F448342

General Info

Members Datasets Scaffolds Average Seq Length
459 264 450 326

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100038068|Ga0075429_1000380684
Length 367
Sequence MDSVFSVAAGDFGINSFPRSKGSVTYAATGKTLPIGTMAALQISLACCDYDRTRAIFDGRAPIEGCEVLPVAVEPEEAFHRAFSSQEFDVSEISISSHTLLTSRGENHYVGIPAFVSRLFRHSGIYIRTDRGIDRPQALAGRTIGLPEYQITANVWIRGILQDDFGLKPESVHWRRGGLENAGRGERAPLKLPPGIDLQQVADGKTLSGMLEAGELDAVVSARAPSCFERGAPHIARLFPDYRRVEEDYFRRTKIFPTMHIIGIRKSLAERHPWLPVSVLKAFVRARNLTTYELGQIGHLFVSLPWGVSEFEKARALMGDDYWSYGFEPNRHVLETFTRYHHEQGLSARRVAPEELFARSTLDLTRI

Samples

Sample ID Description Type Environment
1 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
2 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
3 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
4 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
5 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
6 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
7 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
8 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
9 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
164 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
165 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
166 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
169 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
170 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
172 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
188 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
189 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
259 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
260 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
261 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.04
Metatranscriptomes 0
Isolates 1.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.09
Nodule 1.31
Rhizoplane 1.31
Rhizosphere 91.07
Stem 0
Stem Tuber 0
Unclassified 5.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10022477 3300005295 Bacteria 1679
2 Ga0070658_10003152 3300005327 Bacteria 13604
3 Ga0070658_10133370 3300005327 Bacteria 2071
4 Ga0070658_10137297 3300005327 Bacteria 2041
5 Ga0070658_10325325 3300005327 Unclassified 1313
6 Ga0070676_10135691 3300005328 Bacteria 1561
7 Ga0070683_100001263 3300005329 Bacteria 19249
8 Ga0070683_100006960 3300005329 Bacteria 9511
9 Ga0070690_100017191 3300005330 Bacteria 4344
10 Ga0070670_100001718 3300005331 Bacteria 17833
11 Ga0070670_100032647 3300005331 Bacteria 4484
12 Ga0068869_100001126 3300005334 Bacteria 15595
13 Ga0070666_10007797 3300005335 Bacteria 6613
14 Ga0070666_10105726 3300005335 Bacteria 1944
15 Ga0070680_100028991 3300005336 Bacteria 4444
16 Ga0070680_100055227 3300005336 Bacteria 3245
17 Ga0070680_100080125 3300005336 Bacteria 2693
18 Ga0068868_100011252 3300005338 Bacteria 6516
19 Ga0068868_100067955 3300005338 Bacteria 2837
20 Ga0070660_100012254 3300005339 Bacteria 6118
21 Ga0070660_100012678 3300005339 Bacteria 6025
22 Ga0070661_100001948 3300005344 Bacteria 14288
23 Ga0070661_100033241 3300005344 Bacteria 3735
24 Ga0070692_10000881 3300005345 Bacteria 10136
25 Ga0070692_10046553 3300005345 Bacteria 2242
26 Ga0070668_100192008 3300005347 Bacteria 1673
27 Ga0070669_100028122 3300005353 Bacteria 4047
28 Ga0070675_100100581 3300005354 Unclassified 2435
29 Ga0070675_100102835 3300005354 Bacteria 2408
30 Ga0070671_100017459 3300005355 Bacteria 5813
31 Ga0070671_100039981 3300005355 Bacteria 3894
32 Ga0070674_100025303 3300005356 Bacteria 3863
33 Ga0070674_100039229 3300005356 Bacteria 3197
34 Ga0070673_100204458 3300005364 Bacteria 1702
35 Ga0070659_100000995 3300005366 Bacteria 20803
36 Ga0070659_100038894 3300005366 Bacteria 3711
37 Ga0070659_100165744 3300005366 Bacteria 1808
38 Ga0070667_100020847 3300005367 Bacteria 5443
39 Ga0070667_100041623 3300005367 Bacteria 3854
40 Ga0070667_100125699 3300005367 Bacteria 2235
41 Ga0070709_10008498 3300005434 Bacteria 5638
42 Ga0070709_10013790 3300005434 Bacteria 4554
43 Ga0070714_100001965 3300005435 Bacteria 15018
44 Ga0070714_100004289 3300005435 Bacteria 10744
45 Ga0070713_100419455 3300005436 Bacteria 1252
46 Ga0070710_10013249 3300005437 Bacteria 4123
47 Ga0070710_10049652 3300005437 Bacteria 2348
48 Ga0070705_100031849 3300005440 Bacteria 2924
49 Ga0070694_100007362 3300005444 Bacteria 6712
50 Ga0070694_100010715 3300005444 Bacteria 5668
51 Ga0070694_100105468 3300005444 Bacteria 2000
52 Ga0070663_100005452 3300005455 Bacteria 7557
53 Ga0070663_100006118 3300005455 Bacteria 7203
54 Ga0070678_100036838 3300005456 Bacteria 3428
55 Ga0070678_100063264 3300005456 Bacteria 2737
56 Ga0070678_100185065 3300005456 Bacteria 1708
57 Ga0070662_100044599 3300005457 Bacteria 3177
58 Ga0070662_100050391 3300005457 Bacteria 3004
59 Ga0070662_100057663 3300005457 Bacteria 2823
60 Ga0070681_10033139 3300005458 Bacteria 5185
61 Ga0070681_10113372 3300005458 Bacteria 2650
62 Ga0070681_10139082 3300005458 Bacteria 2358
63 Ga0070681_10287435 3300005458 Bacteria 1555
64 Ga0068867_100083923 3300005459 Unclassified 2406
65 Ga0068867_100100798 3300005459 Bacteria 2205
66 Ga0070706_100018157 3300005467 Bacteria 6489
67 Ga0070707_100067299 3300005468 Bacteria 3446
68 Ga0070699_100003405 3300005518 Bacteria 14073
