F448445

General Info

Members Datasets Scaffolds Average Seq Length
459 271 427 161

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0043045|Ga0501070_0043045_2471_3034
Length 187
Sequence MSRSLPSRVADVSGKGVPDEVAIDGSGLRVAVVAARWHTEVTDALVAGATRGLDAASVADRYLCRVPGAFELAVVAGELARSGYDAVVALGVVVRGGTPHFEYVCSAATDGLNRIAMETGVPVGFGLLTCDTTEQALDRAGLPGSSEDKGREAAMAAVETALVLRAIRRAGSAPGQHGESHASADGR

Samples

Sample ID Description Type Environment
1 2517572101 Frankia sp. DC12 Isolate Nodule
2 2527291627 Frankia casuarinae Thr Isolate Nodule
3 2527291629 Frankia sp. BMG5.23 Isolate Nodule
4 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
5 2576861822 Frankia sp. CeD Isolate Nodule
6 2671180195 Frankia sp. CcI49 Isolate Nodule
7 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
8 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
9 2684623036 Frankia sp. CgIM4 Isolate Nodule
10 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
11 2710264753 Frankia sp. KB5 Isolate Nodule
12 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
13 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
14 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
15 2773857922 Frankia sp. CcI49 Isolate Nodule
16 2773857924 Frankia sp. CgIS1 Isolate Nodule
17 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
18 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
19 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
20 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
21 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
22 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
23 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
24 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
25 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
26 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
27 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
28 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
131 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
141 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
156 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
157 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
160 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
161 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
162 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
169 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
182 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
186 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
220 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
221 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
222 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
223 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
224 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
225 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
258 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
259 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
260 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
261 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
262 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
263 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
264 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
265 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
266 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
267 637000116 Frankia casuarinae CcI3 Isolate Nodule
268 8002775197 Frankia nepalensis CN7 Isolate Nodule
269 8002784119 Frankia sp. AgB1.9 Isolate Nodule
270 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
271 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.85
Metatranscriptomes 2.18
Isolates 6.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.05
Nodule 3.05
Rhizoplane 5.23
Rhizosphere 80.17
Stem 0
Stem Tuber 0
Unclassified 8.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10006107 3300003373 Bacteria 2986
2 JGI25405J52794_10091301 3300003911 Bacteria 674
3 Ga0070690_100186386 3300005330 Bacteria 1436
4 Ga0070666_11066565 3300005335 Bacteria 600
5 Ga0070680_100064860 3300005336 Bacteria 2993
6 Ga0070680_100341402 3300005336 Bacteria 1273
7 Ga0068868_100027988 3300005338 Bacteria 4303
8 Ga0068868_100084285 3300005338 Bacteria 2552
9 Ga0070671_100306508 3300005355 Bacteria 1352
10 Ga0070674_100148754 3300005356 Bacteria 1765
11 Ga0070659_100000619 3300005366 Bacteria 26037
12 Ga0070659_100011660 3300005366 Bacteria 6504
13 Ga0070667_100041508 3300005367 Bacteria 3860
14 Ga0070714_100894577 3300005435 Bacteria 862
15 Ga0070700_100000019 3300005441 Bacteria 137133
16 Ga0070678_100123853 3300005456 Bacteria 2043
17 Ga0070681_10060887 3300005458 Bacteria 3751
18 Ga0070679_100001838 3300005530 Bacteria 19103
19 Ga0070679_100963694 3300005530 Bacteria 797
20 Ga0070665_100083159 3300005548 Bacteria 3206
21 Ga0068855_100027925 3300005563 Bacteria 6750
22 Ga0068855_100050936 3300005563 Bacteria 4878
23 Ga0068857_100569646 3300005577 Bacteria 1068
24 Ga0068854_100238535 3300005578 Bacteria 1447
25 Ga0068856_100018060 3300005614 Bacteria 6840
26 Ga0068856_100568559 3300005614 Bacteria 1155
27 Ga0068852_100048384 3300005616 Bacteria 3632
28 Ga0068859_100009356 3300005617 Bacteria 9894
29 Ga0068866_10135103 3300005718 Bacteria 1408
30 Ga0068863_100000454 3300005841 Bacteria 41713
31 Ga0068858_100000068 3300005842 Bacteria 105957
32 Ga0068862_100000021 3300005844 Bacteria 218035
33 Ga0081455_10000115 3300005937 Bacteria 91703
34 Ga0081455_10000819 3300005937 Bacteria 40048
35 Ga0081455_10008371 3300005937 Bacteria 10764
36 Ga0081538_10001227 3300005981 Bacteria 26904
37 Ga0081540_1002480 3300005983 Bacteria 15030
38 Ga0081539_10000352 3300005985 Bacteria 100942
39 Ga0081539_10006525 3300005985 Bacteria 11135
40 Ga0081539_10038987 3300005985 Bacteria 2809
41 Ga0075365_10003068 3300006038 Bacteria 8480
42 Ga0075364_10908049 3300006051 Bacteria 599
43 Ga0075369_10105133 3300006186 Bacteria 1269
44 Ga0075428_100026586 3300006844 Bacteria 6406
45 Ga0075431_100379944 3300006847 Bacteria 1417
46 Ga0075429_100269208 3300006880 Bacteria 1492
47 Ga0097620_100001250 3300006931 Bacteria 25949
48 Ga0097620_100009356 3300006931 Bacteria 9894
49 Ga0105240_10128283 3300009093 Bacteria 3045
50 Ga0105247_10000164 3300009101 Bacteria 64953
51 Ga0105243_12052193 3300009148 Bacteria 607
52 Ga0105241_10011780 3300009174 Bacteria 6422
53 Ga0105248_10001671 3300009177 Bacteria 24679
54 Ga0105248_10014721 3300009177 Bacteria 8611
55 Ga0105248_10098125 3300009177 Bacteria 3301
56 Ga0105237_10000866 3300009545 Bacteria 41152
57 Ga0105237_10017292 3300009545 Bacteria 7475
58 Ga0105237_10092921 3300009545 Bacteria 3006
59 Ga0105237_10332253 3300009545 Bacteria 1524
60 Ga0105238_10031991 3300009551 Bacteria 5354
61 Ga0105249_10081232 3300009553 Bacteria 3013
