F448487

General Info

Members Datasets Scaffolds Average Seq Length
460 246 920 129

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10367932|Ga0065715_103679322
Length 147
Sequence MAGRGKNAGAAARTPASDTVARETRSGASAGRDVHSGPVATPKRAQARELDRLVHDRTRLAIVSALAANEPLTFTALKAITETTDGNLSVHTRKLEDAGYVSCTKGFEGRTPRTEYALTAAGRKALQKYLDHMEAIISHARKSAGGR

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
92 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
142 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
163 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
176 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
199 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.3
Rhizosphere 98.26
Stem 0
Stem Tuber 0
Unclassified 22.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10367932 3300005293 Bacteria 925
2 JGI24034J14986_100123 3300001432 Unclassified 3555
3 JGI24748J21848_1000035 3300002074 Bacteria 73922
4 JGI24034J26672_10000039 3300002239 Bacteria 73907
5 JGI24742J22300_10018170 3300002244 Unclassified 1191
6 Ga0058861_11505499 3300004800 Bacteria 649
7 Ga0065712_10340644 3300005290 Unclassified 801
8 Ga0065715_10314802 3300005293 Bacteria 1013
9 Ga0065715_10602488 3300005293 Unclassified 707
10 Ga0065707_10935060 3300005295 Unclassified 557
11 Ga0070676_10276248 3300005328 Unclassified 1130
12 Ga0070676_11576743 3300005328 Bacteria 507
13 Ga0070690_100144363 3300005330 Unclassified 1618
14 Ga0070670_100009534 3300005331 Bacteria 8285
15 Ga0070670_100289375 3300005331 Bacteria 1431
16 Ga0070670_100358532 3300005331 Bacteria 1282
17 Ga0070670_101078229 3300005331 Bacteria 732
18 Ga0070670_102138027 3300005331 Unclassified 516
19 Ga0070677_10325006 3300005333 Bacteria 789
20 Ga0070677_10435420 3300005333 Bacteria 698
21 Ga0068869_100904671 3300005334 Bacteria 764
22 Ga0068869_101514344 3300005334 Bacteria 596
23 Ga0070666_10132814 3300005335 Bacteria 1730
24 Ga0070666_10226064 3300005335 Unclassified 1321
25 Ga0070682_101651671 3300005337 Unclassified 555
26 Ga0068868_100779212 3300005338 Bacteria 861
27 Ga0068868_100834081 3300005338 Bacteria 834
28 Ga0070689_100016656 3300005340 Bacteria 5380
29 Ga0070689_100556319 3300005340 Bacteria 989
30 Ga0070691_10638138 3300005341 Bacteria 633
31 Ga0070687_100022801 3300005343 Bacteria 2966
32 Ga0070687_100041191 3300005343 Bacteria 2333
33 Ga0070687_100981517 3300005343 Unclassified 611
34 Ga0070661_100333362 3300005344 Bacteria 1187
35 Ga0070669_100081922 3300005353 Bacteria 2405
36 Ga0070669_100170441 3300005353 Bacteria 1697
37 Ga0070669_100178500 3300005353 Unclassified 1660
38 Ga0070669_100819235 3300005353 Bacteria 792
39 Ga0070675_100004553 3300005354 Bacteria 10584
40 Ga0070675_100045115 3300005354 Bacteria 3606
41 Ga0070675_100122998 3300005354 Bacteria 2206
42 Ga0070675_100189817 3300005354 Bacteria 1780
43 Ga0070671_100402325 3300005355 Unclassified 1171
44 Ga0070671_100446587 3300005355 Bacteria 1109
45 Ga0070674_101728320 3300005356 Unclassified 566
46 Ga0070673_100056437 3300005364 Unclassified 3099
47 Ga0070673_100423004 3300005364 Bacteria 1194
48 Ga0070688_100078973 3300005365 Unclassified 2124
49 Ga0070688_100082221 3300005365 Bacteria 2087
50 Ga0070688_100845075 3300005365 Bacteria 719
51 Ga0070688_100870948 3300005365 Bacteria 709
52 Ga0070659_100524333 3300005366 Bacteria 1012
53 Ga0070667_100338994 3300005367 Bacteria 1359
54 Ga0070667_100399971 3300005367 Unclassified 1250
55 Ga0070667_100616523 3300005367 Bacteria 1000
56 Ga0070701_10098592 3300005438 Bacteria 1614
57 Ga0070701_10195023 3300005438 Bacteria 1194
58 Ga0070700_100719246 3300005441 Unclassified 796
59 Ga0070694_101191677 3300005444 Bacteria 638
60 Ga0070678_100163142 3300005456 Bacteria 1808
61 Ga0070662_100203185 3300005457 Unclassified 1573
62 Ga0070662_101902360 3300005457 Bacteria 514
63 Ga0070662_101915267 3300005457 Bacteria 512
64 Ga0068867_100129445 3300005459 Bacteria 1960
65 Ga0068867_100430796 3300005459 Bacteria 1119
66 Ga0070685_10128650 3300005466 Unclassified 1581
67 Ga0070685_10218045 3300005466 Unclassified 1249
68 Ga0070706_100171781 3300005467 Bacteria 2024
69 Ga0070707_100370938 3300005468 Unclassified 1390
70 Ga0070707_100666772 3300005468 Unclassified 1003
71 Ga0070707_100893388 3300005468 Unclassified 853
72 Ga0070698_100199158 3300005471 Bacteria 1939
73 Ga0070699_100152137 3300005518 Unclassified 2047
74 Ga0070672_100030242 3300005543 Bacteria 4067
75 Ga0070672_100094196 3300005543 Bacteria 2421
76 Ga0070672_100882785 3300005543 Bacteria 789
77 Ga0070686_100855562 3300005544 Bacteria 737
78 Ga0070686_101171433 3300005544 Bacteria 637
79 Ga0070686_101718872 3300005544 Bacteria 533
80 Ga0070695_100025840 3300005545 Bacteria 3628
81 Ga0070696_100014444 3300005546 Bacteria 5296
82 Ga0070696_100346941 3300005546 Bacteria 1149
83 Ga0070664_100025650 3300005564 Unclassified 4888
84 Ga0070664_101408451 3300005564 Bacteria 659