69 Ga0070699_100192227 3300005518 Bacteria 1813
70 Ga0070679_100050859 3300005530 Bacteria 4128
71 Ga0070679_100052257 3300005530 Bacteria 4071
72 Ga0070679_100091300 3300005530 Bacteria 3034
73 Ga0070684_100005508 3300005535 Bacteria 9709
74 Ga0070684_100017735 3300005535 Bacteria 5850
75 Ga0070697_100013857 3300005536 Bacteria 6327
76 Ga0068853_100031579 3300005539 Bacteria 4480
77 Ga0068853_100291413 3300005539 Bacteria 1507
78 Ga0070672_100026713 3300005543 Bacteria 4301
79 Ga0070695_100013780 3300005545 Bacteria 4861
80 Ga0070695_100072484 3300005545 Bacteria 2258
81 Ga0070696_100000287 3300005546 Bacteria 30454
82 Ga0070696_100053877 3300005546 Bacteria 2801
83 Ga0070693_100008837 3300005547 Bacteria 4993
84 Ga0070693_100112923 3300005547 Bacteria 1674
85 Ga0070665_100003399 3300005548 Bacteria 17013
86 Ga0070665_100016892 3300005548 Bacteria 7318
87 Ga0070704_100001530 3300005549 Bacteria 12483
88 Ga0070704_100149645 3300005549 Bacteria 1834
89 Ga0068855_100160386 3300005563 Bacteria 2553
90 Ga0068855_100355838 3300005563 Bacteria 1612
91 Ga0070664_100015389 3300005564 Bacteria 6255
92 Ga0070664_100017471 3300005564 Bacteria 5890
93 Ga0068857_100233630 3300005577 Bacteria 1682
94 Ga0068854_100001155 3300005578 Bacteria 15873
95 Ga0068854_100015415 3300005578 Bacteria 5062
96 Ga0068856_100002796 3300005614 Bacteria 17862
97 Ga0068852_100041485 3300005616 Bacteria 3889
98 Ga0068852_100043396 3300005616 Bacteria 3814
99 Ga0068852_100105120 3300005616 Unclassified 2557
100 Ga0068864_100017691 3300005618 Bacteria 5945
101 Ga0068864_100046181 3300005618 Bacteria 3736
102 Ga0068861_100027792 3300005719 Bacteria 4124
103 Ga0068851_10001702 3300005834 Bacteria 9622
104 Ga0068851_10032742 3300005834 Bacteria 2587
105 Ga0068863_100038502 3300005841 Bacteria 4549
106 Ga0068863_100103040 3300005841 Bacteria 2714
107 Ga0068858_100126670 3300005842 Bacteria 2392
108 Ga0068858_100293586 3300005842 Bacteria 1550
109 Ga0068860_100025713 3300005843 Bacteria 5678
110 Ga0068860_100138615 3300005843 Bacteria 2337
111 Ga0068860_100172065 3300005843 Bacteria 2092
112 Ga0068862_100072045 3300005844 Bacteria 2984
113 Ga0068862_100178955 3300005844 Bacteria 1902
114 Ga0081455_10012821 3300005937 Bacteria 8327
115 Ga0081539_10005942 3300005985 Bacteria 12046
116 Ga0070717_10019421 3300006028 Bacteria 5328
117 Ga0070717_10115652 3300006028 Bacteria 2292
118 Ga0070717_10415356 3300006028 Bacteria 1210
119 Ga0075368_10029526 3300006042 Bacteria 2120
120 Ga0070716_100004977 3300006173 Bacteria 6400
121 Ga0070716_100008455 3300006173 Bacteria 5105
122 Ga0097621_100008818 3300006237 Bacteria 7289
123 Ga0068871_100004432 3300006358 Bacteria 9765
124 Ga0068871_100187043 3300006358 Unclassified 1782
125 Ga0075428_100001740 3300006844 Bacteria 23245
126 Ga0075428_100026141 3300006844 Bacteria 6464
127 Ga0075430_100000043 3300006846 Bacteria 66210
128 Ga0075430_100119710 3300006846 Bacteria 2195
129 Ga0075431_100006881 3300006847 Bacteria 11300
130 Ga0075433_10000927 3300006852 Bacteria 20670
131 Ga0075433_10339519 3300006852 Bacteria 1328
132 Ga0075434_100001439 3300006871 Bacteria 19976
133 Ga0075434_100002868 3300006871 Bacteria 15291
134 Ga0075434_100086874 3300006871 Bacteria 3128
135 Ga0075429_100000315 3300006880 Bacteria 34594
136 Ga0075429_100038068 3300006880 Bacteria 4186
137 Ga0075429_100318663 3300006880 Unclassified 1361
138 Ga0075436_100000231 3300006914 Bacteria 34915
139 Ga0075436_100000407 3300006914 Bacteria 27718
140 Ga0075436_100044516 3300006914 Bacteria 3061
141 Ga0075435_100049637 3300007076 Bacteria 3375
142 Ga0075435_100084199 3300007076 Bacteria 2616
143 Ga0099795_10001107 3300007788 Bacteria 5602
144 Ga0099795_10018930 3300007788 Bacteria 2221
145 Ga0099795_10023219 3300007788 Bacteria 2056
146 Ga0099795_10067665 3300007788 Bacteria 1341
147 Ga0105240_10006140 3300009093 Bacteria 17719
148 Ga0105240_10030849 3300009093 Bacteria 6962
149 Ga0111539_10040818 3300009094 Bacteria 5584
150 Ga0111539_10111567 3300009094 Bacteria 3209
151 Ga0111539_10263206 3300009094 Bacteria 2007
152 Ga0111539_10500908 3300009094 Bacteria 1415
153 Ga0105245_10004806 3300009098 Bacteria 11921
154 Ga0114129_10022567 3300009147 Bacteria 8929
155 Ga0114129_10046044 3300009147 Bacteria 6131
156 Ga0114129_10434335 3300009147 Bacteria 1725
157 Ga0114129_10528183 3300009147 Bacteria 1537
158 Ga0105241_10000655 3300009174 Bacteria 25975
159 Ga0105241_10018920 3300009174 Bacteria 5076
160 Ga0105248_10028719 3300009177 Bacteria 6200
161 Ga0105248_10040181 3300009177 Bacteria 5244
162 Ga0105237_10012240 3300009545 Bacteria 9043
163 Ga0105237_10030887 3300009545 Bacteria 5436
164 Ga0105238_10167578 3300009551 Bacteria 2172
165 Ga0105238_10363440 3300009551 Bacteria 1437
166 Ga0105249_10125888 3300009553 Unclassified 2440
167 Ga0105246_10010341 3300011119 Bacteria 5770
168 Ga0157373_10002847 3300013100 Bacteria 13090
169 Ga0157373_10012894 3300013100 Bacteria 6137
170 Ga0157371_10022023 3300013102 Bacteria 4676
171 Ga0157371_10040899 3300013102 Bacteria 3309
172 Ga0157370_10006420 3300013104 Bacteria 12972
173 Ga0157370_10026132 3300013104 Bacteria 5768
174 Ga0157370_10045259 3300013104 Bacteria 4223
175 Ga0157370_10132772 3300013104 Bacteria 2322