62 Ga0105028_111718 3300009993 Bacteria 925
63 Ga0105239_10024187 3300010375 Bacteria 6690
64 Ga0105239_10029253 3300010375 Bacteria 6058
65 Ga0157371_10034848 3300013102 Bacteria 3609
66 Ga0157369_10002905 3300013105 Bacteria 20475
67 Ga0157369_10048713 3300013105 Bacteria 4597
68 Ga0157369_10106407 3300013105 Bacteria 2985
69 Ga0157369_10849337 3300013105 Bacteria 937
70 Ga0157378_11420824 3300013297 Bacteria 737
71 Ga0157372_11437461 3300013307 Bacteria 795
72 Ga0157375_10156949 3300013308 Bacteria 2415
73 Ga0163163_10002730 3300014325 Bacteria 14902
74 Ga0163163_10055387 3300014325 Bacteria 3919
75 Ga0163163_10066713 3300014325 Bacteria 3575
76 Ga0182008_10811504 3300014497 Bacteria 544
77 Ga0157379_10000014 3300014968 Bacteria 105963
78 Ga0157379_10227253 3300014968 Bacteria 1691
79 Ga0157376_10806362 3300014969 Bacteria 952
80 Ga0197907_10909664 3300020069 Bacteria 1223
81 Ga0197907_11141094 3300020069 Bacteria 952
82 Ga0206351_10505258 3300020077 Bacteria 1319
83 Ga0206354_10463838 3300020081 Bacteria 1252
84 Ga0206354_10650934 3300020081 Bacteria 710
85 Ga0206353_10407747 3300020082 Bacteria 882
86 Ga0206353_10722038 3300020082 Bacteria 885
87 Ga0206353_11029603 3300020082 Bacteria 19172
88 Ga0206353_11791765 3300020082 Bacteria 629
89 Ga0213876_10002533 3300021384 Bacteria 10695
90 Ga0224712_10022215 3300022467 Bacteria 2183
91 Ga0207656_10075010 3300025321 Bacteria 1510
92 Ga0207710_10000178 3300025900 Bacteria 64962
93 Ga0207647_10012472 3300025904 Bacteria 5916
94 Ga0207699_10109642 3300025906 Bacteria 1767
95 Ga0207705_10002849 3300025909 Bacteria 13227
96 Ga0207705_10123795 3300025909 Bacteria 1920
97 Ga0207654_10189519 3300025911 Bacteria 1347
98 Ga0207707_10001139 3300025912 Bacteria 25193
99 Ga0207695_10036510 3300025913 Bacteria 5312
100 Ga0207671_10000180 3300025914 Bacteria 96543
101 Ga0207671_10053160 3300025914 Bacteria 3001
102 Ga0207671_11043583 3300025914 Bacteria 643
103 Ga0207660_10011557 3300025917 Bacteria 5752
104 Ga0207657_10208006 3300025919 Bacteria 1571
105 Ga0207652_10000651 3300025921 Bacteria 34132
106 Ga0207694_10002564 3300025924 Bacteria 14749
107 Ga0207694_11601143 3300025924 Bacteria 549
108 Ga0207687_10392614 3300025927 Bacteria 1139
109 Ga0207664_10077464 3300025929 Bacteria 2694
110 Ga0207664_10238769 3300025929 Bacteria 1582
111 Ga0207644_10170150 3300025931 Bacteria 1700
112 Ga0207690_10003694 3300025932 Bacteria 9106
113 Ga0207690_10010459 3300025932 Bacteria 5516
114 Ga0207669_10036290 3300025937 Bacteria 2815
115 Ga0207711_10000929 3300025941 Bacteria 28223
116 Ga0207711_10120990 3300025941 Bacteria 2337
117 Ga0207711_10164269 3300025941 Bacteria 2012
118 Ga0207689_10390616 3300025942 Bacteria 1159
119 Ga0207667_10012473 3300025949 Bacteria 9788
120 Ga0207667_10017191 3300025949 Bacteria 8151
121 Ga0207712_10018571 3300025961 Bacteria 4531
122 Ga0207668_10501538 3300025972 Bacteria 1044
123 Ga0207640_10157204 3300025981 Bacteria 1677
124 Ga0207658_10081596 3300025986 Bacteria 2480
125 Ga0207677_10030768 3300026023 Bacteria 3431
126 Ga0207703_10000083 3300026035 Bacteria 110315
127 Ga0207703_10011620 3300026035 Bacteria 6845
128 Ga0207639_10372684 3300026041 Bacteria 1280
129 Ga0207678_10022690 3300026067 Bacteria 5497
130 Ga0207678_10420952 3300026067 Bacteria 1158
131 Ga0207708_10000038 3300026075 Bacteria 137212
132 Ga0207702_10276333 3300026078 Bacteria 1586
133 Ga0207702_11111496 3300026078 Bacteria 784
134 Ga0207641_10004238 3300026088 Bacteria 12502
135 Ga0207641_10518501 3300026088 Bacteria 1159
136 Ga0207674_10082595 3300026116 Bacteria 3214
137 Ga0207683_10072619 3300026121 Bacteria 3043
138 Ga0207698_10498970 3300026142 Bacteria 1184
139 Ga0268266_10463001 3300028379 Bacteria 1206
140 Ga0268265_10000034 3300028380 Bacteria 218695
141 Ga0307517_10087413 3300028786 Bacteria 2590
142 Ga0307515_10292755 3300028794 Bacteria 1322
143 Ga0265338_10178478 3300028800 Bacteria 1621
144 Ga0265338_10342401 3300028800 Bacteria 1077
145 Ga0316181_1012079 3300030744 Bacteria 6660
146 Ga0316182_1190631 3300030745 Bacteria 5061
147 Ga0265325_10020517 3300031241 Bacteria 3642
148 Ga0265340_10021442 3300031247 Bacteria 3313
149 Ga0265339_10148093 3300031249 Bacteria 1189
150 Ga0265327_10000081 3300031251 Bacteria 205988
151 Ga0307408_100375912 3300031548 Bacteria 1213
152 Ga0307408_100676169 3300031548 Bacteria 925
153 Ga0307508_10041829 3300031616 Bacteria 4112
154 Ga0307508_10164377 3300031616 Bacteria 1823
155 Ga0265314_10288254 3300031711 Bacteria 926
156 Ga0265342_10049524 3300031712 Bacteria 2514
157 Ga0316576_10107125 3300031727 Bacteria 2093
158 Ga0316576_10234689 3300031727 Bacteria 1379
159 Ga0316576_10800714 3300031727 Bacteria 678
160 Ga0316578_10333639 3300031728 Bacteria 904
161 Ga0307405_10257858 3300031731 Bacteria 1301
162 Ga0307405_10393901 3300031731 Bacteria 1082
163 Ga0316577_10288035 3300031733 Bacteria 930
164 Ga0307413_10303781 3300031824 Bacteria 1211
165 Ga0307413_10818514 3300031824 Bacteria 784
166 Ga0307410_10304611 3300031852 Bacteria 1258
167 Ga0307406_10295130 3300031901 Bacteria 1243
168 Ga0307412_10576785 3300031911 Bacteria 949
169 Ga0307409_100093661 3300031995 Bacteria 2469
170 Ga0307409_100355658 3300031995 Bacteria 1384
171 Ga0307409_100973527 3300031995 Bacteria 865
172 Ga0307409_101242584 3300031995 Bacteria 769
173 Ga0307409_101730613 3300031995 Bacteria 654
174 Ga0307416_100049610 3300032002 Bacteria 3339
175 Ga0307416_100377961 3300032002 Bacteria 1446
176 Ga0307416_100571250 3300032002 Bacteria 1207
177 Ga0307416_101853761 3300032002 Bacteria 707
178 Ga0307414_11444154 3300032004 Bacteria 640
179 Ga0307411_11812332 3300032005 Bacteria 567
180 Ga0307415_100026034 3300032126 Bacteria 3682
181 Ga0307415_100343071 3300032126 Bacteria 1254
182 Ga0307507_10000038 3300033179 Bacteria 184517
183 Ga0307510_10252098 3300033180 Bacteria 1252
184 Ga0316574_0008018 3300035398 Bacteria 5835
185 Ga0316574_0110467 3300035398 Bacteria 1762
186 Ga0316582_0436946 3300036647 Bacteria 902
187 Ga0316584_0068038 3300036712 Bacteria 2669
188 Ga0436365_0849899 3300039437 Bacteria 19757
189 Ga0451833_0960841 3300041491 Bacteria 990
190 Ga0451839_0229956 3300041496 Bacteria 1377
191 Ga0439459_0093326 3300042438 Bacteria 727
192 Ga0466969_0001843 3300044656 Bacteria 11335
193 Ga0466969_0021607 3300044656 Bacteria 3326
194 Ga0466969_0029043 3300044656 Bacteria 2826
195 Ga0466969_0063358 3300044656 Bacteria 1792
196 Ga0466969_0181373 3300044656 Bacteria 963
197 Ga0466972_0044823 3300044658 Bacteria 2144
198 Ga0466965_0573758 3300044683 Bacteria 639
199 Ga0466966_0009208 3300044684 Bacteria 6537
200 Ga0466966_0051747 3300044684 Bacteria 2610
201 Ga0466966_0324866 3300044684 Bacteria 924
202 Ga0466961_0009991 3300044693 Bacteria 6048
203 Ga0466961_0061663 3300044693 Bacteria 2383