85 Ga0068857_100193956 3300005577 Bacteria 1850
86 Ga0068857_100311915 3300005577 Unclassified 1451
87 Ga0068857_100630484 3300005577 Bacteria 1015
88 Ga0068857_102415415 3300005577 Bacteria 516
89 Ga0068856_101212745 3300005614 Bacteria 771
90 Ga0070702_100248312 3300005615 Bacteria 1205
91 Ga0068859_100038432 3300005617 Bacteria 4802
92 Ga0068859_100131374 3300005617 Unclassified 2576
93 Ga0068859_100254132 3300005617 Bacteria 1848
94 Ga0068859_100284922 3300005617 Unclassified 1745
95 Ga0068859_100403099 3300005617 Bacteria 1464
96 Ga0068859_100926700 3300005617 Bacteria 955
97 Ga0068864_100035735 3300005618 Bacteria 4232
98 Ga0068864_100038079 3300005618 Bacteria 4105
99 Ga0068864_100235163 3300005618 Bacteria 1696
100 Ga0068864_100279946 3300005618 Bacteria 1556
101 Ga0068864_100303814 3300005618 Unclassified 1494
102 Ga0068866_10623765 3300005718 Bacteria 731
103 Ga0068861_100898625 3300005719 Bacteria 839
104 Ga0068861_101419721 3300005719 Bacteria 679
105 Ga0068870_10324280 3300005840 Bacteria 979
106 Ga0068870_10456433 3300005840 Bacteria 843
107 Ga0068863_101789186 3300005841 Bacteria 624
108 Ga0068858_100000053 3300005842 Bacteria 119869
109 Ga0068858_100225440 3300005842 Bacteria 1776
110 Ga0068858_100501886 3300005842 Bacteria 1172
111 Ga0068858_100502671 3300005842 Unclassified 1171
112 Ga0068860_100155959 3300005843 Unclassified 2200
113 Ga0068860_102808951 3300005843 Bacteria 505
114 Ga0068862_100352010 3300005844 Bacteria 1367
115 Ga0068862_100877764 3300005844 Unclassified 880
116 Ga0075432_10151098 3300006058 Unclassified 892
117 Ga0070712_101689623 3300006175 Bacteria 554
118 Ga0097621_100667052 3300006237 Bacteria 955
119 Ga0097621_101289228 3300006237 Bacteria 690
120 Ga0068871_101579803 3300006358 Unclassified 621
121 Ga0075428_100038448 3300006844 Bacteria 5266
122 Ga0075428_100074133 3300006844 Bacteria 3718
123 Ga0075428_101414029 3300006844 Bacteria 730
124 Ga0075430_100008965 3300006846 Bacteria 8451
125 Ga0075430_100068844 3300006846 Bacteria 2970
126 Ga0075430_100286726 3300006846 Bacteria 1362
127 Ga0075431_100015548 3300006847 Bacteria 7712
128 Ga0075431_100019876 3300006847 Bacteria 6857
129 Ga0075431_100070933 3300006847 Bacteria 3594
130 Ga0075433_10010761 3300006852 Bacteria 7357
131 Ga0075433_11205991 3300006852 Bacteria 657
132 Ga0075434_100024619 3300006871 Bacteria 5886
133 Ga0075434_100206535 3300006871 Unclassified 1984
134 Ga0075429_100004449 3300006880 Bacteria 12050
135 Ga0075429_100038741 3300006880 Bacteria 4150
136 Ga0075429_100185523 3300006880 Unclassified 1823
137 Ga0075429_100546265 3300006880 Unclassified 1015
138 Ga0068865_100285565 3300006881 Bacteria 1315
139 Ga0097620_100038434 3300006931 Bacteria 4802
140 Ga0097620_100131369 3300006931 Unclassified 2576
141 Ga0097620_100254135 3300006931 Bacteria 1848
142 Ga0097620_100284901 3300006931 Unclassified 1745
143 Ga0097620_100403105 3300006931 Bacteria 1464
144 Ga0097620_100926535 3300006931 Bacteria 955
145 Ga0075435_100232907 3300007076 Bacteria 1565
146 Ga0105240_11024786 3300009093 Unclassified 882
147 Ga0111539_10001367 3300009094 Bacteria 32489
148 Ga0111539_10001507 3300009094 Bacteria 31120
149 Ga0111539_10003937 3300009094 Bacteria 19525
150 Ga0111539_10005198 3300009094 Bacteria 16863
151 Ga0111539_10014950 3300009094 Bacteria 9676
152 Ga0111539_10261176 3300009094 Bacteria 2016
153 Ga0105245_10040179 3300009098 Unclassified 4166
154 Ga0105245_12732317 3300009098 Bacteria 547
155 Ga0105247_10000052 3300009101 Bacteria 141465
156 Ga0114129_10023721 3300009147 Bacteria 8697
157 Ga0114129_10064061 3300009147 Bacteria 5130
158 Ga0114129_10092457 3300009147 Bacteria 4191
159 Ga0105243_10000214 3300009148 Bacteria 67405
160 Ga0105243_10149312 3300009148 Bacteria 2003
161 Ga0105243_10202588 3300009148 Bacteria 1741
162 Ga0105243_12511325 3300009148 Unclassified 554
163 Ga0105241_10110800 3300009174 Bacteria 2196
164 Ga0105242_10000811 3300009176 Bacteria 24253
165 Ga0105242_11254571 3300009176 Bacteria 763
166 Ga0105248_10024264 3300009177 Bacteria 6743
167 Ga0105248_10276003 3300009177 Bacteria 1892
168 Ga0105238_10191405 3300009551 Bacteria 2022
169 Ga0105238_10193851 3300009551 Bacteria 2007
170 Ga0105249_10169334 3300009553 Bacteria 2117
171 Ga0105249_10170956 3300009553 Unclassified 2107
172 Ga0105249_11247204 3300009553 Unclassified 815
173 Ga0105239_11445612 3300010375 Bacteria 794
174 Ga0105246_10263597 3300011119 Bacteria 1374
175 Ga0105246_10313432 3300011119 Unclassified 1272
176 Ga0157374_10371637 3300013296 Unclassified 1423
177 Ga0157378_10000026 3300013297 Bacteria 128499
178 Ga0157378_10289020 3300013297 Bacteria 1583
179 Ga0163162_10199042 3300013306 Bacteria 2132
180 Ga0163162_10413838 3300013306 Bacteria 1480
181 Ga0157375_10013286 3300013308 Bacteria 7324
182 Ga0157375_10427107 3300013308 Bacteria 1491