176 Ga0157370_10189338 3300013104 Bacteria 1910
177 Ga0157369_10013018 3300013105 Bacteria 9423
178 Ga0157369_10036404 3300013105 Bacteria 5392
179 Ga0157369_10141784 3300013105 Bacteria 2543
180 Ga0157374_10303132 3300013296 Bacteria 1581
181 Ga0163162_10084337 3300013306 Bacteria 3252
182 Ga0163162_10163835 3300013306 Bacteria 2346
183 Ga0157372_10114073 3300013307 Bacteria 3097
184 Ga0157372_10239325 3300013307 Bacteria 2106
185 Ga0157375_10016845 3300013308 Bacteria 6579
186 Ga0157375_10053654 3300013308 Bacteria 3968
187 Ga0157375_10087305 3300013308 Bacteria 3171
188 Ga0163163_10067530 3300014325 Bacteria 3555
189 Ga0163163_10072176 3300014325 Bacteria 3441
190 Ga0157380_10119420 3300014326 Bacteria 2230
191 Ga0157379_10345615 3300014968 Bacteria 1361
192 Ga0157376_10003017 3300014969 Bacteria 11548
193 Ga0213874_10053637 3300021377 Bacteria 1244
194 Ga0207656_10016479 3300025321 Bacteria 2878
195 Ga0207692_10163611 3300025898 Bacteria 1284
196 Ga0207680_10020403 3300025903 Bacteria 3566
197 Ga0207680_10077461 3300025903 Bacteria 2080
198 Ga0207699_10003773 3300025906 Bacteria 7234
199 Ga0207705_10036084 3300025909 Bacteria 3538
200 Ga0207705_10209126 3300025909 Bacteria 1480
201 Ga0207684_10046224 3300025910 Bacteria 3693
202 Ga0207654_10002565 3300025911 Bacteria 9221
203 Ga0207654_10066613 3300025911 Bacteria 2125
204 Ga0207707_10000952 3300025912 Bacteria 27860
205 Ga0207707_10005041 3300025912 Bacteria 11594
206 Ga0207707_10005301 3300025912 Bacteria 11275
207 Ga0207695_10009526 3300025913 Bacteria 12009
208 Ga0207695_10031387 3300025913 Bacteria 5827
209 Ga0207671_10021840 3300025914 Bacteria 4849
210 Ga0207693_10001209 3300025915 Bacteria 23010
211 Ga0207693_10002655 3300025915 Bacteria 15538
212 Ga0207660_10001956 3300025917 Bacteria 13742
213 Ga0207657_10000245 3300025919 Bacteria 57819
214 Ga0207657_10002473 3300025919 Bacteria 19994
215 Ga0207652_10002834 3300025921 Bacteria 14542
216 Ga0207652_10062901 3300025921 Bacteria 3208
217 Ga0207652_10144496 3300025921 Bacteria 2128
218 Ga0207652_10248343 3300025921 Bacteria 1605
219 Ga0207681_10039640 3300025923 Bacteria 3129
220 Ga0207681_10164649 3300025923 Bacteria 1675
221 Ga0207694_10049984 3300025924 Bacteria 3237
222 Ga0207694_10123401 3300025924 Bacteria 2070
223 Ga0207650_10000711 3300025925 Bacteria 25962
224 Ga0207650_10064152 3300025925 Bacteria 2749
225 Ga0207650_10071157 3300025925 Bacteria 2616
226 Ga0207650_10226118 3300025925 Unclassified 1508
227 Ga0207659_10036803 3300025926 Bacteria 3394
228 Ga0207687_10026453 3300025927 Bacteria 3886
229 Ga0207664_10048653 3300025929 Bacteria 3335
230 Ga0207664_10122170 3300025929 Bacteria 2181
231 Ga0207644_10013103 3300025931 Bacteria 5520
232 Ga0207690_10021219 3300025932 Plasmid 4025
233 Ga0207690_10028513 3300025932 Bacteria 3539
234 Ga0207706_10033987 3300025933 Bacteria 4538
235 Ga0207706_10041834 3300025933 Bacteria 4061
236 Ga0207706_10227872 3300025933 Bacteria 1631
237 Ga0207670_10039316 3300025936 Bacteria 3097
238 Ga0207670_10133077 3300025936 Bacteria 1824
239 Ga0207669_10018531 3300025937 Bacteria 3602
240 Ga0207665_10001529 3300025939 Bacteria 15562
241 Ga0207665_10094769 3300025939 Bacteria 2074
242 Ga0207691_10000706 3300025940 Bacteria 33060
243 Ga0207691_10011247 3300025940 Bacteria 8586
244 Ga0207691_10095026 3300025940 Bacteria 2666
245 Ga0207711_10305931 3300025941 Unclassified 1467
246 Ga0207689_10003727 3300025942 Bacteria 13896
247 Ga0207661_10144509 3300025944 Unclassified 2050
248 Ga0207667_10004566 3300025949 Bacteria 16976
249 Ga0207667_10215151 3300025949 Unclassified 1969
250 Ga0207651_10120320 3300025960 Bacteria 1990
251 Ga0207651_10142035 3300025960 Bacteria 1856
252 Ga0207668_10047795 3300025972 Bacteria 2932
253 Ga0207668_10173866 3300025972 Bacteria 1692
254 Ga0207640_10006031 3300025981 Bacteria 6625
255 Ga0207640_10031660 3300025981 Bacteria 3271
256 Ga0207658_10233797 3300025986 Bacteria 1553
257 Ga0207677_10006877 3300026023 Bacteria 6252
258 Ga0207677_10115232 3300026023 Bacteria 2010
259 Ga0207639_10005943 3300026041 Bacteria 8278
260 Ga0207639_10041349 3300026041 Bacteria 3448
261 Ga0207678_10003144 3300026067 Bacteria 14935
262 Ga0207678_10044110 3300026067 Bacteria 3858
263 Ga0207702_10020697 3300026078 Bacteria 5443
264 Ga0207641_10003755 3300026088 Bacteria 13339
265 Ga0207641_10028078 3300026088 Bacteria 4647
266 Ga0207641_10079298 3300026088 Bacteria 2846
267 Ga0207648_10018056 3300026089 Bacteria 6392
268 Ga0207648_10096887 3300026089 Unclassified 2581
269 Ga0207676_10219412 3300026095 Bacteria 1692
270 Ga0207674_10000253 3300026116 Bacteria 66599
271 Ga0207674_10001876 3300026116 Bacteria 26767
272 Ga0207674_10223461 3300026116 Bacteria 1831
273 Ga0207675_100379827 3300026118 Bacteria 1389
274 Ga0207683_10000261 3300026121 Bacteria 47116
275 Ga0207683_10007772 3300026121 Bacteria 9174
276 Ga0207683_10089709 3300026121 Bacteria 2736
277 Ga0207698_10005430 3300026142 Bacteria 7879
278 Ga0207698_10037481 3300026142 Bacteria 3572
279 Ga0207428_10007750 3300027907 Bacteria 9770
280 Ga0207428_10022708 3300027907 Bacteria 5289
281 Ga0268266_10013186 3300028379 Bacteria 7127
282 Ga0268266_10042859 3300028379 Bacteria 3867
283 Ga0268265_10257902 3300028380 Bacteria 1548