204 Ga0466961_0112710 3300044693 Bacteria 1710
205 Ga0466963_0035184 3300044694 Bacteria 3262
206 Ga0466963_0065927 3300044694 Bacteria 2428
207 Ga0466963_0080674 3300044694 Bacteria 2203
208 Ga0466963_0112695 3300044694 Bacteria 1868
209 Ga0466963_0168803 3300044694 Bacteria 1525
210 Ga0466963_0237664 3300044694 Bacteria 1277
211 Ga0466963_0664941 3300044694 Bacteria 735
212 Ga0466964_0189356 3300044706 Bacteria 981
213 Ga0466971_0001759 3300044719 Bacteria 9191
214 Ga0466971_0013981 3300044719 Bacteria 3527
215 Ga0466971_0055123 3300044719 Bacteria 1791
216 Ga0466970_0007042 3300044765 Bacteria 5625
217 Ga0466970_0204135 3300044765 Bacteria 1100
218 Ga0466957_0097101 3300044842 Bacteria 1853
219 Ga0466957_0921414 3300044842 Bacteria 625
220 Ga0466960_0001989 3300044901 Bacteria 7580
221 Ga0466960_0049534 3300044901 Bacteria 2022
222 Ga0466960_0167874 3300044901 Bacteria 1183
223 Ga0466960_0211669 3300044901 Bacteria 1063
224 Ga0466959_0049230 3300045049 Bacteria 3095
225 Ga0466959_0084135 3300045049 Bacteria 2290
226 Ga0466959_0128612 3300045049 Bacteria 1796
227 Ga0466959_0184335 3300045049 Bacteria 1459
228 Ga0466959_0312893 3300045049 Bacteria 1074
229 Ga0466959_0418671 3300045049 Bacteria 909
230 Ga0466959_0458305 3300045049 Bacteria 864
231 Ga0466958_0008521 3300045836 Bacteria 5693
232 Ga0466958_0041862 3300045836 Bacteria 2757
233 Ga0466958_0051750 3300045836 Bacteria 2487
234 Ga0466958_0115384 3300045836 Bacteria 1678
235 Ga0466958_0867069 3300045836 Bacteria 589
236 Ga0466967_0017008 3300045976 Bacteria 5755
237 Ga0466967_0136672 3300045976 Bacteria 2280
238 Ga0466967_0169866 3300045976 Bacteria 2051
239 Ga0466967_0214029 3300045976 Bacteria 1829
240 Ga0466967_0255869 3300045976 Bacteria 1674
241 Ga0466967_0325290 3300045976 Bacteria 1484
242 Ga0466967_0467122 3300045976 Bacteria 1235
243 Ga0466967_1029398 3300045976 Bacteria 820
244 Ga0495592_0043125 3300046454 Bacteria 3376
245 Ga0495629_0011189 3300046459 Bacteria 6515
246 Ga0495629_0563129 3300046459 Bacteria 764
247 Ga0495638_0192791 3300046460 Bacteria 1155
248 Ga0495638_0318163 3300046460 Bacteria 832
249 Ga0495651_0006018 3300046462 Bacteria 9263
250 Ga0495651_0063733 3300046462 Bacteria 2817
251 Ga0495664_0191005 3300046477 Bacteria 1241
252 Ga0495585_0403424 3300046492 Bacteria 658
253 Ga0495583_0148508 3300046506 Bacteria 972
254 Ga0495606_0223100 3300046507 Bacteria 1061
255 Ga0495628_0022814 3300046516 Bacteria 5140
256 Ga0495648_0002584 3300046524 Bacteria 16584
257 Ga0495648_0176045 3300046524 Bacteria 1092
258 Ga0495666_0168628 3300046526 Bacteria 1013
259 Ga0495652_0111677 3300046529 Bacteria 2197
260 Ga0495665_0260875 3300046531 Bacteria 891
261 Ga0495640_0038188 3300046533 Bacteria 3378
262 Ga0495645_0335852 3300046543 Bacteria 977
263 Ga0495667_0719620 3300046559 Bacteria 618
264 Ga0495668_0024608 3300046616 Bacteria 3424
265 Ga0495634_0002349 3300046642 Bacteria 15796
266 Ga0495635_0127033 3300046663 Bacteria 1739
267 Ga0495657_0004261 3300046675 Bacteria 11439
268 Ga0495599_0132601 3300046678 Bacteria 1547
269 Ga0495613_0012794 3300046689 Bacteria 6239
270 Ga0495613_0247054 3300046689 Bacteria 1246
271 Ga0495624_0013838 3300046690 Bacteria 5493
272 Ga0495600_0066880 3300046809 Bacteria 2349
273 Ga0495581_0141726 3300047315 Bacteria 1402
274 Ga0495581_0328098 3300047315 Bacteria 894
275 Ga0495604_0004161 3300047317 Bacteria 11481
276 Ga0495604_0023688 3300047317 Bacteria 4899
277 Ga0495672_0002481 3300047320 Bacteria 16913
278 Ga0495672_0207063 3300047320 Bacteria 977
279 Ga0495676_0065668 3300047321 Bacteria 2815
280 Ga0495680_0096004 3300047322 Bacteria 2215
281 Ga0495675_0420047 3300047444 Bacteria 777
282 Ga0495673_0001087 3300047469 Bacteria 23738
283 Ga0496100_0000510 3300048903 Bacteria 18704
284 Ga0496100_0001466 3300048903 Bacteria 11542
285 Ga0496101_0000011 3300048904 Bacteria 272153
286 Ga0496101_0001462 3300048904 Bacteria 14111
287 Ga0496102_0000012 3300048905 Bacteria 315470
288 Ga0496102_0034761 3300048905 Bacteria 4535
289 Ga0496102_0149634 3300048905 Bacteria 2193
290 Ga0496103_0000005 3300048906 Bacteria 505416
291 Ga0496103_0070913 3300048906 Bacteria 2180
292 Ga0496103_0122075 3300048906 Bacteria 1660
293 Ga0496104_0004228 3300048907 Bacteria 12471
294 Ga0496105_0016589 3300048908 Bacteria 5881
295 Ga0496105_0760419 3300048908 Bacteria 739
296 Ga0496106_0015219 3300048909 Bacteria 5692
297 Ga0496106_0030282 3300048909 Bacteria 4036
298 Ga0496106_0672727 3300048909 Bacteria 826
299 Ga0496107_0002019 3300048910 Bacteria 12956
300 Ga0496107_0408618 3300048910 Bacteria 1010
301 Ga0496109_0175233 3300048912 Bacteria 2013
302 Ga0496109_1008777 3300048912 Unclassified 770
303 Ga0496110_1104394 3300048913 Bacteria 701
304 Ga0496114_0003971 3300048917 Bacteria 11423
305 Ga0496115_0007561 3300048918 Bacteria 8003
306 Ga0496116_0000050 3300048919 Bacteria 311670
307 Ga0496116_0000165 3300048919 Bacteria 133688
308 Ga0496117_0000042 3300048920 Bacteria 315470
309 Ga0496118_0000037 3300048921 Bacteria 315470
310 Ga0496118_0018369 3300048921 Bacteria 6312
311 Ga0496119_0000375 3300048922 Bacteria 61774
312 Ga0496119_0001269 3300048922 Bacteria 31365
313 Ga0496119_0007190 3300048922 Bacteria 10085
314 Ga0496119_0025638 3300048922 Bacteria 4112
315 Ga0496119_0077926 3300048922 Bacteria 1918
316 Ga0496119_0102539 3300048922 Bacteria 1604
317 Ga0496119_0261781 3300048922 Bacteria 867
318 Ga0496120_0000453 3300048923 Bacteria 64868
319 Ga0496120_0007333 3300048923 Bacteria 8228
320 Ga0496120_0033242 3300048923 Bacteria 3100
321 Ga0496120_0185526 3300048923 Bacteria 1018
322 Ga0496120_0230653 3300048923 Bacteria 879
323 Ga0496121_0000039 3300048924 Bacteria 351444
324 Ga0496125_0100641 3300048928 Bacteria 2130
325 Ga0496126_0000236 3300048929 Bacteria 119350
326 Ga0496126_0142738 3300048929 Bacteria 2060
327 Ga0501031_0022901 3300049568 Bacteria 4074
328 Ga0501031_0110575 3300049568 Bacteria 1794
329 Ga0501032_0006792 3300049569 Bacteria 8397
330 Ga0501032_0057210 3300049569 Bacteria 2620
331 Ga0501032_0102601 3300049569 Bacteria 1895
332 Ga0501032_0260875 3300049569 Bacteria 1123
333 Ga0501032_0273260 3300049569 Bacteria 1095
334 Ga0501033_0009823 3300049570 Bacteria 7345
335 Ga0501033_0045162 3300049570 Bacteria 3279
336 Ga0501033_0075880 3300049570 Bacteria 2467
337 Ga0501034_0015609 3300049571 Bacteria 7802
338 Ga0501034_0079386 3300049571 Bacteria 3285
339 Ga0501034_0089659 3300049571 Bacteria 3073
340 Ga0501034_0200757 3300049571 Bacteria 1952
341 Ga0501034_0629542 3300049571 Bacteria 976
342 Ga0501034_1169466 3300049571 Bacteria 649
343 Ga0501036_0006356 3300049572 Bacteria 9590
344 Ga0501036_0046292 3300049572 Bacteria 3683
345 Ga0501036_0089136 3300049572 Bacteria 2606
346 Ga0501037_0228449 3300049573 Bacteria 1307
347 Ga0501037_0362883 3300049573 Bacteria 998