183 Ga0157375_10646830 3300013308 Bacteria 1214
184 Ga0157375_12930248 3300013308 Unclassified 570
185 Ga0163163_11221252 3300014325 Unclassified 814
186 Ga0157380_10464878 3300014326 Bacteria 1219
187 Ga0157380_10527832 3300014326 Bacteria 1153
188 Ga0157380_11378844 3300014326 Bacteria 755
189 Ga0157379_10088697 3300014968 Unclassified 2774
190 Ga0157376_10590749 3300014969 Unclassified 1104
191 Ga0157376_10883202 3300014969 Bacteria 911
192 Ga0213874_10373763 3300021377 Unclassified 550
193 Ga0207672_1000342 3300025223 Bacteria 6176
194 Ga0207682_10199361 3300025893 Bacteria 920
195 Ga0207642_10860319 3300025899 Bacteria 579
196 Ga0207710_10000004 3300025900 Bacteria 846540
197 Ga0207688_10082768 3300025901 Unclassified 1835
198 Ga0207680_10055673 3300025903 Bacteria 2385
199 Ga0207645_10317271 3300025907 Unclassified 1039
200 Ga0207645_11090424 3300025907 Unclassified 539
201 Ga0207643_10519122 3300025908 Bacteria 763
202 Ga0207705_10538871 3300025909 Bacteria 907
203 Ga0207684_10029101 3300025910 Bacteria 4706
204 Ga0207684_11148681 3300025910 Bacteria 645
205 Ga0207660_10364104 3300025917 Bacteria 1160
206 Ga0207662_10008587 3300025918 Bacteria 5600
207 Ga0207662_10604878 3300025918 Unclassified 763
208 Ga0207662_11157603 3300025918 Unclassified 550
209 Ga0207657_10995432 3300025919 Unclassified 643
210 Ga0207649_10316066 3300025920 Bacteria 1146
211 Ga0207646_10733015 3300025922 Unclassified 883
212 Ga0207646_11135563 3300025922 Bacteria 687
213 Ga0207646_11246300 3300025922 Bacteria 651
214 Ga0207681_10155158 3300025923 Bacteria 1720
215 Ga0207681_10243190 3300025923 Unclassified 1402
216 Ga0207681_10818303 3300025923 Bacteria 778
217 Ga0207681_11021887 3300025923 Bacteria 694
218 Ga0207694_10395062 3300025924 Bacteria 1149
219 Ga0207650_10746809 3300025925 Bacteria 828
220 Ga0207650_10982491 3300025925 Bacteria 718
221 Ga0207650_11374509 3300025925 Unclassified 601
222 Ga0207659_10007048 3300025926 Bacteria 6898
223 Ga0207659_10037023 3300025926 Bacteria 3385
224 Ga0207659_10037803 3300025926 Bacteria 3354
225 Ga0207659_10047754 3300025926 Bacteria 3030
226 Ga0207659_10088665 3300025926 Bacteria 2305
227 Ga0207659_10172437 3300025926 Bacteria 1707
228 Ga0207644_10563303 3300025931 Unclassified 944
229 Ga0207690_10296501 3300025932 Unclassified 1264
230 Ga0207706_10082696 3300025933 Bacteria 2822
231 Ga0207706_10151824 3300025933 Unclassified 2037
232 Ga0207706_10189331 3300025933 Bacteria 1806
233 Ga0207706_10330835 3300025933 Bacteria 1325
234 Ga0207686_10003568 3300025934 Bacteria 8348
235 Ga0207686_10092993 3300025934 Bacteria 1996
236 Ga0207686_10763178 3300025934 Bacteria 773
237 Ga0207709_10000590 3300025935 Bacteria 30350
238 Ga0207709_10104259 3300025935 Bacteria 1881
239 Ga0207670_10039041 3300025936 Unclassified 3106
240 Ga0207670_10064636 3300025936 Bacteria 2508
241 Ga0207670_10813387 3300025936 Unclassified 779
242 Ga0207704_10273620 3300025938 Bacteria 1280
243 Ga0207704_10499809 3300025938 Bacteria 980
244 Ga0207704_10729318 3300025938 Bacteria 823
245 Ga0207704_10857461 3300025938 Bacteria 762
246 Ga0207691_10003135 3300025940 Bacteria 16151
247 Ga0207691_10054118 3300025940 Bacteria 3661
248 Ga0207691_10058064 3300025940 Bacteria 3520
249 Ga0207691_10098663 3300025940 Bacteria 2609
250 Ga0207691_10792440 3300025940 Bacteria 797
251 Ga0207711_10395912 3300025941 Bacteria 1283
252 Ga0207689_10006436 3300025942 Bacteria 10385
253 Ga0207651_10030101 3300025960 Bacteria 3451
254 Ga0207651_10050375 3300025960 Bacteria 2827
255 Ga0207651_10168716 3300025960 Bacteria 1724
256 Ga0207651_11113280 3300025960 Bacteria 708
257 Ga0207712_10217333 3300025961 Unclassified 1526
258 Ga0207640_11266726 3300025981 Bacteria 657
259 Ga0207658_10526092 3300025986 Bacteria 1056
260 Ga0207658_10902245 3300025986 Bacteria 805
261 Ga0207677_10043304 3300026023 Bacteria 2992
262 Ga0207677_10713451 3300026023 Bacteria 891
263 Ga0207703_10000093 3300026035 Bacteria 104313
264 Ga0207703_10363483 3300026035 Bacteria 1335
265 Ga0207703_11429154 3300026035 Unclassified 665
266 Ga0207708_10253524 3300026075 Unclassified 1419
267 Ga0207708_10282571 3300026075 Bacteria 1345
268 Ga0207708_10324812 3300026075 Bacteria 1257
269 Ga0207702_11134762 3300026078 Bacteria 776
270 Ga0207641_10670398 3300026088 Bacteria 1020
271 Ga0207641_11606202 3300026088 Bacteria 652
272 Ga0207648_10416273 3300026089 Bacteria 1220
273 Ga0207648_10514432 3300026089 Bacteria 1096
274 Ga0207648_10955622 3300026089 Bacteria 802
275 Ga0207676_10128447 3300026095 Bacteria 2151
276 Ga0207676_10145301 3300026095 Bacteria 2036
277 Ga0207674_11873882 3300026116 Bacteria 566
278 Ga0207675_100051118 3300026118 Unclassified 3856
279 Ga0207675_100183514 3300026118 Unclassified 2005
280 Ga0207683_10439749 3300026121 Bacteria 1202
281 Ga0207683_10984806 3300026121 Bacteria 783
282 Ga0207698_12066005 3300026142 Unclassified 584