284 Ga0268265_10334742 3300028380 Bacteria 1376
285 Ga0268264_10203057 3300028381 Bacteria 1814
286 Ga0268264_10382108 3300028381 Bacteria 1349
287 Ga0265339_10005501 3300031249 Bacteria 8439
288 Ga0307509_10054839 3300031507 Bacteria 4240
289 Ga0307508_10000051 3300031616 Bacteria 134500
290 Ga0307508_10120096 3300031616 Bacteria 2230
291 Ga0307516_10007922 3300031730 Bacteria 12102
292 Ga0307516_10141188 3300031730 Unclassified 2178
293 Ga0307407_10012448 3300031903 Bacteria 4089
294 Ga0307409_100189313 3300031995 Bacteria 1830
295 Ga0307507_10061691 3300033179 Bacteria 3489
296 Ga0316215_1000908 3300033544 Bacteria 2897
297 Ga0373958_0008540 3300034819 Bacteria 1662
298 Ga0373959_0017068 3300034820 Bacteria 1352
299 Ga0373926_0000366 3300035083 Bacteria 11528
300 Ga0373929_0029890 3300035085 Bacteria 1159
301 Ga0373951_0007992 3300035091 Bacteria 2397
302 Ga0373936_0084990 3300035113 Bacteria 1321
303 Ga0373939_0025685 3300035114 Unclassified 1653
304 Ga0373945_0059995 3300035116 Bacteria 1418
305 Ga0373946_0000833 3300035171 Bacteria 10545
306 Ga0373962_0012046 3300035242 Bacteria 2175
307 Ga0373931_0019522 3300035691 Bacteria 3384
308 Ga0373931_0144317 3300035691 Bacteria 1382
309 Ga0373935_0103297 3300035692 Bacteria 1882
310 Ga0373935_0121494 3300035692 Bacteria 1746
311 Ga0373935_0242519 3300035692 Bacteria 1259
312 Ga0373927_0021161 3300035695 Bacteria 4261
313 Ga0373927_0040907 3300035695 Bacteria 3006
314 Ga0373927_0060907 3300035695 Bacteria 2442
315 Ga0373927_0185314 3300035695 Bacteria 1365
316 Ga0373947_0018903 3300035725 Bacteria 3970
317 Ga0373937_0035162 3300036401 Bacteria 4559
318 Ga0373925_0127722 3300037068 Bacteria 1979
319 Ga0373925_0218386 3300037068 Bacteria 1521
320 Ga0373925_0224571 3300037068 Bacteria 1500
321 Ga0395905_0046355 3300037471 Bacteria 4076
322 Ga0436364_0953789 3300037853 Bacteria 5220
323 Ga0436364_1047360 3300037853 Bacteria 1321
324 Ga0395901_0041311 3300038443 Bacteria 4779
325 Ga0395901_0075488 3300038443 Bacteria 3516
326 Ga0436365_0138582 3300039437 Bacteria 2719
327 Ga0436361_0837780 3300039447 Bacteria 1687
328 Ga0436363_0521698 3300039450 Bacteria 1256
329 Ga0439453_0027187 3300041408 Unclassified 1064
330 Ga0439443_001236 3300042003 Bacteria 2745
331 Ga0439460_0000415 3300042461 Bacteria 9118
332 Ga0451577_0030656 3300042876 Bacteria 4857
333 Ga0466969_0111267 3300044656 Unclassified 1282
334 Ga0466957_0006648 3300044842 Bacteria 6538
335 Ga0451576_0000220 3300045051 Bacteria 141261
336 Ga0466958_0101913 3300045836 Bacteria 1786
337 Ga0495603_0005429 3300046455 Bacteria 7610
338 Ga0495603_0312618 3300046455 Bacteria 902
339 Ga0495580_0003516 3300046472 Bacteria 13315
340 Ga0495639_0006968 3300046475 Bacteria 4856
341 Ga0495662_0043668 3300046476 Bacteria 2164
342 Ga0495664_0175633 3300046477 Bacteria 1299
343 Ga0495630_0134280 3300046517 Bacteria 1880
344 Ga0495666_0010218 3300046526 Bacteria 4683
345 Ga0495665_0017908 3300046531 Bacteria 3807
346 Ga0495640_0025297 3300046533 Bacteria 4308
347 Ga0495586_0014175 3300046535 Bacteria 4236
348 Ga0495622_0082411 3300046557 Bacteria 1480
349 Ga0495622_0109970 3300046557 Unclassified 1262
350 Ga0495635_0274983 3300046663 Bacteria 1132
351 Ga0495599_0006095 3300046678 Bacteria 7259
352 Ga0495647_0001389 3300046681 Bacteria 7466
353 Ga0495658_0032949 3300046683 Bacteria 2833
354 Ga0495658_0234889 3300046683 Bacteria 1150
355 Ga0495613_0151314 3300046689 Bacteria 1655
356 Ga0495671_0089307 3300046692 Bacteria 1509
357 Ga0495600_0162080 3300046809 Bacteria 1445
358 Ga0495581_0168172 3300047315 Unclassified 1282
359 Ga0495676_0056364 3300047321 Bacteria 3108
360 Ga0495675_0291456 3300047444 Bacteria 971
361 Ga0495684_0246342 3300047471 Bacteria 1301
362 Ga0495684_0291067 3300047471 Bacteria 1176
363 Ga0496102_0034034 3300048905 Bacteria 4582
364 Ga0496106_0001765 3300048909 Bacteria 16152
365 Ga0496106_0026428 3300048909 Bacteria 4323
366 Ga0496109_0319413 3300048912 Bacteria 1465
367 Ga0496110_0082420 3300048913 Bacteria 2869
368 Ga0496114_0044539 3300048917 Bacteria 3682
369 Ga0496117_0101286 3300048920 Bacteria 1822
370 Ga0496121_0008347 3300048924 Bacteria 12227
371 Ga0496121_0008776 3300048924 Bacteria 11790
372 Ga0496121_0024223 3300048924 Bacteria 5814
373 Ga0496124_0001579 3300048927 Bacteria 32910
374 Ga0496126_0000122 3300048929 Bacteria 182785
375 Ga0496126_0008384 3300048929 Bacteria 11153
376 Ga0496126_0027352 3300048929 Bacteria 5449
377 Ga0496126_0101171 3300048929 Bacteria 2521
378 Ga0501031_0004981 3300049568 Bacteria 8636
379 Ga0501036_0196466 3300049572 Bacteria 1697
380 Ga0501037_0008414 3300049573 Bacteria 7567
381 Ga0501038_0034252 3300049574 Bacteria 4466
382 Ga0501038_0158638 3300049574 Bacteria 1840
383 Ga0501039_0000671 3300049575 Bacteria 24660
384 Ga0501040_0044929 3300049576 Bacteria 3012
385 Ga0501041_0004303 3300049577 Bacteria 8239
386 Ga0501041_0019087 3300049577 Bacteria 4089
387 Ga0501041_0157878 3300049577 Bacteria 1417
388 Ga0501042_0022391 3300049578 Bacteria 4414
389 Ga0501042_0075381 3300049578 Bacteria 2414
390 Ga0501068_0009863 3300049584 Bacteria 5350
391 Ga0501068_0236544 3300049584 Bacteria 1162
392 Ga0501068_0253871 3300049584 Bacteria 1121
393 Ga0501071_0008631 3300049587 Bacteria 6736