348 Ga0501037_0497317 3300049573 Bacteria 827
349 Ga0501037_0656657 3300049573 Bacteria 700
350 Ga0501038_0009857 3300049574 Bacteria 8742
351 Ga0501038_0027683 3300049574 Bacteria 5041
352 Ga0501038_0034176 3300049574 Bacteria 4473
353 Ga0501038_0132507 3300049574 Bacteria 2044
354 Ga0501038_0647715 3300049574 Bacteria 796
355 Ga0501039_0093986 3300049575 Bacteria 2337
356 Ga0501039_0101908 3300049575 Bacteria 2240
357 Ga0501039_1024187 3300049575 Bacteria 641
358 Ga0501042_0494979 3300049578 Bacteria 887
359 Ga0501043_0009555 3300049579 Bacteria 7602
360 Ga0501043_0350564 3300049579 Bacteria 1121
361 Ga0501043_0470580 3300049579 Bacteria 942
362 Ga0501043_1034592 3300049579 Bacteria 583
363 Ga0501046_0029318 3300049580 Bacteria 4474
364 Ga0501047_0000182 3300049581 Bacteria 76846
365 Ga0501047_0002063 3300049581 Bacteria 19207
366 Ga0501047_0013709 3300049581 Bacteria 7695
367 Ga0501047_0016826 3300049581 Bacteria 6986
368 Ga0501047_0197143 3300049581 Bacteria 1875
369 Ga0501047_0305882 3300049581 Bacteria 1431
370 Ga0501048_0000162 3300049582 Bacteria 41735
371 Ga0501067_0038950 3300049583 Bacteria 2639
372 Ga0501068_0072176 3300049584 Bacteria 2108
373 Ga0501069_0046556 3300049585 Bacteria 2406
374 Ga0501070_0002856 3300049586 Bacteria 15063
375 Ga0501070_0013106 3300049586 Bacteria 6988
376 Ga0501070_0015126 3300049586 Bacteria 6495
377 Ga0501070_0037849 3300049586 Bacteria 4026
378 Ga0501070_0043045 3300049586 Bacteria 3758
379 Ga0501070_0049933 3300049586 Bacteria 3473
380 Ga0501071_0619361 3300049587 Bacteria 832
381 Ga0501072_0338437 3300049588 Bacteria 1195
382 Ga0501073_0012996 3300049589 Bacteria 6069
383 Ga0501073_0149215 3300049589 Bacteria 1620
384 Ga0501074_0010059 3300049590 Bacteria 6866
385 Ga0501079_0031834 3300049741 Bacteria 4053
386 Ga0501080_0000943 3300049742 Bacteria 23758
387 Ga0501080_0022348 3300049742 Bacteria 5859
388 Ga0501080_0116818 3300049742 Bacteria 2472
389 Ga0501080_0648517 3300049742 Bacteria 934
390 Ga0501081_0187114 3300049743 Bacteria 1499
391 Ga0501035_0004758 3300049822 Bacteria 12891
392 Ga0501035_0009547 3300049822 Bacteria 9020
393 Ga0501035_0063151 3300049822 Bacteria 3294
394 Ga0501035_0066287 3300049822 Bacteria 3204
395 Ga0501035_0067968 3300049822 Bacteria 3160
396 Ga0501035_0213085 3300049822 Bacteria 1652
397 Ga0501035_0400720 3300049822 Bacteria 1142
398 Ga0501035_0997923 3300049822 Bacteria 658
399 Ga0501044_0011098 3300049823 Bacteria 9771
400 Ga0501044_0020431 3300049823 Bacteria 7071
401 Ga0501044_0141808 3300049823 Bacteria 2391
402 Ga0501044_0150745 3300049823 Bacteria 2307
403 Ga0501044_0230419 3300049823 Bacteria 1800
404 Ga0501044_0261606 3300049823 Bacteria 1668
405 Ga0501044_0435199 3300049823 Bacteria 1220
406 Ga0501044_0475925 3300049823 Bacteria 1152
407 Ga0501044_0942117 3300049823 Bacteria 737
408 Ga0501045_0027418 3300049824 Bacteria 4105
409 Ga0501045_0076541 3300049824 Bacteria 2465
410 Ga0501045_0386304 3300049824 Bacteria 1042
411 nmdc:mga00v17_262630_c1 3300050491 Bacteria 1120
412 nmdc:mga09592_272218_c1 3300050508 Bacteria 1469
413 nmdc:mga06r32_384031_c1 3300050510 Bacteria 1387
414 nmdc:mga06r32_941507_c1 3300050510 Bacteria 819
415 nmdc:mga0sz30_98735_c1 3300050516 Bacteria 1274
416 Ga0500557_056121 3300053105 Bacteria 1272
417 Ga0500594_0290960 3300053118 Bacteria 547
418 Ga0500559_0451382 3300053136 Bacteria 594
419 Ga0500568_0045525 3300053139 Bacteria 1746
420 Ga0500573_0000001 3300053140 Bacteria 436394
421 Ga0500604_0027592 3300053151 Bacteria 1644
422 Ga0500616_0005662 3300053153 Bacteria 8429
423 Ga0500616_0016814 3300053153 Bacteria 4157
424 Ga0500627_0026944 3300053158 Bacteria 2376
425 Ga0466962_0002960 3300061719 Bacteria 8104
426 Ga0466962_0017827 3300061719 Bacteria 3417
427 Ga0466962_0058230 3300061719 Bacteria 1844

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050510 nmdc:mga06r32_941507_c1 nmdc:mga06r32_941507_c1_18_422 129
2 3300031995 Ga0307409_101242584 Ga0307409_1012425841 135
3 3300005338 Ga0068868_100084285 Ga0068868_1000842852 137
4 3300031548 Ga0307408_100375912 Ga0307408_1003759122 137
5 3300031824 Ga0307413_10303781 Ga0307413_103037812 137
6 3300031852 Ga0307410_10304611 Ga0307410_103046111 137
7 3300025927 Ga0207687_10392614 Ga0207687_103926143 138
8 3300049743 Ga0501081_0187114 Ga0501081_0187114_935_1417 140
9 3300045976 Ga0466967_0255869 Ga0466967_0255869_1176_1652 141
10 3300046663 Ga0495635_0127033 Ga0495635_0127033_251_682 141
11 3300044694 Ga0466963_0664941 Ga0466963_0664941_21_485 145
12 3300031995 Ga0307409_100093661 Ga0307409_1000936611 146
13 3300032126 Ga0307415_100026034 Ga0307415_1000260343 146
14 3300031727 Ga0316576_10234689 Ga0316576_102346892 147
15 3300005335 Ga0070666_11066565 Ga0070666_110665651 148
16 3300005355 Ga0070671_100306508 Ga0070671_1003065082 148
17 3300009177 Ga0105248_10098125 Ga0105248_100981252 148
18 3300013308 Ga0157375_10156949 Ga0157375_101569494 148
19 3300025931 Ga0207644_10170150 Ga0207644_101701502 148
20 3300025937 Ga0207669_10036290 Ga0207669_100362904 148
21 3300025941 Ga0207711_10120990 Ga0207711_101209902 148
22 3300026088 Ga0207641_10518501 Ga0207641_105185012 148
23 3300044694 Ga0466963_0237664 Ga0466963_0237664_745_1197 148
24 3300048903 Ga0496100_0001466 Ga0496100_0001466_10490_10939 148
25 3300048904 Ga0496101_0001462 Ga0496101_0001462_3039_3488 148
26 3300048905 Ga0496102_0034761 Ga0496102_0034761_1695_2144 148
27 3300048907 Ga0496104_0004228 Ga0496104_0004228_177_626 148
28 3300048908 Ga0496105_0016589 Ga0496105_0016589_2768_3217 148
29 3300048909 Ga0496106_0030282 Ga0496106_0030282_2373_2822 148
30 3300048910 Ga0496107_0002019 Ga0496107_0002019_923_1372 148
31 3300048917 Ga0496114_0003971 Ga0496114_0003971_2276_2725 148
32 3300048918 Ga0496115_0007561 Ga0496115_0007561_2838_3287 148
33 3300005548 Ga0070665_100083159 Ga0070665_1000831593 149
34 3300005563 Ga0068855_100050936 Ga0068855_1000509362 149
35 3300005578 Ga0068854_100238535 Ga0068854_1002385352 149
36 3300005614 Ga0068856_100568559 Ga0068856_1005685591 149
37 3300005616 Ga0068852_100048384 Ga0068852_1000483843 149
38 3300009093 Ga0105240_10128283 Ga0105240_101282832 149
39 3300009174 Ga0105241_10011780 Ga0105241_100117807 149
40 3300009545 Ga0105237_10092921 Ga0105237_100929212 149
41 3300009551 Ga0105238_10031991 Ga0105238_100319915 149
42 3300010375 Ga0105239_10029253 Ga0105239_100292537 149
43 3300013105 Ga0157369_10849337 Ga0157369_108493372 149
44 3300014325 Ga0163163_10002730 Ga0163163_1000273010 149
45 3300014969 Ga0157376_10806362 Ga0157376_108063622 149
46 3300020081 Ga0206354_10650934 Ga0206354_106509341 149
47 3300025321 Ga0207656_10075010 Ga0207656_100750102 149
48 3300025904 Ga0207647_10012472 Ga0207647_100124726 149
49 3300025911 Ga0207654_10189519 Ga0207654_101895192 149