283 Ga0209998_10003502 3300027717 Bacteria 3427
284 Ga0209998_10093983 3300027717 Bacteria 737
285 Ga0209974_10048883 3300027876 Unclassified 1418
286 Ga0207428_10002423 3300027907 Bacteria 18613
287 Ga0207428_10011298 3300027907 Bacteria 7908
288 Ga0207428_10015465 3300027907 Bacteria 6601
289 Ga0207428_10048165 3300027907 Bacteria 3420
290 Ga0207428_10184966 3300027907 Bacteria 1572
291 Ga0207428_10206212 3300027907 Bacteria 1478
292 Ga0207428_10262828 3300027907 Bacteria 1285
293 Ga0207428_11206919 3300027907 Bacteria 526
294 Ga0268265_10185887 3300028380 Bacteria 1790
295 Ga0268265_10333057 3300028380 Bacteria 1379
296 Ga0268265_10543169 3300028380 Unclassified 1102
297 Ga0268265_10589474 3300028380 Bacteria 1061
298 Ga0268265_10694884 3300028380 Bacteria 982
299 Ga0268264_10460926 3300028381 Unclassified 1233
300 Ga0268264_11320593 3300028381 Unclassified 731
301 Ga0268264_11845439 3300028381 Bacteria 614
302 Ga0268264_11980734 3300028381 Unclassified 592
303 Ga0265328_10404594 3300031239 Unclassified 536
304 Ga0265320_10068758 3300031240 Bacteria 1673
305 Ga0265325_10004690 3300031241 Bacteria 8572
306 Ga0265331_10041431 3300031250 Bacteria 2238
307 Ga0265331_10436059 3300031250 Unclassified 588
308 Ga0265316_10240945 3300031344 Bacteria 1330
309 Ga0307408_100023278 3300031548 Bacteria 4217
310 Ga0307408_101599087 3300031548 Bacteria 619
311 Ga0265313_10194686 3300031595 Bacteria 846
312 Ga0265314_10005619 3300031711 Bacteria 11261
313 Ga0307405_10069000 3300031731 Bacteria 2265
314 Ga0307405_10124096 3300031731 Unclassified 1772
315 Ga0307410_10114557 3300031852 Bacteria 1956
316 Ga0307406_10206138 3300031901 Bacteria 1451
317 Ga0307407_10005672 3300031903 Bacteria 5448
318 Ga0307412_10020349 3300031911 Bacteria 4037
319 Ga0307412_10839485 3300031911 Bacteria 801
320 Ga0307416_100036452 3300032002 Bacteria 3772
321 Ga0307416_100148508 3300032002 Unclassified 2145
322 Ga0307416_100285609 3300032002 Bacteria 1630
323 Ga0307416_102183904 3300032002 Bacteria 655
324 Ga0307414_10042160 3300032004 Bacteria 3099
325 Ga0307411_10023228 3300032005 Bacteria 3669
326 Ga0307411_10162842 3300032005 Unclassified 1673
327 Ga0307411_11156524 3300032005 Unclassified 700
328 Ga0307415_100100468 3300032126 Bacteria 2120
329 Ga0307415_100169831 3300032126 Unclassified 1699
330 Ga0307415_100325874 3300032126 Bacteria 1283
331 Ga0373961_0148958 3300035241 Unclassified 796
332 Ga0373931_0168145 3300035691 Bacteria 1290
333 Ga0373937_0333942 3300036401 Bacteria 1435
334 Ga0436363_0494152 3300039450 Unclassified 551
335 Ga0439453_0026066 3300041408 Bacteria 1082
336 Ga0439435_0009794 3300042436 Bacteria 2257
337 Ga0451577_0895811 3300042876 Unclassified 799
338 Ga0453684_0343518 3300044712 Bacteria 1685
339 Ga0451576_0040232 3300045051 Bacteria 4949
340 Ga0451576_0496714 3300045051 Unclassified 1282
341 Ga0495629_0000200 3300046459 Bacteria 53129
342 Ga0495582_0048517 3300046473 Bacteria 2338
343 Ga0495582_0090836 3300046473 Unclassified 1703
344 Ga0495639_0093779 3300046475 Bacteria 1411
345 Ga0495662_0182068 3300046476 Bacteria 1035
346 Ga0495594_0016099 3300046499 Bacteria 3935
347 Ga0495594_0118114 3300046499 Bacteria 1498
348 Ga0495594_0251008 3300046499 Bacteria 1008
349 Ga0495644_0152976 3300046523 Bacteria 883
350 Ga0495665_0024207 3300046531 Unclassified 3262
351 Ga0495586_0058500 3300046535 Unclassified 2093
352 Ga0495598_0017961 3300046537 Bacteria 1831
353 Ga0495621_0026122 3300046539 Bacteria 1967
354 Ga0495667_0297355 3300046559 Bacteria 1023
355 Ga0495656_0040280 3300046615 Bacteria 1946
356 Ga0495635_0056075 3300046663 Unclassified 2714
357 Ga0495657_0728852 3300046675 Bacteria 569
358 Ga0495657_0754989 3300046675 Bacteria 557
359 Ga0495647_0012952 3300046681 Bacteria 2880
360 Ga0495647_0490254 3300046681 Unclassified 571
361 Ga0495658_0000206 3300046683 Bacteria 34059
362 Ga0495669_0105101 3300046684 Unclassified 1314
363 Ga0495613_0043500 3300046689 Bacteria 3323
364 Ga0495600_0612222 3300046809 Bacteria 661
365 Ga0495581_0001500 3300047315 Bacteria 12993
366 Ga0495581_0104106 3300047315 Unclassified 1649
367 Ga0495636_0034908 3300047318 Unclassified 2071
368 Ga0495676_0875145 3300047321 Unclassified 576
369 Ga0495680_0001895 3300047322 Bacteria 21961
370 Ga0495675_0243435 3300047444 Bacteria 1082
371 Ga0495614_0013889 3300048089 Bacteria 3529
372 Ga0496104_0288933 3300048907 Bacteria 1552
373 Ga0496106_0018159 3300048909 Bacteria 5202
374 Ga0496108_1469678 3300048911 Unclassified 568
375 Ga0496110_0414020 3300048913 Bacteria 1229
376 Ga0496112_0228008 3300048915 Bacteria 1818
377 Ga0496113_0740043 3300048916 Unclassified 783
378 Ga0501291_092701 3300049514 Bacteria 619
379 Ga0501299_067599 3300049522 Bacteria 769
380 Ga0501031_0007996 3300049568 Bacteria 6885
381 Ga0501032_0014324 3300049569 Bacteria 5616
382 Ga0501033_0028666 3300049570 Bacteria 4182
