635
776 Ga0495597_0001227
777 Ga0495622_0016461
778 Ga0495668_0025573
779 Ga0495668_0085566
780 Ga0495668_0580430
781 Ga0495611_0064086
782 Ga0495611_0396239
783 Ga0495625_0034519
784 Ga0495625_0100400
785 Ga0495625_0116216
786 Ga0495625_0234474
787 Ga0495625_0661551
788 Ga0495669_0000270
789 Ga0495669_0018957
790 Ga0495649_0353609
791 Ga0495672_0361023
792 Ga0495687_132244
793 Ga0495677_0137144
794 Ga0495685_067709
795 Ga0495686_0214304
796 Ga0496101_0211676
797 Ga0496101_0999762
798 Ga0496102_0086850
799 Ga0496104_0492596
800 Ga0496107_0395976
801 Ga0496115_0061783
802 Ga0496115_1300064
803 Ga0496118_0015437
804 Ga0496119_0021576
805 Ga0496120_0157508
806 Ga0496121_0000130
807 Ga0495682_0327643
808 Ga0501031_0001568
809 Ga0501032_0025928
810 Ga0501032_0689677
811 Ga0501033_0014570
812 Ga0501033_0033403
813 Ga0501033_0075641
814 Ga0501034_0039127
815 Ga0501034_0060440
816 Ga0501034_0103809
817 Ga0501034_0449357
818 Ga0501034_1100010
819 Ga0501036_0028286
820 Ga0501036_0059436
821 Ga0501037_0020311
822 Ga0501037_0672973
823 Ga0501038_0036608
824 Ga0501039_0088985
825 Ga0501040_0554490
826 Ga0501042_0054930
827 Ga0501043_0022056
828 Ga0501043_0083018
829 Ga0501046_0005425
830 Ga0501046_0178158
831 Ga0501047_0005046
832 Ga0501047_0008898
833 Ga0501047_0042905
834 Ga0501047_0051369
835 Ga0501047_0311627
836 Ga0501047_0886880
837 Ga0501047_1161653
838 Ga0501048_0008869
839 Ga0501067_0001812
840 Ga0501067_0114647
841 Ga0501069_0031266
842 Ga0501070_0032549
843 Ga0501070_0038993
844 Ga0501071_1220896
845 Ga0501073_0008917
846 Ga0501073_0060921
847 Ga0501073_0189988
848 Ga0501074_0000651
849 Ga0501076_0363418
850 Ga0501076_0376516
851 Ga0501079_0000470
852 Ga0501083_0002083
853 Ga0501035_0097315
854 Ga0501035_0174450
855 Ga0501035_0229220
856 Ga0501044_0004206
857 Ga0501044_0064424
858 Ga0501044_0097176
859 Ga0501044_0431915
860 Ga0501044_0727315
861 Ga0501044_1236173
862 Ga0501045_0034717
863 nmdc:mga00v17_3947_c1
864 nmdc:mga0k408_25735_c1
865 nmdc:mga06z11_53687_c1
866 nmdc:mga07m45_190_c1
867 nmdc:mga08y16_1802525_c1
868 nmdc:mga0sz30_40377_c1
869 Ga0500635_0000283
870 Ga0500578_0437144
871 Ga0500647_0023825
872 Ga0500583_0079358
873 Ga0500651_0027265
874 Ga0500566_0022856
875 Ga0500566_0453733
876 Ga0500650_0437614
877 Ga0500555_141223
878 Ga0500569_036358
879 Ga0500591_173616
880 Ga0500592_053575
881 Ga0500594_0046964
882 Ga0500595_014987
883 Ga0500595_015625
884 Ga0500597_279038
885 Ga0500607_036232
886 Ga0500608_002286
887 Ga0500614_005148
888 Ga0500614_112051
889 Ga0500642_0076922
890 Ga0500655_011060
891 Ga0500658_0063928
892 Ga0500559_0030323
893 Ga0500559_0047474
894 Ga0500568_0023563
895 Ga0500568_0026265
896 Ga0500573_0000026
897 Ga0500577_0030809
898 Ga0500577_0208720
899 Ga0500588_0170124
900 Ga0500590_029217
901 Ga0500619_022645
902 Ga0500620_188561
903 Ga0500627_0207629
904 Ga0500638_106995
905 Ga0500639_134217
906 Ga0500636_0012926
907 Ga0500636_0013372
908 Ga0500636_0293367
909 Ga0500637_0243630
910 Ga0500637_0261121
911 Ga0500576_154817
912 Ga0500625_059432
913 Ga0500596_002458
914 Ga0500601_032648
915 Ga0501084_0019927
916 Ga0500661_062801
917 Ga0501082_0025837
918 Ga0501082_0037723
919 Ga0466962_0435939
920 Ga0530510_1261368

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02049

FliE

Flagellar hook-basal body complex protein FliE

14

105

0.91

Map