50 3300025913 Ga0207695_10036510 Ga0207695_100365106 149
51 3300025914 Ga0207671_10000180 Ga0207671_1000018083 149
52 3300025924 Ga0207694_10002564 Ga0207694_100025647 149
53 3300025949 Ga0207667_10017191 Ga0207667_100171916 149
54 3300025981 Ga0207640_10157204 Ga0207640_101572043 149
55 3300026041 Ga0207639_10372684 Ga0207639_103726842 149
56 3300026067 Ga0207678_10022690 Ga0207678_100226906 149
57 3300026142 Ga0207698_10498970 Ga0207698_104989701 149
58 3300028379 Ga0268266_10463001 Ga0268266_104630012 149
59 3300046524 Ga0495648_0176045 Ga0495648_0176045_108_563 149
60 3300048905 Ga0496102_0149634 Ga0496102_0149634_1438_1893 149
61 3300048906 Ga0496103_0070913 Ga0496103_0070913_358_813 149
62 3300048919 Ga0496116_0000165 Ga0496116_0000165_109461_109916 149
63 3300048921 Ga0496118_0018369 Ga0496118_0018369_1769_2224 149
64 3300048922 Ga0496119_0077926 Ga0496119_0077926_1308_1763 149
65 3300048923 Ga0496120_0185526 Ga0496120_0185526_105_560 149
66 iso_pu_bacteria 2857710386 2857710867 149
67 3300013105 Ga0157369_10106407 Ga0157369_101064075 150
68 iso_pu_bacteria 2675903059 2676487061 150
69 iso_pu_bacteria 2758568621 2760623338 150
70 3300032005 Ga0307411_11812332 Ga0307411_118123321 151
71 iso_pu_bacteria 2728369276 2729904951 151
72 iso_pu_bacteria 2897561785 2897562773 151
73 iso_pu_bacteria 2935890801 2935891042 151
74 3300030744 Ga0316181_1012079 Ga0316181_10120794 152
75 3300030745 Ga0316182_1190631 Ga0316182_11906313 152
76 3300032002 Ga0307416_101853761 Ga0307416_1018537612 152
77 3300049742 Ga0501080_0116818 Ga0501080_0116818_1418_1906 152
78 3300053153 Ga0500616_0005662 Ga0500616_0005662_5466_5930 152
79 iso_pu_bacteria 2767802112 2768645856 152
80 iso_pu_bacteria 2867346516 2867346785 152
81 iso_pu_bacteria 3006321560 3006328084 152
82 iso_pu_bacteria 8054160619 8054163880 152
83 iso_pu_bacteria 2956939328 2956940197 153
84 iso_pu_bacteria 3001119090 3001121616 153
85 3300009993 Ga0105028_111718 Ga0105028_1117182 154
86 3300032002 Ga0307416_100377961 Ga0307416_1003779612 154
87 3300045836 Ga0466958_0115384 Ga0466958_0115384_96_578 154
88 3300046526 Ga0495666_0168628 Ga0495666_0168628_389_856 154
89 3300046689 Ga0495613_0247054 Ga0495613_0247054_271_750 154
90 3300048929 Ga0496126_0142738 Ga0496126_0142738_1418_1888 154
91 3300049574 Ga0501038_0647715 Ga0501038_0647715_272_772 154
92 3300053136 Ga0500559_0451382 Ga0500559_0451382_38_526 154
93 3300053140 Ga0500573_0000001 Ga0500573_0000001_7793_8263 154
94 iso_pu_bacteria 2517572101 2517759706 154
95 iso_pu_bacteria 2527291627 2528205535 154
96 iso_pu_bacteria 2527291629 2528214988 154
97 iso_pu_bacteria 2546825537 2546950312 154
98 iso_pu_bacteria 2576861822 2579750228 154
99 iso_pu_bacteria 2671180195 2671839088 154
100 iso_pu_bacteria 2684623035 2686537815 154
101 iso_pu_bacteria 2684623036 2686543118 154
102 iso_pu_bacteria 2687453743 2689991632 154
103 iso_pu_bacteria 2710264753 2710603794 154
104 iso_pu_bacteria 2773857922 2774857244 154
105 iso_pu_bacteria 2773857924 2774866119 154
106 iso_pu_bacteria 2895880812 2895888721 154
107 iso_pu_bacteria 2902792274 2902796015 154
108 iso_pu_bacteria 2929212328 2929215394 154
109 iso_pu_bacteria 637000116 637880509 154
110 iso_pu_bacteria 8002775197 8002782799 154
111 iso_pu_bacteria 8002784119 8002788572 154
112 iso_pu_bacteria 8055157932 8055160838 154
113 3300003911 JGI25405J52794_10091301 JGI25405J52794_100913011 155
114 3300005435 Ga0070714_100894577 Ga0070714_1008945771 155
115 3300005456 Ga0070678_100123853 Ga0070678_1001238533 155
116 3300005937 Ga0081455_10000819 Ga0081455_1000081915 155
117 3300005985 Ga0081539_10000352 Ga0081539_1000035249 155
118 3300005985 Ga0081539_10006525 Ga0081539_100065255 155
119 3300005985 Ga0081539_10038987 Ga0081539_100389874 155
120 3300006051 Ga0075364_10908049 Ga0075364_109080491 155
121 3300020069 Ga0197907_11141094 Ga0197907_111410941 155
122 3300022467 Ga0224712_10022215 Ga0224712_100222153 155
123 3300025906 Ga0207699_10109642 Ga0207699_101096423 155
124 3300025929 Ga0207664_10077464 Ga0207664_100774641 155
125 3300025929 Ga0207664_10238769 Ga0207664_102387692 155
126 3300025942 Ga0207689_10390616 Ga0207689_103906161 155
127 3300026078 Ga0207702_11111496 Ga0207702_111114962 155
128 3300026121 Ga0207683_10072619 Ga0207683_100726193 155
129 3300028786 Ga0307517_10087413 Ga0307517_100874133 155
130 3300028794 Ga0307515_10292755 Ga0307515_102927552 155
131 3300031616 Ga0307508_10041829 Ga0307508_100418295 155
132 3300031727 Ga0316576_10107125 Ga0316576_101071252 155
133 3300031727 Ga0316576_10800714 Ga0316576_108007142 155
134 3300031728 Ga0316578_10333639 Ga0316578_103336392 155
135 3300031731 Ga0307405_10257858 Ga0307405_102578583 155
136 3300031731 Ga0307405_10393901 Ga0307405_103939013 155
137 3300031901 Ga0307406_10295130 Ga0307406_102951302 155
138 3300031911 Ga0307412_10576785 Ga0307412_105767852 155
139 3300031995 Ga0307409_100973527 Ga0307409_1009735272 155
140 3300031995 Ga0307409_101730613 Ga0307409_1017306131 155
141 3300032002 Ga0307416_100049610 Ga0307416_1000496104 155
142 3300032002 Ga0307416_100571250 Ga0307416_1005712501 155
143 3300032004 Ga0307414_11444154 Ga0307414_114441541 155
144 3300032126 Ga0307415_100343071 Ga0307415_1003430712 155
145 3300033179 Ga0307507_10000038 Ga0307507_10000038137 155
146 3300035398 Ga0316574_0008018 Ga0316574_0008018_1641_2117 155
147 3300035398 Ga0316574_0110467 Ga0316574_0110467_1028_1501 155
148 3300041491 Ga0451833_0960841 Ga0451833_0960841_346_840 155
149 3300041496 Ga0451839_0229956 Ga0451839_0229956_502_996 155
150 3300044656 Ga0466969_0021607 Ga0466969_0021607_1740_2234 155
151 3300044656 Ga0466969_0063358 Ga0466969_0063358_1015_1497 155
152 3300044656 Ga0466969_0181373 Ga0466969_0181373_245_739 155
153 3300044658 Ga0466972_0044823 Ga0466972_0044823_913_1389 155
154 3300044684 Ga0466966_0009208 Ga0466966_0009208_256_735 155
155 3300044684 Ga0466966_0051747 Ga0466966_0051747_1927_2421 155
156 3300044684 Ga0466966_0324866 Ga0466966_0324866_13_507 155
157 3300044693 Ga0466961_0009991 Ga0466961_0009991_5350_5829 155
158 3300044693 Ga0466961_0061663 Ga0466961_0061663_104_598 155
159 3300044693 Ga0466961_0112710 Ga0466961_0112710_549_1031 155
160 3300044694 Ga0466963_0065927 Ga0466963_0065927_99_593 155
161 3300044706 Ga0466964_0189356 Ga0466964_0189356_245_739 155
162 3300044719 Ga0466971_0013981 Ga0466971_0013981_789_1283 155
163 3300044765 Ga0466970_0204135 Ga0466970_0204135_223_717 155
164 3300044901 Ga0466960_0001989 Ga0466960_0001989_218_694 155
165 3300044901 Ga0466960_0049534 Ga0466960_0049534_700_1170 155
166 3300045049 Ga0466959_0084135 Ga0466959_0084135_802_1296 155
167 3300045049 Ga0466959_0128612 Ga0466959_0128612_1206_1682 155
168 3300045049 Ga0466959_0312893 Ga0466959_0312893_10_504 155
169 3300045049 Ga0466959_0418671 Ga0466959_0418671_82_561 155