383 Ga0501034_0013157 3300049571 Bacteria 8524
384 Ga0501036_0001986 3300049572 Bacteria 15874
385 Ga0501036_0024243 3300049572 Bacteria 5114
386 Ga0501037_0003330 3300049573 Bacteria 11680
387 Ga0501038_0016114 3300049574 Bacteria 6783
388 Ga0501039_0038287 3300049575 Bacteria 3704
389 Ga0501039_0155336 3300049575 Bacteria 1797
390 Ga0501040_0025671 3300049576 Bacteria 3963
391 Ga0501040_0114725 3300049576 Bacteria 1886
392 Ga0501040_0954291 3300049576 Bacteria 621
393 Ga0501041_0046418 3300049577 Bacteria 2642
394 Ga0501042_0063080 3300049578 Bacteria 2648
395 Ga0501043_0010006 3300049579 Bacteria 7438
396 Ga0501046_0016613 3300049580 Bacteria 6159
397 Ga0501046_0191811 3300049580 Bacteria 1524
398 Ga0501047_0033190 3300049581 Bacteria 4982
399 Ga0501047_0052435 3300049581 Bacteria 3943
400 Ga0501067_0013840 3300049583 Bacteria 4467
401 Ga0501068_0000167 3300049584 Bacteria 30701
402 Ga0501069_0002433 3300049585 Bacteria 9482
403 Ga0501070_0017926 3300049586 Bacteria 5944
404 Ga0501071_0302152 3300049587 Bacteria 1213
405 Ga0501072_0001309 3300049588 Bacteria 18642
406 Ga0501072_0265707 3300049588 Bacteria 1365
407 Ga0501073_0019789 3300049589 Bacteria 4857
408 Ga0501074_0007765 3300049590 Bacteria 7765
409 Ga0501074_0153046 3300049590 Bacteria 1648
410 Ga0501075_0004771 3300049591 Bacteria 9217
411 Ga0501075_0366599 3300049591 Bacteria 1098
412 Ga0501076_0024939 3300049592 Bacteria 4626
413 Ga0501076_0149299 3300049592 Bacteria 1901
414 Ga0501077_0013263 3300049593 Bacteria 5165
415 Ga0501259_028799 3300049688 Bacteria 1036
416 Ga0501079_0002565 3300049741 Bacteria 13196
417 Ga0501079_0014294 3300049741 Bacteria 6053
418 Ga0501080_0001974 3300049742 Bacteria 17699
419 Ga0501080_0357807 3300049742 Bacteria 1317
420 Ga0501081_0008774 3300049743 Bacteria 6571
421 Ga0501083_0015163 3300049744 Bacteria 5395
422 Ga0501083_0347189 3300049744 Bacteria 965
423 Ga0501035_0071536 3300049822 Bacteria 3070
424 Ga0501035_0201455 3300049822 Bacteria 1707
425 Ga0501044_0052851 3300049823 Bacteria 4182
426 Ga0501045_0025400 3300049824 Unclassified 4259
427 nmdc:mga05p37_1083396_c1 3300050507 Bacteria 841
428 nmdc:mga05p37_20608_c1 3300050507 Bacteria 7977
429 nmdc:mga05p37_68468_c1 3300050507 Bacteria 4365
430 nmdc:mga09592_20416_c1 3300050508 Bacteria 5447
431 nmdc:mga09592_356879_c1 3300050508 Unclassified 1265
432 nmdc:mga09592_57805_c1 3300050508 Bacteria 3279
433 nmdc:mga0qj67_1378477_c1 3300050509 Bacteria 545
434 nmdc:mga0qj67_24792_c1 3300050509 Bacteria 4628
435 nmdc:mga0qj67_61777_c1 3300050509 Bacteria 2975
436 nmdc:mga0qj67_9704_c1 3300050509 Bacteria 7170
437 nmdc:mga06r32_278547_c1 3300050510 Bacteria 1660
438 nmdc:mga06r32_33709_c1 3300050510 Bacteria 4824
439 nmdc:mga08y16_10366_c1 3300050511 Bacteria 9779
440 nmdc:mga08y16_131692_c1 3300050511 Bacteria 2600
441 nmdc:mga08y16_137330_c1 3300050511 Unclassified 2542
442 nmdc:mga08y16_38404_c1 3300050511 Bacteria 5028
443 nmdc:mga08y16_4202_c1 3300050511 Bacteria 15033
444 nmdc:mga08y16_68289_c1 3300050511 Bacteria 3706
445 nmdc:mga0n895_139305_c1 3300050512 Bacteria 2454
446 nmdc:mga0n895_2022_c1 3300050512 Bacteria 15597
447 nmdc:mga0rr50_1203727_c1 3300050513 Bacteria 643
448 nmdc:mga0rr50_1763128_c1 3300050513 Bacteria 521
449 nmdc:mga0rr50_328016_c1 3300050513 Bacteria 1284
450 nmdc:mga0a205_1001490_c1 3300050515 Bacteria 683
451 Ga0495655_0005461 3300053083 Bacteria 2246
452 Ga0495619_0013643 3300053085 Bacteria 5121
453 Ga0495619_0048630 3300053085 Unclassified 2795
454 Ga0501084_0000382 3300054114 Bacteria 33987
455 Ga0501084_0118923 3300054114 Bacteria 2221
456 Ga0590077_080395 3300059426 Bacteria 750
457 Ga0501082_0008115 3300060353 Bacteria 9060
458 Ga0501082_0413486 3300060353 Bacteria 1178
459 Ga0501082_1397886 3300060353 Bacteria 611
460 Ga0530510_1144718 3300061734 Bacteria 596
461 Ga0065715_10367932
462 JGI24034J14986_100123
463 JGI24748J21848_1000035
464 JGI24034J26672_10000039
465 JGI24742J22300_10018170
466 Ga0058861_11505499
467 Ga0065712_10340644
468 Ga0065715_10314802
469 Ga0065715_10602488
470 Ga0065707_10935060
471 Ga0070676_10276248
472 Ga0070676_11576743
473 Ga0070690_100144363
474 Ga0070670_100009534
475 Ga0070670_100289375
476 Ga0070670_100358532
477 Ga0070670_101078229
478 Ga0070670_102138027
479 Ga0070677_10325006
480 Ga0070677_10435420
481 Ga0068869_100904671
482 Ga0068869_101514344
483 Ga0070666_10132814
484 Ga0070666_10226064
485 Ga0070682_101651671
486 Ga0068868_100779212
487 Ga0068868_100834081
488 Ga0070689_100016656
489 Ga0070689_100556319
490 Ga0070691_10638138
491 Ga0070687_100022801
492 Ga0070687_100041191
493 Ga0070687_100981517
494 Ga0070661_100333362
495 Ga0070669_100081922
496 Ga0070669_100170441
497 Ga0070669_100178500
498 Ga0070669_100819235
499 Ga0070675_100004553
500 Ga0070675_100045115
501 Ga0070675_100122998
502 Ga0070675_100189817
503 Ga0070671_100402325