394 Ga0501071_0140320 3300049587 Bacteria 1799
395 Ga0501071_0582934 3300049587 Bacteria 859
396 Ga0501072_0006550 3300049588 Bacteria 8870
397 Ga0501073_0093121 3300049589 Bacteria 2094
398 Ga0501074_0012431 3300049590 Bacteria 6188
399 Ga0501075_0007669 3300049591 Bacteria 7490
400 Ga0501075_0073664 3300049591 Bacteria 2582
401 Ga0501076_0000181 3300049592 Bacteria 37445
402 Ga0501076_0001724 3300049592 Bacteria 14784
403 Ga0501077_0354409 3300049593 Bacteria 936
404 Ga0501079_0000510 3300049741 Bacteria 25226
405 Ga0501079_0073290 3300049741 Bacteria 2646
406 Ga0501080_0009100 3300049742 Bacteria 9040
407 Ga0501080_0208034 3300049742 Bacteria 1794
408 Ga0501080_0375361 3300049742 Unclassified 1282
409 Ga0501081_0012872 3300049743 Bacteria 5502
410 Ga0501081_0087123 3300049743 Bacteria 2193
411 Ga0501081_0146643 3300049743 Unclassified 1694
412 Ga0501081_0219093 3300049743 Bacteria 1384
413 Ga0501083_0137694 3300049744 Bacteria 1599
414 Ga0501044_0200314 3300049823 Bacteria 1955
415 Ga0501045_0009236 3300049824 Bacteria 6894
416 nmdc:mga05p37_467_c1 3300050507 Bacteria 11202
417 nmdc:mga05p37_483112_c1 3300050507 Bacteria 1426
418 nmdc:mga05p37_612901_c1 3300050507 Bacteria 1226
419 nmdc:mga09592_34624_c1 3300050508 Bacteria 4222
420 nmdc:mga09592_381482_c1 3300050508 Unclassified 1219
421 nmdc:mga09592_45339_c1 3300050508 Bacteria 3704
422 nmdc:mga0qj67_38003_c1 3300050509 Bacteria 3775
423 nmdc:mga0qj67_80_c1 3300050509 Bacteria 66211
424 nmdc:mga08y16_10282_c1 3300050511 Bacteria 9821
425 nmdc:mga08y16_16106_c1 3300050511 Bacteria 7863
426 nmdc:mga08y16_272003_c1 3300050511 Bacteria 1749
427 nmdc:mga0n895_1623_c1 3300050512 Bacteria 16964
428 nmdc:mga0n895_17431_c1 3300050512 Bacteria 6617
429 nmdc:mga0n895_2650_c1 3300050512 Bacteria 14113
430 nmdc:mga0n895_37570_c1 3300050512 Bacteria 4686
431 nmdc:mga0n895_440923_c1 3300050512 Bacteria 1315
432 nmdc:mga0rr50_235_c1 3300050513 Bacteria 30007
433 nmdc:mga0rr50_585_c1 3300050513 Bacteria 19523
434 nmdc:mga08x19_19700_c1 3300050514 Bacteria 4144
435 nmdc:mga08x19_45560_c1 3300050514 Bacteria 2803
436 nmdc:mga08x19_55466_c1 3300050514 Bacteria 2554
437 nmdc:mga08x19_89977_c1 3300050514 Bacteria 2025
438 nmdc:mga0a205_123_c1 3300050515 Bacteria 47084
439 nmdc:mga0a205_177167_c1 3300050515 Bacteria 2027
440 Ga0495595_0173752 3300053084 Bacteria 1067
441 Ga0495619_0127110 3300053085 Bacteria 1750
442 Ga0500556_0000026 3300053104 Bacteria 166874
443 Ga0500603_048406 3300053150 Bacteria 1156
444 Ga0500616_0000108 3300053153 Bacteria 152917
445 Ga0500627_0065030 3300053158 Bacteria 1609
446 Ga0501082_0007347 3300060353 Bacteria 9507
447 Ga0501082_0012109 3300060353 Bacteria 7411
448 Ga0466962_0052175 3300061719 Bacteria 1955
449 Ga0530510_0006200 3300061734 Bacteria 8309
450 Ga0530510_0190623 3300061734 Bacteria 1522

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_0044539 Ga0496114_0044539_2850_3668 263
2 3300049593 Ga0501077_0354409 Ga0501077_0354409_14_805 263
3 3300049577 Ga0501041_0157878 Ga0501041_0157878_49_843 264
4 3300046455 Ga0495603_0312618 Ga0495603_0312618_64_888 265
5 3300047444 Ga0495675_0291456 Ga0495675_0291456_16_840 265
6 3300049587 Ga0501071_0582934 Ga0501071_0582934_21_821 266
7 3300053084 Ga0495595_0173752 Ga0495595_0173752_202_1047 272
8 3300046663 Ga0495635_0274983 Ga0495635_0274983_21_911 287
9 3300048913 Ga0496110_0082420 Ga0496110_0082420_1959_2849 287
10 3300047471 Ga0495684_0246342 Ga0495684_0246342_11_901 288
11 3300035116 Ga0373945_0059995 Ga0373945_0059995_298_1287 293
12 3300050514 nmdc:mga08x19_89977_c1 nmdc:mga08x19_89977_c1_40_963 297
13 3300009177 Ga0105248_10028719 Ga0105248_100287192 298
14 3300013306 Ga0163162_10084337 Ga0163162_100843374 298
15 3300049574 Ga0501038_0158638 Ga0501038_0158638_19_915 298
16 3300039447 Ga0436361_0837780 Ga0436361_0837780_248_1237 299
17 3300034820 Ga0373959_0017068 Ga0373959_0017068_13_918 301
18 3300049743 Ga0501081_0087123 Ga0501081_0087123_344_1249 301
19 3300035692 Ga0373935_0242519 Ga0373935_0242519_40_1008 308
20 3300046683 Ga0495658_0234889 Ga0495658_0234889_65_1033 308
21 3300041408 Ga0439453_0027187 Ga0439453_0027187_87_1019 310
22 3300042003 Ga0439443_001236 Ga0439443_001236_852_1784 310
23 3300042461 Ga0439460_0000415 Ga0439460_0000415_5479_6411 310
24 3300061734 Ga0530510_0190623 Ga0530510_0190623_131_1063 310
25 iso_pu_bacteria 2510065057 2510307656 310
26 iso_pu_bacteria 2516653046 2516897890 310
27 iso_pu_bacteria 2643221689 2644501176 310
28 iso_pu_bacteria 2842922631 2842927447 310
29 iso_pu_bacteria 2916021584 2916026347 310
30 iso_pu_bacteria 2916048683 2916053811 310
31 iso_pu_bacteria 2916076590 2916081034 310
32 iso_pu_bacteria 2970082768 2970084734 310
33 iso_pu_bacteria 2989349275 2989351298 310
34 3300013104 Ga0157370_10132772 Ga0157370_101327723 311
35 3300050507 nmdc:mga05p37_467_c1 nmdc:mga05p37_467_c1_6461_7396 311
36 3300050508 nmdc:mga09592_45339_c1 nmdc:mga09592_45339_c1_982_1917 311
37 3300050511 nmdc:mga08y16_16106_c1 nmdc:mga08y16_16106_c1_6349_7284 311
38 3300050515 nmdc:mga0a205_177167_c1 nmdc:mga0a205_177167_c1_861_1796 311
39 3300049572 Ga0501036_0196466 Ga0501036_0196466_727_1665 312
40 3300049576 Ga0501040_0044929 Ga0501040_0044929_151_1089 312