170 3300045836 Ga0466958_0051750 Ga0466958_0051750_200_694 155
171 3300045976 Ga0466967_0017008 Ga0466967_0017008_3133_3612 155
172 3300045976 Ga0466967_0136672 Ga0466967_0136672_1571_2050 155
173 3300045976 Ga0466967_0169866 Ga0466967_0169866_595_1071 155
174 3300045976 Ga0466967_0214029 Ga0466967_0214029_753_1235 155
175 3300046460 Ga0495638_0318163 Ga0495638_0318163_39_533 155
176 3300046462 Ga0495651_0006018 Ga0495651_0006018_4793_5287 155
177 3300046531 Ga0495665_0260875 Ga0495665_0260875_338_832 155
178 3300046678 Ga0495599_0132601 Ga0495599_0132601_835_1329 155
179 3300047322 Ga0495680_0096004 Ga0495680_0096004_252_746 155
180 3300048906 Ga0496103_0122075 Ga0496103_0122075_1005_1487 155
181 3300048908 Ga0496105_0760419 Ga0496105_0760419_144_626 155
182 3300048922 Ga0496119_0001269 Ga0496119_0001269_8756_9238 155
183 3300048922 Ga0496119_0102539 Ga0496119_0102539_104_571 155
184 3300048923 Ga0496120_0007333 Ga0496120_0007333_6978_7460 155
185 3300049587 Ga0501071_0619361 Ga0501071_0619361_158_631 155
186 3300050491 nmdc:mga00v17_262630_c1 nmdc:mga00v17_262630_c1_76_543 155
187 3300053151 Ga0500604_0027592 Ga0500604_0027592_1070_1564 155
188 3300053153 Ga0500616_0016814 Ga0500616_0016814_586_1080 155
189 3300061719 Ga0466962_0058230 Ga0466962_0058230_177_671 155
190 iso_pu_bacteria 2827628540 2827630840 155
191 3300005356 Ga0070674_100148754 Ga0070674_1001487542 156
192 3300005367 Ga0070667_100041508 Ga0070667_1000415083 156
193 3300005441 Ga0070700_100000019 Ga0070700_100000019121 156
194 3300005563 Ga0068855_100027925 Ga0068855_1000279252 156
195 3300005614 Ga0068856_100018060 Ga0068856_1000180606 156
196 3300005718 Ga0068866_10135103 Ga0068866_101351032 156
197 3300009148 Ga0105243_12052193 Ga0105243_120521932 156
198 3300013307 Ga0157372_11437461 Ga0157372_114374612 156
199 3300014497 Ga0182008_10811504 Ga0182008_108115041 156
200 3300020069 Ga0197907_10909664 Ga0197907_109096642 156
201 3300020077 Ga0206351_10505258 Ga0206351_105052582 156
202 3300020081 Ga0206354_10463838 Ga0206354_104638382 156
203 3300020082 Ga0206353_10407747 Ga0206353_104077471 156
204 3300020082 Ga0206353_10722038 Ga0206353_107220382 156
205 3300020082 Ga0206353_11791765 Ga0206353_117917651 156
206 3300025949 Ga0207667_10012473 Ga0207667_100124735 156
207 3300025972 Ga0207668_10501538 Ga0207668_105015382 156
208 3300025986 Ga0207658_10081596 Ga0207658_100815962 156
209 3300026067 Ga0207678_10420952 Ga0207678_104209522 156
210 3300026075 Ga0207708_10000038 Ga0207708_10000038119 156
211 3300026078 Ga0207702_10276333 Ga0207702_102763332 156
212 3300031616 Ga0307508_10164377 Ga0307508_101643771 156
213 3300031733 Ga0316577_10288035 Ga0316577_102880352 156
214 3300036647 Ga0316582_0436946 Ga0316582_0436946_364_840 156
215 3300036712 Ga0316584_0068038 Ga0316584_0068038_1235_1714 156
216 3300044656 Ga0466969_0001843 Ga0466969_0001843_5242_5727 156
217 3300044683 Ga0466965_0573758 Ga0466965_0573758_19_519 156
218 3300044694 Ga0466963_0035184 Ga0466963_0035184_2231_2731 156
219 3300044719 Ga0466971_0001759 Ga0466971_0001759_8384_8869 156
220 3300044719 Ga0466971_0055123 Ga0466971_0055123_1060_1560 156
221 3300045049 Ga0466959_0049230 Ga0466959_0049230_343_828 156
222 3300045836 Ga0466958_0008521 Ga0466958_0008521_144_644 156
223 3300045976 Ga0466967_0467122 Ga0466967_0467122_134_634 156
224 3300046454 Ga0495592_0043125 Ga0495592_0043125_1114_1599 156
225 3300046459 Ga0495629_0011189 Ga0495629_0011189_1871_2356 156
226 3300046459 Ga0495629_0563129 Ga0495629_0563129_17_502 156
227 3300046462 Ga0495651_0063733 Ga0495651_0063733_2209_2694 156
228 3300046477 Ga0495664_0191005 Ga0495664_0191005_55_540 156
229 3300046492 Ga0495585_0403424 Ga0495585_0403424_94_579 156
230 3300046516 Ga0495628_0022814 Ga0495628_0022814_4118_4603 156
231 3300046529 Ga0495652_0111677 Ga0495652_0111677_64_549 156
232 3300046533 Ga0495640_0038188 Ga0495640_0038188_195_680 156
233 3300046559 Ga0495667_0719620 Ga0495667_0719620_68_553 156
234 3300046642 Ga0495634_0002349 Ga0495634_0002349_14171_14656 156
235 3300046675 Ga0495657_0004261 Ga0495657_0004261_259_744 156
236 3300046689 Ga0495613_0012794 Ga0495613_0012794_767_1252 156
237 3300046690 Ga0495624_0013838 Ga0495624_0013838_2018_2503 156
238 3300046809 Ga0495600_0066880 Ga0495600_0066880_387_872 156
239 3300047315 Ga0495581_0141726 Ga0495581_0141726_156_641 156
240 3300047315 Ga0495581_0328098 Ga0495581_0328098_326_811 156
241 3300047317 Ga0495604_0004161 Ga0495604_0004161_9984_10469 156
242 3300047317 Ga0495604_0023688 Ga0495604_0023688_338_823 156
243 3300047321 Ga0495676_0065668 Ga0495676_0065668_1883_2368 156
244 3300047444 Ga0495675_0420047 Ga0495675_0420047_72_557 156
245 3300048912 Ga0496109_0175233 Ga0496109_0175233_865_1347 156
246 3300048928 Ga0496125_0100641 Ga0496125_0100641_1309_1785 156
247 3300049568 Ga0501031_0022901 Ga0501031_0022901_318_803 156
248 3300049568 Ga0501031_0110575 Ga0501031_0110575_1094_1579 156
249 3300049569 Ga0501032_0006792 Ga0501032_0006792_3083_3568 156
250 3300049569 Ga0501032_0057210 Ga0501032_0057210_1827_2318 156
251 3300049569 Ga0501032_0102601 Ga0501032_0102601_903_1388 156
252 3300049569 Ga0501032_0260875 Ga0501032_0260875_50_535 156
253 3300049570 Ga0501033_0009823 Ga0501033_0009823_1070_1555 156
254 3300049570 Ga0501033_0045162 Ga0501033_0045162_1640_2125 156
255 3300049570 Ga0501033_0075880 Ga0501033_0075880_1698_2183 156
256 3300049571 Ga0501034_0015609 Ga0501034_0015609_5526_6011 156
257 3300049571 Ga0501034_0079386 Ga0501034_0079386_1453_1938 156
258 3300049571 Ga0501034_0089659 Ga0501034_0089659_138_629 156
259 3300049571 Ga0501034_0200757 Ga0501034_0200757_1247_1732 156
260 3300049572 Ga0501036_0006356 Ga0501036_0006356_3356_3841 156
261 3300049572 Ga0501036_0046292 Ga0501036_0046292_76_561 156
262 3300049572 Ga0501036_0089136 Ga0501036_0089136_1559_2044 156
263 3300049573 Ga0501037_0228449 Ga0501037_0228449_149_634 156
264 3300049573 Ga0501037_0362883 Ga0501037_0362883_445_936 156
265 3300049573 Ga0501037_0497317 Ga0501037_0497317_328_813 156
266 3300049573 Ga0501037_0656657 Ga0501037_0656657_185_670 156
267 3300049574 Ga0501038_0009857 Ga0501038_0009857_7935_8426 156
268 3300049574 Ga0501038_0027683 Ga0501038_0027683_3726_4211 156
269 3300049574 Ga0501038_0034176 Ga0501038_0034176_1338_1823 156
270 3300049574 Ga0501038_0132507 Ga0501038_0132507_196_681 156
271 3300049575 Ga0501039_0093986 Ga0501039_0093986_179_664 156
272 3300049575 Ga0501039_0101908 Ga0501039_0101908_267_752 156
273 3300049575 Ga0501039_1024187 Ga0501039_1024187_91_576 156
274 3300049578 Ga0501042_0494979 Ga0501042_0494979_113_598 156
275 3300049579 Ga0501043_0009555 Ga0501043_0009555_4031_4522 156
276 3300049579 Ga0501043_0350564 Ga0501043_0350564_88_573 156
277 3300049579 Ga0501043_0470580 Ga0501043_0470580_400_885 156