504 Ga0070671_100446587
505 Ga0070674_101728320
506 Ga0070673_100056437
507 Ga0070673_100423004
508 Ga0070688_100078973
509 Ga0070688_100082221
510 Ga0070688_100845075
511 Ga0070688_100870948
512 Ga0070659_100524333
513 Ga0070667_100338994
514 Ga0070667_100399971
515 Ga0070667_100616523
516 Ga0070701_10098592
517 Ga0070701_10195023
518 Ga0070700_100719246
519 Ga0070694_101191677
520 Ga0070678_100163142
521 Ga0070662_100203185
522 Ga0070662_101902360
523 Ga0070662_101915267
524 Ga0068867_100129445
525 Ga0068867_100430796
526 Ga0070685_10128650
527 Ga0070685_10218045
528 Ga0070706_100171781
529 Ga0070707_100370938
530 Ga0070707_100666772
531 Ga0070707_100893388
532 Ga0070698_100199158
533 Ga0070699_100152137
534 Ga0070672_100030242
535 Ga0070672_100094196
536 Ga0070672_100882785
537 Ga0070686_100855562
538 Ga0070686_101171433
539 Ga0070686_101718872
540 Ga0070695_100025840
541 Ga0070696_100014444
542 Ga0070696_100346941
543 Ga0070664_100025650
544 Ga0070664_101408451
545 Ga0068857_100193956
546 Ga0068857_100311915
547 Ga0068857_100630484
548 Ga0068857_102415415
549 Ga0068856_101212745
550 Ga0070702_100248312
551 Ga0068859_100038432
552 Ga0068859_100131374
553 Ga0068859_100254132
554 Ga0068859_100284922
555 Ga0068859_100403099
556 Ga0068859_100926700
557 Ga0068864_100035735
558 Ga0068864_100038079
559 Ga0068864_100235163
560 Ga0068864_100279946
561 Ga0068864_100303814
562 Ga0068866_10623765
563 Ga0068861_100898625
564 Ga0068861_101419721
565 Ga0068870_10324280
566 Ga0068870_10456433
567 Ga0068863_101789186
568 Ga0068858_100000053
569 Ga0068858_100225440
570 Ga0068858_100501886
571 Ga0068858_100502671
572 Ga0068860_100155959
573 Ga0068860_102808951
574 Ga0068862_100352010
575 Ga0068862_100877764
576 Ga0075432_10151098
577 Ga0070712_101689623
578 Ga0097621_100667052
579 Ga0097621_101289228
580 Ga0068871_101579803
581 Ga0075428_100038448
582 Ga0075428_100074133
583 Ga0075428_101414029
584 Ga0075430_100008965
585 Ga0075430_100068844
586 Ga0075430_100286726
587 Ga0075431_100015548
588 Ga0075431_100019876
589 Ga0075431_100070933
590 Ga0075433_10010761
591 Ga0075433_11205991
592 Ga0075434_100024619
593 Ga0075434_100206535
594 Ga0075429_100004449
595 Ga0075429_100038741
596 Ga0075429_100185523
597 Ga0075429_100546265
598 Ga0068865_100285565
599 Ga0097620_100038434
600 Ga0097620_100131369
601 Ga0097620_100254135
602 Ga0097620_100284901
603 Ga0097620_100403105
604 Ga0097620_100926535
605 Ga0075435_100232907
606 Ga0105240_11024786
607 Ga0111539_10001367
608 Ga0111539_10001507
609 Ga0111539_10003937
610 Ga0111539_10005198
611 Ga0111539_10014950
612 Ga0111539_10261176
613 Ga0105245_10040179
614 Ga0105245_12732317
615 Ga0105247_10000052
616 Ga0114129_10023721
617 Ga0114129_10064061
618 Ga0114129_10092457
619 Ga0105243_10000214
620 Ga0105243_10149312
621 Ga0105243_10202588
622 Ga0105243_12511325
623 Ga0105241_10110800
624 Ga0105242_10000811
625 Ga0105242_11254571
626 Ga0105248_10024264
627 Ga0105248_10276003
628 Ga0105238_10191405
629 Ga0105238_10193851
630 Ga0105249_10169334
631 Ga0105249_10170956
632 Ga0105249_11247204
633 Ga0105239_11445612
634 Ga0105246_10263597
635 Ga0105246_10313432
636 Ga0157374_10371637
637 Ga0157378_10000026
638 Ga0157378_10289020
639 Ga0163162_10199042
640 Ga0163162_10413838
641 Ga0157375_10013286
642 Ga0157375_10427107
643 Ga0157375_10646830
644 Ga0157375_12930248
645 Ga0163163_11221252
646 Ga0157380_10464878
647 Ga0157380_10527832
648 Ga0157380_11378844
649 Ga0157379_10088697
650 Ga0157376_10590749
651 Ga0157376_10883202
652 Ga0213874_10373763
653 Ga0207672_1000342
654 Ga0207682_10199361
655 Ga0207642_10860319
656 Ga0207710_10000004
657 Ga0207688_10082768
658 Ga0207680_10055673
659 Ga0207645_10317271
660 Ga0207645_11090424
661 Ga0207643_10519122
662 Ga0207705_10538871
663 Ga0207684_10029101
664 Ga0207684_11148681
665 Ga0207660_10364104
666 Ga0207662_10008587
667 Ga0207662_10604878
668 Ga0207662_11157603
669 Ga0207657_10995432
670 Ga0207649_10316066
671 Ga0207646_10733015
672 Ga0207646_11135563
673 Ga0207646_11246300
674 Ga0207681_10155158
675 Ga0207681_10243190
676 Ga0207681_10818303
677 Ga0207681_11021887
678 Ga0207694_10395062
679 Ga0207650_10746809
680 Ga0207650_10982491
681 Ga0207650_11374509
682 Ga0207659_10007048
683 Ga0207659_10037023
684 Ga0207659_10037803
685 Ga0207659_10047754
686 Ga0207659_10088665
687 Ga0207659_10172437
688 Ga0207644_10563303
689 Ga0207690_10296501
690 Ga0207706_10082696
691 Ga0207706_10151824
692 Ga0207706_10189331
693 Ga0207706_10330835
694 Ga0207686_10003568
695 Ga0207686_10092993
696 Ga0207686_10763178
697 Ga0207709_10000590
698 Ga0207709_10104259
699 Ga0207670_10039041
700 Ga0207670_10064636
701 Ga0207670_10813387
702 Ga0207704_10273620
703 Ga0207704_10499809
704 Ga0207704_10729318
705 Ga0207704_10857461
706 Ga0207691_10003135
707 Ga0207691_10054118
708 Ga0207691_10058064
709 Ga0207691_10098663
710 Ga0207691_10792440