41 3300049577 Ga0501041_0019087 Ga0501041_0019087_59_997 312
42 3300049578 Ga0501042_0075381 Ga0501042_0075381_95_1033 312
43 3300049584 Ga0501068_0253871 Ga0501068_0253871_86_1024 312
44 3300049591 Ga0501075_0007669 Ga0501075_0007669_4292_5230 312
45 3300049592 Ga0501076_0000181 Ga0501076_0000181_13424_14362 312
46 3300049741 Ga0501079_0073290 Ga0501079_0073290_98_1036 312
47 3300049742 Ga0501080_0208034 Ga0501080_0208034_735_1673 312
48 3300049742 Ga0501080_0375361 Ga0501080_0375361_317_1255 312
49 3300049743 Ga0501081_0012872 Ga0501081_0012872_4484_5422 312
50 3300049743 Ga0501081_0146643 Ga0501081_0146643_572_1510 312
51 3300049824 Ga0501045_0009236 Ga0501045_0009236_4263_5201 312
52 3300060353 Ga0501082_0012109 Ga0501082_0012109_1102_2040 312
53 3300061734 Ga0530510_0006200 Ga0530510_0006200_608_1546 312
54 3300031995 Ga0307409_100189313 Ga0307409_1001893132 313
55 3300035692 Ga0373935_0121494 Ga0373935_0121494_542_1528 313
56 3300048924 Ga0496121_0024223 Ga0496121_0024223_3159_4142 313
57 3300049584 Ga0501068_0236544 Ga0501068_0236544_175_1116 313
58 3300005336 Ga0070680_100028991 Ga0070680_1000289912 314
59 3300005336 Ga0070680_100080125 Ga0070680_1000801252 314
60 3300005434 Ga0070709_10013790 Ga0070709_100137902 314
61 3300005436 Ga0070713_100419455 Ga0070713_1004194552 314
62 3300005437 Ga0070710_10013249 Ga0070710_100132492 314
63 3300005458 Ga0070681_10113372 Ga0070681_101133723 314
64 3300005530 Ga0070679_100091300 Ga0070679_1000913002 314
65 3300005549 Ga0070704_100149645 Ga0070704_1001496451 314
66 3300005563 Ga0068855_100160386 Ga0068855_1001603861 314
67 3300005719 Ga0068861_100027792 Ga0068861_1000277922 314
68 3300005842 Ga0068858_100126670 Ga0068858_1001266702 314
69 3300005937 Ga0081455_10012821 Ga0081455_100128219 314
70 3300006028 Ga0070717_10019421 Ga0070717_100194214 314
71 3300006028 Ga0070717_10115652 Ga0070717_101156522 314
72 3300006028 Ga0070717_10415356 Ga0070717_104153562 314
73 3300006042 Ga0075368_10029526 Ga0075368_100295262 314
74 3300006173 Ga0070716_100004977 Ga0070716_1000049773 314
75 3300006846 Ga0075430_100000043 Ga0075430_1000000435 314
76 3300006871 Ga0075434_100001439 Ga0075434_10000143910 314
77 3300006871 Ga0075434_100086874 Ga0075434_1000868743 314
78 3300007076 Ga0075435_100084199 Ga0075435_1000841993 314
79 3300007788 Ga0099795_10001107 Ga0099795_100011072 314
80 3300007788 Ga0099795_10018930 Ga0099795_100189301 314
81 3300007788 Ga0099795_10023219 Ga0099795_100232192 314
82 3300007788 Ga0099795_10067665 Ga0099795_100676651 314
83 3300009147 Ga0114129_10046044 Ga0114129_100460444 314
84 3300009147 Ga0114129_10528183 Ga0114129_105281831 314
85 3300009551 Ga0105238_10363440 Ga0105238_103634402 314
86 3300013104 Ga0157370_10189338 Ga0157370_101893382 314
87 3300013308 Ga0157375_10053654 Ga0157375_100536542 314
88 3300014968 Ga0157379_10345615 Ga0157379_103456151 314
89 3300021377 Ga0213874_10053637 Ga0213874_100536371 314
90 3300025898 Ga0207692_10163611 Ga0207692_101636111 314
91 3300025912 Ga0207707_10005041 Ga0207707_100050414 314
92 3300025913 Ga0207695_10031387 Ga0207695_100313873 314
93 3300025915 Ga0207693_10002655 Ga0207693_100026552 314
94 3300025921 Ga0207652_10248343 Ga0207652_102483431 314
95 3300025924 Ga0207694_10123401 Ga0207694_101234012 314
96 3300025929 Ga0207664_10048653 Ga0207664_100486532 314
97 3300025939 Ga0207665_10001529 Ga0207665_100015293 314
98 3300031507 Ga0307509_10054839 Ga0307509_100548394 314
99 3300031616 Ga0307508_10000051 Ga0307508_100000519 314
100 3300031616 Ga0307508_10120096 Ga0307508_101200962 314
101 3300031730 Ga0307516_10007922 Ga0307516_1000792210 314
102 3300031730 Ga0307516_10141188 Ga0307516_101411882 314
103 3300033179 Ga0307507_10061691 Ga0307507_100616912 314
104 3300033544 Ga0316215_1000908 Ga0316215_10009081 314
105 3300035113 Ga0373936_0084990 Ga0373936_0084990_78_1067 314
106 3300035695 Ga0373927_0021161 Ga0373927_0021161_1772_2761 314
107 3300035695 Ga0373927_0060907 Ga0373927_0060907_24_1013 314
108 3300035695 Ga0373927_0185314 Ga0373927_0185314_10_999 314
109 3300035725 Ga0373947_0018903 Ga0373947_0018903_1510_2499 314
110 3300036401 Ga0373937_0035162 Ga0373937_0035162_3407_4396 314
111 3300037068 Ga0373925_0218386 Ga0373925_0218386_74_1063 314
112 3300037068 Ga0373925_0224571 Ga0373925_0224571_489_1478 314
113 3300037853 Ga0436364_0953789 Ga0436364_0953789_143_1126 314
114 3300039437 Ga0436365_0138582 Ga0436365_0138582_1662_2648 314
115 3300039450 Ga0436363_0521698 Ga0436363_0521698_170_1159 314
116 3300045836 Ga0466958_0101913 Ga0466958_0101913_364_1350 314
117 3300046476 Ga0495662_0043668 Ga0495662_0043668_1122_2111 314
118 3300046477 Ga0495664_0175633 Ga0495664_0175633_51_1040 314
119 3300046533 Ga0495640_0025297 Ga0495640_0025297_1105_2094 314
120 3300046557 Ga0495622_0082411 Ga0495622_0082411_100_1089 314
121 3300046689 Ga0495613_0151314 Ga0495613_0151314_578_1567 314
122 3300046692 Ga0495671_0089307 Ga0495671_0089307_334_1323 314
123 3300046809 Ga0495600_0162080 Ga0495600_0162080_156_1145 314
124 3300047471 Ga0495684_0291067 Ga0495684_0291067_63_1052 314
125 3300048909 Ga0496106_0001765 Ga0496106_0001765_315_1304 314
126 3300048920 Ga0496117_0101286 Ga0496117_0101286_69_1058 314
127 3300048924 Ga0496121_0008776 Ga0496121_0008776_10455_11444 314