278 3300049579 Ga0501043_1034592 Ga0501043_1034592_79_564 156
279 3300049580 Ga0501046_0029318 Ga0501046_0029318_3129_3614 156
280 3300049581 Ga0501047_0000182 Ga0501047_0000182_4804_5289 156
281 3300049581 Ga0501047_0002063 Ga0501047_0002063_11085_11576 156
282 3300049581 Ga0501047_0013709 Ga0501047_0013709_1119_1604 156
283 3300049581 Ga0501047_0016826 Ga0501047_0016826_2226_2711 156
284 3300049581 Ga0501047_0197143 Ga0501047_0197143_345_830 156
285 3300049582 Ga0501048_0000162 Ga0501048_0000162_4032_4523 156
286 3300049584 Ga0501068_0072176 Ga0501068_0072176_1527_2012 156
287 3300049586 Ga0501070_0013106 Ga0501070_0013106_2621_3112 156
288 3300049586 Ga0501070_0015126 Ga0501070_0015126_1228_1713 156
289 3300049588 Ga0501072_0338437 Ga0501072_0338437_385_870 156
290 3300049822 Ga0501035_0004758 Ga0501035_0004758_8642_9133 156
291 3300049822 Ga0501035_0009547 Ga0501035_0009547_5270_5755 156
292 3300049822 Ga0501035_0063151 Ga0501035_0063151_1582_2067 156
293 3300049822 Ga0501035_0066287 Ga0501035_0066287_1826_2311 156
294 3300049822 Ga0501035_0067968 Ga0501035_0067968_348_833 156
295 3300049822 Ga0501035_0213085 Ga0501035_0213085_570_1061 156
296 3300049822 Ga0501035_0400720 Ga0501035_0400720_159_644 156
297 3300049822 Ga0501035_0997923 Ga0501035_0997923_16_501 156
298 3300049823 Ga0501044_0011098 Ga0501044_0011098_2715_3206 156
299 3300049823 Ga0501044_0020431 Ga0501044_0020431_1571_2056 156
300 3300049823 Ga0501044_0150745 Ga0501044_0150745_1800_2285 156
301 3300049823 Ga0501044_0230419 Ga0501044_0230419_122_607 156
302 3300049823 Ga0501044_0435199 Ga0501044_0435199_660_1145 156
303 3300049823 Ga0501044_0475925 Ga0501044_0475925_184_669 156
304 3300049823 Ga0501044_0942117 Ga0501044_0942117_149_634 156
305 3300049824 Ga0501045_0027418 Ga0501045_0027418_1263_1748 156
306 3300049824 Ga0501045_0076541 Ga0501045_0076541_1638_2123 156
307 3300049824 Ga0501045_0386304 Ga0501045_0386304_191_676 156
308 3300053118 Ga0500594_0290960 Ga0500594_0290960_17_514 156
309 3300061719 Ga0466962_0002960 Ga0466962_0002960_4163_4648 156
310 3300061719 Ga0466962_0017827 Ga0466962_0017827_2785_3285 156
311 3300005336 Ga0070680_100341402 Ga0070680_1003414022 157
312 3300005983 Ga0081540_1002480 Ga0081540_10024808 157
313 3300006038 Ga0075365_10003068 Ga0075365_100030685 157
314 3300006186 Ga0075369_10105133 Ga0075369_101051333 157
315 3300009545 Ga0105237_10000866 Ga0105237_1000086637 157
316 3300010375 Ga0105239_10024187 Ga0105239_100241875 157
317 3300031251 Ga0265327_10000081 Ga0265327_10000081196 157
318 3300031548 Ga0307408_100676169 Ga0307408_1006761692 157
319 3300031824 Ga0307413_10818514 Ga0307413_108185141 157
320 3300031995 Ga0307409_100355658 Ga0307409_1003556582 157
321 3300042438 Ga0439459_0093326 Ga0439459_0093326_157_639 157
322 3300044694 Ga0466963_0080674 Ga0466963_0080674_1357_1851 157
323 3300044694 Ga0466963_0168803 Ga0466963_0168803_105_608 157
324 3300044842 Ga0466957_0921414 Ga0466957_0921414_107_610 157
325 3300046460 Ga0495638_0192791 Ga0495638_0192791_611_1090 157
326 3300046506 Ga0495583_0148508 Ga0495583_0148508_332_814 157
327 3300046507 Ga0495606_0223100 Ga0495606_0223100_544_1026 157
328 3300046524 Ga0495648_0002584 Ga0495648_0002584_1386_1868 157
329 3300046543 Ga0495645_0335852 Ga0495645_0335852_433_915 157
330 3300046616 Ga0495668_0024608 Ga0495668_0024608_2227_2709 157
331 3300047320 Ga0495672_0002481 Ga0495672_0002481_2243_2725 157
332 3300047320 Ga0495672_0207063 Ga0495672_0207063_429_908 157
333 3300047469 Ga0495673_0001087 Ga0495673_0001087_9607_10089 157
334 3300048903 Ga0496100_0000510 Ga0496100_0000510_2769_3251 157
335 3300048904 Ga0496101_0000011 Ga0496101_0000011_212523_213005 157
336 3300048905 Ga0496102_0000012 Ga0496102_0000012_90470_90952 157
337 3300048906 Ga0496103_0000005 Ga0496103_0000005_224511_224993 157
338 3300048909 Ga0496106_0015219 Ga0496106_0015219_14_496 157
339 3300048910 Ga0496107_0408618 Ga0496107_0408618_205_687 157
340 3300048919 Ga0496116_0000050 Ga0496116_0000050_86691_87173 157
341 3300048920 Ga0496117_0000042 Ga0496117_0000042_224519_225001 157
342 3300048921 Ga0496118_0000037 Ga0496118_0000037_224519_225001 157
343 3300048922 Ga0496119_0007190 Ga0496119_0007190_9568_10050 157
344 3300048922 Ga0496119_0025638 Ga0496119_0025638_395_877 157
345 3300048922 Ga0496119_0261781 Ga0496119_0261781_36_518 157
346 3300048923 Ga0496120_0033242 Ga0496120_0033242_2583_3065 157
347 3300048923 Ga0496120_0230653 Ga0496120_0230653_362_844 157
348 3300048924 Ga0496121_0000039 Ga0496121_0000039_344022_344504 157
349 3300048929 Ga0496126_0000236 Ga0496126_0000236_42407_42889 157
350 3300049586 Ga0501070_0049933 Ga0501070_0049933_2925_3431 157
351 3300050516 nmdc:mga0sz30_98735_c1 nmdc:mga0sz30_98735_c1_159_641 157
352 3300053105 Ga0500557_056121 Ga0500557_056121_589_1068 157
353 3300053139 Ga0500568_0045525 Ga0500568_0045525_995_1474 157
354 3300053158 Ga0500627_0026944 Ga0500627_0026944_129_608 157
355 3300005330 Ga0070690_100186386 Ga0070690_1001863862 158
356 3300005336 Ga0070680_100064860 Ga0070680_1000648602 158
357 3300005338 Ga0068868_100027988 Ga0068868_1000279884 158
358 3300005366 Ga0070659_100000619 Ga0070659_1000006196 158
359 3300005366 Ga0070659_100011660 Ga0070659_1000116605 158
360 3300005458 Ga0070681_10060887 Ga0070681_100608872 158
361 3300005530 Ga0070679_100001838 Ga0070679_10000183818 158
362 3300005530 Ga0070679_100963694 Ga0070679_1009636941 158
363 3300005577 Ga0068857_100569646 Ga0068857_1005696462 158
364 3300005617 Ga0068859_100009356 Ga0068859_1000093564 158
365 3300005841 Ga0068863_100000454 Ga0068863_10000045431 158
366 3300005842 Ga0068858_100000068 Ga0068858_10000006819 158
367 3300005844 Ga0068862_100000021 Ga0068862_100000021177 158
368 3300005937 Ga0081455_10000115 Ga0081455_1000011567 158
369 3300006931 Ga0097620_100001250 Ga0097620_10000125019 158
370 3300006931 Ga0097620_100009356 Ga0097620_1000093564 158
371 3300009101 Ga0105247_10000164 Ga0105247_1000016421 158
372 3300009177 Ga0105248_10001671 Ga0105248_1000167119 158
373 3300009177 Ga0105248_10014721 Ga0105248_100147219 158
374 3300009545 Ga0105237_10017292 Ga0105237_100172924 158
375 3300009545 Ga0105237_10332253 Ga0105237_103322533 158
376 3300009553 Ga0105249_10081232 Ga0105249_100812321 158
377 3300013102 Ga0157371_10034848 Ga0157371_100348482 158
378 3300013105 Ga0157369_10002905 Ga0157369_1000290518 158
379 3300013105 Ga0157369_10048713 Ga0157369_100487133 158
380 3300013297 Ga0157378_11420824 Ga0157378_114208241 158
381 3300014325 Ga0163163_10055387 Ga0163163_100553872 158
382 3300014325 Ga0163163_10066713 Ga0163163_100667132 158
383 3300014968 Ga0157379_10000014 Ga0157379_1000001485 158
384 3300014968 Ga0157379_10227253 Ga0157379_102272532 158
385 3300020082 Ga0206353_11029603 Ga0206353_1102960311 158