711 Ga0207711_10395912
712 Ga0207689_10006436
713 Ga0207651_10030101
714 Ga0207651_10050375
715 Ga0207651_10168716
716 Ga0207651_11113280
717 Ga0207712_10217333
718 Ga0207640_11266726
719 Ga0207658_10526092
720 Ga0207658_10902245
721 Ga0207677_10043304
722 Ga0207677_10713451
723 Ga0207703_10000093
724 Ga0207703_10363483
725 Ga0207703_11429154
726 Ga0207708_10253524
727 Ga0207708_10282571
728 Ga0207708_10324812
729 Ga0207702_11134762
730 Ga0207641_10670398
731 Ga0207641_11606202
732 Ga0207648_10416273
733 Ga0207648_10514432
734 Ga0207648_10955622
735 Ga0207676_10128447
736 Ga0207676_10145301
737 Ga0207674_11873882
738 Ga0207675_100051118
739 Ga0207675_100183514
740 Ga0207683_10439749
741 Ga0207683_10984806
742 Ga0207698_12066005
743 Ga0209998_10003502
744 Ga0209998_10093983
745 Ga0209974_10048883
746 Ga0207428_10002423
747 Ga0207428_10011298
748 Ga0207428_10015465
749 Ga0207428_10048165
750 Ga0207428_10184966
751 Ga0207428_10206212
752 Ga0207428_10262828
753 Ga0207428_11206919
754 Ga0268265_10185887
755 Ga0268265_10333057
756 Ga0268265_10543169
757 Ga0268265_10589474
758 Ga0268265_10694884
759 Ga0268264_10460926
760 Ga0268264_11320593
761 Ga0268264_11845439
762 Ga0268264_11980734
763 Ga0265328_10404594
764 Ga0265320_10068758
765 Ga0265325_10004690
766 Ga0265331_10041431
767 Ga0265331_10436059
768 Ga0265316_10240945
769 Ga0307408_100023278
770 Ga0307408_101599087
771 Ga0265313_10194686
772 Ga0265314_10005619
773 Ga0307405_10069000
774 Ga0307405_10124096
775 Ga0307410_10114557
776 Ga0307406_10206138
777 Ga0307407_10005672
778 Ga0307412_10020349
779 Ga0307412_10839485
780 Ga0307416_100036452
781 Ga0307416_100148508
782 Ga0307416_100285609
783 Ga0307416_102183904
784 Ga0307414_10042160
785 Ga0307411_10023228
786 Ga0307411_10162842
787 Ga0307411_11156524
788 Ga0307415_100100468
789 Ga0307415_100169831
790 Ga0307415_100325874
791 Ga0373961_0148958
792 Ga0373931_0168145
793 Ga0373937_0333942
794 Ga0436363_0494152
795 Ga0439453_0026066
796 Ga0439435_0009794
797 Ga0451577_0895811
798 Ga0453684_0343518
799 Ga0451576_0040232
800 Ga0451576_0496714
801 Ga0495629_0000200
802 Ga0495582_0048517
803 Ga0495582_0090836
804 Ga0495639_0093779
805 Ga0495662_0182068
806 Ga0495594_0016099
807 Ga0495594_0118114
808 Ga0495594_0251008
809 Ga0495644_0152976
810 Ga0495665_0024207
811 Ga0495586_0058500
812 Ga0495598_0017961
813 Ga0495621_0026122
814 Ga0495667_0297355
815 Ga0495656_0040280
816 Ga0495635_0056075
817 Ga0495657_0728852
818 Ga0495657_0754989
819 Ga0495647_0012952
820 Ga0495647_0490254
821 Ga0495658_0000206
822 Ga0495669_0105101
823 Ga0495613_0043500
824 Ga0495600_0612222
825 Ga0495581_0001500
826 Ga0495581_0104106
827 Ga0495636_0034908
828 Ga0495676_0875145
829 Ga0495680_0001895
830 Ga0495675_0243435
831 Ga0495614_0013889
832 Ga0496104_0288933
833 Ga0496106_0018159
834 Ga0496108_1469678
835 Ga0496110_0414020
836 Ga0496112_0228008
837 Ga0496113_0740043
838 Ga0501291_092701
839 Ga0501299_067599
840 Ga0501031_0007996
841 Ga0501032_0014324
842 Ga0501033_0028666
843 Ga0501034_0013157
844 Ga0501036_0001986
845 Ga0501036_0024243
846 Ga0501037_0003330
847 Ga0501038_0016114
848 Ga0501039_0038287
849 Ga0501039_0155336
850 Ga0501040_0025671
851 Ga0501040_0114725
852 Ga0501040_0954291
853 Ga0501041_0046418
854 Ga0501042_0063080
855 Ga0501043_0010006
856 Ga0501046_0016613
857 Ga0501046_0191811
858 Ga0501047_0033190
859 Ga0501047_0052435
860 Ga0501067_0013840
861 Ga0501068_0000167
862 Ga0501069_0002433
863 Ga0501070_0017926
864 Ga0501071_0302152
865 Ga0501072_0001309
866 Ga0501072_0265707
867 Ga0501073_0019789
868 Ga0501074_0007765
869 Ga0501074_0153046
870 Ga0501075_0004771
871 Ga0501075_0366599
872 Ga0501076_0024939
873 Ga0501076_0149299
874 Ga0501077_0013263
875 Ga0501259_028799
876 Ga0501079_0002565
877 Ga0501079_0014294
878 Ga0501080_0001974
879 Ga0501080_0357807
880 Ga0501081_0008774
881 Ga0501083_0015163
882 Ga0501083_0347189
883 Ga0501035_0071536
884 Ga0501035_0201455
885 Ga0501044_0052851
886 Ga0501045_0025400
887 nmdc:mga05p37_1083396_c1
888 nmdc:mga05p37_20608_c1
889 nmdc:mga05p37_68468_c1
890 nmdc:mga09592_20416_c1
891 nmdc:mga09592_356879_c1
892 nmdc:mga09592_57805_c1
893 nmdc:mga0qj67_1378477_c1
894 nmdc:mga0qj67_24792_c1
895 nmdc:mga0qj67_61777_c1
896 nmdc:mga0qj67_9704_c1
897 nmdc:mga06r32_278547_c1
898 nmdc:mga06r32_33709_c1
899 nmdc:mga08y16_10366_c1
900 nmdc:mga08y16_131692_c1
901 nmdc:mga08y16_137330_c1
902 nmdc:mga08y16_38404_c1
903 nmdc:mga08y16_4202_c1
904 nmdc:mga08y16_68289_c1
905 nmdc:mga0n895_139305_c1
906 nmdc:mga0n895_2022_c1
907 nmdc:mga0rr50_1203727_c1
908 nmdc:mga0rr50_1763128_c1
909 nmdc:mga0rr50_328016_c1
910 nmdc:mga0a205_1001490_c1
911 Ga0495655_0005461
912 Ga0495619_0013643
913 Ga0495619_0048630
914 Ga0501084_0000382
915 Ga0501084_0118923
916 Ga0590077_080395
917 Ga0501082_0008115
918 Ga0501082_0413486
919 Ga0501082_1397886
920 Ga0530510_1144718