128 3300048927 Ga0496124_0001579 Ga0496124_0001579_31635_32624 314
129 3300048929 Ga0496126_0008384 Ga0496126_0008384_9863_10852 314
130 3300048929 Ga0496126_0101171 Ga0496126_0101171_1236_2225 314
131 3300050507 nmdc:mga05p37_612901_c1 nmdc:mga05p37_612901_c1_201_1190 314
132 3300050509 nmdc:mga0qj67_80_c1 nmdc:mga0qj67_80_c1_3540_4529 314
133 3300050512 nmdc:mga0n895_17431_c1 nmdc:mga0n895_17431_c1_4084_5073 314
134 3300050512 nmdc:mga0n895_2650_c1 nmdc:mga0n895_2650_c1_6281_7270 314
135 3300050512 nmdc:mga0n895_440923_c1 nmdc:mga0n895_440923_c1_175_1164 314
136 3300053085 Ga0495619_0127110 Ga0495619_0127110_97_1086 314
137 3300053104 Ga0500556_0000026 Ga0500556_0000026_83417_84403 314
138 3300053150 Ga0500603_048406 Ga0500603_048406_58_1047 314
139 3300005295 Ga0065707_10022477 Ga0065707_100224772 315
140 3300005327 Ga0070658_10003152 Ga0070658_100031523 315
141 3300005327 Ga0070658_10133370 Ga0070658_101333702 315
142 3300005327 Ga0070658_10137297 Ga0070658_101372972 315
143 3300005327 Ga0070658_10325325 Ga0070658_103253251 315
144 3300005328 Ga0070676_10135691 Ga0070676_101356912 315
145 3300005329 Ga0070683_100001263 Ga0070683_1000012636 315
146 3300005329 Ga0070683_100006960 Ga0070683_1000069608 315
147 3300005330 Ga0070690_100017191 Ga0070690_1000171913 315
148 3300005331 Ga0070670_100001718 Ga0070670_10000171813 315
149 3300005331 Ga0070670_100032647 Ga0070670_1000326472 315
150 3300005334 Ga0068869_100001126 Ga0068869_1000011268 315
151 3300005335 Ga0070666_10007797 Ga0070666_100077975 315
152 3300005335 Ga0070666_10105726 Ga0070666_101057261 315
153 3300005336 Ga0070680_100055227 Ga0070680_1000552273 315
154 3300005338 Ga0068868_100011252 Ga0068868_1000112524 315
155 3300005338 Ga0068868_100067955 Ga0068868_1000679552 315
156 3300005339 Ga0070660_100012254 Ga0070660_1000122544 315
157 3300005339 Ga0070660_100012678 Ga0070660_1000126783 315
158 3300005344 Ga0070661_100001948 Ga0070661_1000019482 315
159 3300005344 Ga0070661_100033241 Ga0070661_1000332412 315
160 3300005345 Ga0070692_10000881 Ga0070692_100008818 315
161 3300005345 Ga0070692_10046553 Ga0070692_100465532 315
162 3300005347 Ga0070668_100192008 Ga0070668_1001920081 315
163 3300005353 Ga0070669_100028122 Ga0070669_1000281224 315
164 3300005354 Ga0070675_100100581 Ga0070675_1001005812 315
165 3300005354 Ga0070675_100102835 Ga0070675_1001028352 315
166 3300005355 Ga0070671_100017459 Ga0070671_1000174596 315
167 3300005355 Ga0070671_100039981 Ga0070671_1000399814 315
168 3300005356 Ga0070674_100025303 Ga0070674_1000253032 315
169 3300005356 Ga0070674_100039229 Ga0070674_1000392294 315
170 3300005364 Ga0070673_100204458 Ga0070673_1002044582 315
171 3300005366 Ga0070659_100000995 Ga0070659_10000099513 315
172 3300005366 Ga0070659_100038894 Ga0070659_1000388945 315
173 3300005366 Ga0070659_100165744 Ga0070659_1001657442 315
174 3300005367 Ga0070667_100020847 Ga0070667_1000208473 315
175 3300005367 Ga0070667_100041623 Ga0070667_1000416231 315
176 3300005367 Ga0070667_100125699 Ga0070667_1001256993 315
177 3300005434 Ga0070709_10008498 Ga0070709_100084982 315
178 3300005435 Ga0070714_100001965 Ga0070714_1000019656 315
179 3300005435 Ga0070714_100004289 Ga0070714_10000428910 315
180 3300005437 Ga0070710_10049652 Ga0070710_100496522 315
181 3300005440 Ga0070705_100031849 Ga0070705_1000318493 315
182 3300005444 Ga0070694_100007362 Ga0070694_1000073625 315
183 3300005444 Ga0070694_100010715 Ga0070694_1000107155 315
184 3300005444 Ga0070694_100105468 Ga0070694_1001054682 315
185 3300005455 Ga0070663_100005452 Ga0070663_1000054522 315
186 3300005455 Ga0070663_100006118 Ga0070663_1000061184 315
187 3300005456 Ga0070678_100036838 Ga0070678_1000368383 315
188 3300005456 Ga0070678_100063264 Ga0070678_1000632643 315
189 3300005456 Ga0070678_100185065 Ga0070678_1001850652 315
190 3300005457 Ga0070662_100044599 Ga0070662_1000445992 315
191 3300005457 Ga0070662_100050391 Ga0070662_1000503914 315
192 3300005457 Ga0070662_100057663 Ga0070662_1000576633 315
193 3300005458 Ga0070681_10033139 Ga0070681_100331395 315
194 3300005458 Ga0070681_10139082 Ga0070681_101390822 315
195 3300005458 Ga0070681_10287435 Ga0070681_102874351 315
196 3300005459 Ga0068867_100083923 Ga0068867_1000839231 315
197 3300005459 Ga0068867_100100798 Ga0068867_1001007982 315
198 3300005467 Ga0070706_100018157 Ga0070706_1000181574 315
199 3300005468 Ga0070707_100067299 Ga0070707_1000672994 315
200 3300005518 Ga0070699_100003405 Ga0070699_1000034059 315
201 3300005518 Ga0070699_100192227 Ga0070699_1001922272 315
202 3300005530 Ga0070679_100050859 Ga0070679_1000508592 315
203 3300005530 Ga0070679_100052257 Ga0070679_1000522572 315
204 3300005535 Ga0070684_100005508 Ga0070684_1000055085 315
205 3300005535 Ga0070684_100017735 Ga0070684_1000177354 315
206 3300005536 Ga0070697_100013857 Ga0070697_1000138574 315
207 3300005539 Ga0068853_100031579 Ga0068853_1000315795 315
208 3300005539 Ga0068853_100291413 Ga0068853_1002914132 315
209 3300005543 Ga0070672_100026713 Ga0070672_1000267135 315
210 3300005545 Ga0070695_100013780 Ga0070695_1000137803 315
211 3300005545 Ga0070695_100072484 Ga0070695_1000724842 315
212 3300005546 Ga0070696_100000287 Ga0070696_10000028729 315