386 3300021384 Ga0213876_10002533 Ga0213876_100025333 158
387 3300025900 Ga0207710_10000178 Ga0207710_1000017821 158
388 3300025909 Ga0207705_10002849 Ga0207705_100028497 158
389 3300025909 Ga0207705_10123795 Ga0207705_101237951 158
390 3300025912 Ga0207707_10001139 Ga0207707_1000113921 158
391 3300025914 Ga0207671_10053160 Ga0207671_100531604 158
392 3300025914 Ga0207671_11043583 Ga0207671_110435832 158
393 3300025917 Ga0207660_10011557 Ga0207660_100115575 158
394 3300025919 Ga0207657_10208006 Ga0207657_102080062 158
395 3300025921 Ga0207652_10000651 Ga0207652_1000065131 158
396 3300025932 Ga0207690_10003694 Ga0207690_1000369411 158
397 3300025932 Ga0207690_10010459 Ga0207690_100104594 158
398 3300025941 Ga0207711_10000929 Ga0207711_100009299 158
399 3300025941 Ga0207711_10164269 Ga0207711_101642692 158
400 3300025961 Ga0207712_10018571 Ga0207712_100185712 158
401 3300026023 Ga0207677_10030768 Ga0207677_100307682 158
402 3300026035 Ga0207703_10000083 Ga0207703_1000008385 158
403 3300026035 Ga0207703_10011620 Ga0207703_100116202 158
404 3300026088 Ga0207641_10004238 Ga0207641_100042384 158
405 3300026116 Ga0207674_10082595 Ga0207674_100825952 158
406 3300028380 Ga0268265_10000034 Ga0268265_1000003423 158
407 3300028800 Ga0265338_10178478 Ga0265338_101784782 158
408 3300028800 Ga0265338_10342401 Ga0265338_103424012 158
409 3300031241 Ga0265325_10020517 Ga0265325_100205173 158
410 3300031247 Ga0265340_10021442 Ga0265340_100214423 158
411 3300031249 Ga0265339_10148093 Ga0265339_101480932 158
412 3300031711 Ga0265314_10288254 Ga0265314_102882542 158
413 3300031712 Ga0265342_10049524 Ga0265342_100495243 158
414 3300033180 Ga0307510_10252098 Ga0307510_102520982 158
415 3300039437 Ga0436365_0849899 Ga0436365_0849899_1674_2180 158
416 3300044656 Ga0466969_0029043 Ga0466969_0029043_439_921 158
417 3300044765 Ga0466970_0007042 Ga0466970_0007042_3601_4083 158
418 3300045049 Ga0466959_0184335 Ga0466959_0184335_562_1044 158
419 3300045049 Ga0466959_0458305 Ga0466959_0458305_175_657 158
420 3300045836 Ga0466958_0041862 Ga0466958_0041862_763_1266 158
421 3300045836 Ga0466958_0867069 Ga0466958_0867069_87_572 158
422 3300045976 Ga0466967_0325290 Ga0466967_0325290_583_1089 158
423 3300048909 Ga0496106_0672727 Ga0496106_0672727_115_597 158
424 3300048913 Ga0496110_1104394 Ga0496110_1104394_23_526 158
425 3300048922 Ga0496119_0000375 Ga0496119_0000375_39142_39624 158
426 3300048923 Ga0496120_0000453 Ga0496120_0000453_42236_42718 158
427 3300003373 JGI25407J50210_10006107 JGI25407J50210_100061072 159
428 3300005937 Ga0081455_10008371 Ga0081455_100083717 159
429 3300005981 Ga0081538_10001227 Ga0081538_100012276 159
430 3300006844 Ga0075428_100026586 Ga0075428_1000265862 159
431 3300006847 Ga0075431_100379944 Ga0075431_1003799442 159
432 3300006880 Ga0075429_100269208 Ga0075429_1002692082 159
433 3300025924 Ga0207694_11601143 Ga0207694_116011431 159
434 3300044694 Ga0466963_0112695 Ga0466963_0112695_106_636 159
435 3300044842 Ga0466957_0097101 Ga0466957_0097101_487_993 159
436 3300044901 Ga0466960_0167874 Ga0466960_0167874_497_988 159
437 3300044901 Ga0466960_0211669 Ga0466960_0211669_129_632 159
438 3300045976 Ga0466967_1029398 Ga0466967_1029398_134_640 159
439 3300048912 Ga0496109_1008777 Ga0496109_1008777_227_712 159
440 3300049569 Ga0501032_0273260 Ga0501032_0273260_16_531 159
441 3300049571 Ga0501034_0629542 Ga0501034_0629542_307_822 159
442 3300049571 Ga0501034_1169466 Ga0501034_1169466_25_555 159
443 3300049581 Ga0501047_0305882 Ga0501047_0305882_50_595 159
444 3300049583 Ga0501067_0038950 Ga0501067_0038950_1147_1635 159
445 3300049585 Ga0501069_0046556 Ga0501069_0046556_992_1531 159
446 3300049586 Ga0501070_0002856 Ga0501070_0002856_7026_7541 159
447 3300049586 Ga0501070_0037849 Ga0501070_0037849_1451_1996 159
448 3300049586 Ga0501070_0043045 Ga0501070_0043045_2471_3034 159
449 3300049589 Ga0501073_0012996 Ga0501073_0012996_2808_3323 159
450 3300049589 Ga0501073_0149215 Ga0501073_0149215_97_636 159
451 3300049590 Ga0501074_0010059 Ga0501074_0010059_3800_4315 159
452 3300049741 Ga0501079_0031834 Ga0501079_0031834_2766_3281 159
453 3300049742 Ga0501080_0000943 Ga0501080_0000943_15750_16265 159
454 3300049742 Ga0501080_0022348 Ga0501080_0022348_4317_4856 159
455 3300049742 Ga0501080_0648517 Ga0501080_0648517_105_650 159
456 3300049823 Ga0501044_0141808 Ga0501044_0141808_1436_1981 159
457 3300049823 Ga0501044_0261606 Ga0501044_0261606_951_1466 159
458 3300050508 nmdc:mga09592_272218_c1 nmdc:mga09592_272218_c1_425_913 159
459 3300050510 nmdc:mga06r32_384031_c1 nmdc:mga06r32_384031_c1_348_836 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00885

DMRL_synthase

6,7-dimethyl-8-ribityllumazine synthase

27

165

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j07-assembly1.cif.gz_B crystal structure of a probable riboflavin synthase, beta chain ribh (6,7-dimethyl-8-ribityllumazine synthase, dmrl synthase, lumazine synthase) from mycobacterium leprae 0.9731 11 159
4j07-assembly1.cif.gz_B crystal structure of a probable riboflavin synthase, beta chain ribh (6,7-dimethyl-8-ribityllumazine synthase, dmrl synthase, lumazine synthase) from mycobacterium leprae 0.9667 11 159
2c9b-assembly2.cif.gz_G lumazine synthase from mycobacterium tuberculosus bound to 3-(1,3,7- trihydro-9-d-ribityl-2,6,8-purinetrione-7-yl) 0.964 14 159
2c9b-assembly2.cif.gz_G lumazine synthase from mycobacterium tuberculosus bound to 3-(1,3,7- trihydro-9-d-ribityl-2,6,8-purinetrione-7-yl) 0.9448 14 159
1c41-assembly1.cif.gz_A crystal structures of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly 0.9439 11 151
ID Description Score Start End Superfamily
2vi5I00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.969 12 159 3.40.50.960
2vi5I00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9437 12 159 3.40.50.960
4kq6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9345 12 150 3.40.50.960
af_Q57751_4_141_3.40.50.960 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9336 17 156 3.40.50.960
3mk3100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.927 10 150 3.40.50.960
ID Description Score Start End GO Terms
AF-A0A7W5T3Z0-F1-model_v4 deleted 0.9798 17 156
AF-A0A6J6J2Z3-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78) 0.9778 12 150 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A6A9UXY3-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9775 5 156 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A0K2RD09-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9759 31 156 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A6J6NTG3-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78) 0.9747 16 149 GO:0000906
GO:0005829
GO:0009231
GO:0009349

Feature Viewer

pLDDT pTM Quality
92.29 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map