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13601

HTH_34

Winged helix DNA-binding domain

58

137

0.98

PF12840

HTH_20

Helix-turn-helix domain

53

101

0.96

PF01022

HTH_5

Bacterial regulatory protein, arsR family

56

102

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5duk-assembly1.cif.gz_B n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.9507 38 83
3bp8-assembly2.cif.gz_A crystal structure of mlc/eiib complex 0.9371 37 86
3bp8-assembly2.cif.gz_B crystal structure of mlc/eiib complex 0.9273 38 86
4hob-assembly2.cif.gz_C the crystal structure of the zalpha domain from cyprinid herpes virus 3 0.9224 40 83
6wxq-assembly1.cif.gz_A crystal structure of crispr-associated transcription factor csa3 complexed with ca4 0.9178 41 111
ID Description Score Start End Superfamily
3bp8B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9273 38 86 1.10.10.10
4hobC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9224 40 83 1.10.10.10
2mlgA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9138 42 102 1.10.10.10
2ia2D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9104 38 86 1.10.10.10
af_Q5NE14_88_145_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9103 39 88 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1H4BP91-F1-model_v4 Winged helix DNA-binding domain-containing protein 0.9876 41 122 GO:0003677
GO:0005737
AF-W5WBY8-F1-model_v4 Winged helix DNA-binding domain-containing protein 0.9869 41 127
AF-D4YKT1-F1-model_v4 Winged helix DNA-binding domain-containing protein 0.9842 42 121
AF-A0A7L7LDY6-F1-model_v4 Transcriptional regulator 0.9838 41 127 GO:0005737
AF-A0A6M1YBQ9-F1-model_v4 Transcriptional regulator 0.9832 41 120

Map