213 3300005546 Ga0070696_100053877 Ga0070696_1000538771 315
214 3300005547 Ga0070693_100008837 Ga0070693_1000088373 315
215 3300005547 Ga0070693_100112923 Ga0070693_1001129231 315
216 3300005548 Ga0070665_100003399 Ga0070665_1000033999 315
217 3300005548 Ga0070665_100016892 Ga0070665_1000168921 315
218 3300005549 Ga0070704_100001530 Ga0070704_1000015308 315
219 3300005563 Ga0068855_100355838 Ga0068855_1003558382 315
220 3300005564 Ga0070664_100015389 Ga0070664_1000153893 315
221 3300005564 Ga0070664_100017471 Ga0070664_1000174715 315
222 3300005577 Ga0068857_100233630 Ga0068857_1002336303 315
223 3300005578 Ga0068854_100001155 Ga0068854_10000115515 315
224 3300005578 Ga0068854_100015415 Ga0068854_1000154155 315
225 3300005614 Ga0068856_100002796 Ga0068856_1000027969 315
226 3300005616 Ga0068852_100041485 Ga0068852_1000414854 315
227 3300005616 Ga0068852_100043396 Ga0068852_1000433962 315
228 3300005616 Ga0068852_100105120 Ga0068852_1001051203 315
229 3300005618 Ga0068864_100017691 Ga0068864_1000176912 315
230 3300005618 Ga0068864_100046181 Ga0068864_1000461812 315
231 3300005834 Ga0068851_10001702 Ga0068851_100017029 315
232 3300005834 Ga0068851_10032742 Ga0068851_100327422 315
233 3300005841 Ga0068863_100038502 Ga0068863_1000385022 315
234 3300005841 Ga0068863_100103040 Ga0068863_1001030402 315
235 3300005842 Ga0068858_100293586 Ga0068858_1002935861 315
236 3300005843 Ga0068860_100025713 Ga0068860_1000257135 315
237 3300005843 Ga0068860_100138615 Ga0068860_1001386152 315
238 3300005843 Ga0068860_100172065 Ga0068860_1001720652 315
239 3300005844 Ga0068862_100072045 Ga0068862_1000720452 315
240 3300005844 Ga0068862_100178955 Ga0068862_1001789552 315
241 3300005985 Ga0081539_10005942 Ga0081539_100059427 315
242 3300006173 Ga0070716_100008455 Ga0070716_1000084555 315
243 3300006237 Ga0097621_100008818 Ga0097621_1000088183 315
244 3300006358 Ga0068871_100004432 Ga0068871_1000044326 315
245 3300006358 Ga0068871_100187043 Ga0068871_1001870432 315
246 3300006844 Ga0075428_100001740 Ga0075428_10000174020 315
247 3300006844 Ga0075428_100026141 Ga0075428_1000261412 315
248 3300006846 Ga0075430_100119710 Ga0075430_1001197102 315
249 3300006847 Ga0075431_100006881 Ga0075431_1000068812 315
250 3300006852 Ga0075433_10000927 Ga0075433_100009278 315
251 3300006852 Ga0075433_10339519 Ga0075433_103395192 315
252 3300006871 Ga0075434_100002868 Ga0075434_1000028688 315
253 3300006880 Ga0075429_100000315 Ga0075429_10000031516 315
254 3300006880 Ga0075429_100038068 Ga0075429_1000380684 315
255 3300006880 Ga0075429_100318663 Ga0075429_1003186632 315
256 3300006914 Ga0075436_100000231 Ga0075436_10000023116 315
257 3300006914 Ga0075436_100000407 Ga0075436_10000040723 315
258 3300006914 Ga0075436_100044516 Ga0075436_1000445163 315
259 3300007076 Ga0075435_100049637 Ga0075435_1000496374 315
260 3300009093 Ga0105240_10006140 Ga0105240_100061407 315
261 3300009093 Ga0105240_10030849 Ga0105240_100308495 315
262 3300009094 Ga0111539_10040818 Ga0111539_100408186 315
263 3300009094 Ga0111539_10111567 Ga0111539_101115672 315
264 3300009094 Ga0111539_10263206 Ga0111539_102632062 315
265 3300009094 Ga0111539_10500908 Ga0111539_105009081 315
266 3300009098 Ga0105245_10004806 Ga0105245_100048069 315
267 3300009147 Ga0114129_10022567 Ga0114129_100225678 315
268 3300009147 Ga0114129_10434335 Ga0114129_104343352 315
269 3300009174 Ga0105241_10000655 Ga0105241_1000065514 315
270 3300009174 Ga0105241_10018920 Ga0105241_100189205 315
271 3300009177 Ga0105248_10040181 Ga0105248_100401812 315
272 3300009545 Ga0105237_10012240 Ga0105237_100122407 315
273 3300009545 Ga0105237_10030887 Ga0105237_100308874 315
274 3300009551 Ga0105238_10167578 Ga0105238_101675782 315
275 3300009553 Ga0105249_10125888 Ga0105249_101258883 315
276 3300011119 Ga0105246_10010341 Ga0105246_100103415 315
277 3300013100 Ga0157373_10002847 Ga0157373_100028474 315
278 3300013100 Ga0157373_10012894 Ga0157373_100128943 315
279 3300013102 Ga0157371_10022023 Ga0157371_100220234 315
280 3300013102 Ga0157371_10040899 Ga0157371_100408992 315
281 3300013104 Ga0157370_10006420 Ga0157370_100064205 315
282 3300013104 Ga0157370_10026132 Ga0157370_100261324 315
283 3300013104 Ga0157370_10045259 Ga0157370_100452593 315
284 3300013105 Ga0157369_10013018 Ga0157369_100130184 315
285 3300013105 Ga0157369_10036404 Ga0157369_100364042 315
286 3300013105 Ga0157369_10141784 Ga0157369_101417842 315
287 3300013296 Ga0157374_10303132 Ga0157374_103031322 315
288 3300013306 Ga0163162_10163835 Ga0163162_101638352 315
289 3300013307 Ga0157372_10114073 Ga0157372_101140733 315
290 3300013307 Ga0157372_10239325 Ga0157372_102393251 315
291 3300013308 Ga0157375_10016845 Ga0157375_100168455 315
292 3300013308 Ga0157375_10087305 Ga0157375_100873052 315
293 3300014325 Ga0163163_10067530 Ga0163163_100675302 315
294 3300014325 Ga0163163_10072176 Ga0163163_100721762 315
295 3300014326 Ga0157380_10119420 Ga0157380_101194202 315
296 3300014969 Ga0157376_10003017 Ga0157376_100030172 315
297 3300025321 Ga0207656_10016479 Ga0207656_100164792 315
298 3300025903 Ga0207680_10020403 Ga0207680_100204033 315
299 3300025903 Ga0207680_10077461 Ga0207680_100774612 315
300 3300025906 Ga0207699_10003773 Ga0207699_100037736 315
301 3300025909 Ga0207705_10036084 Ga0207705_100360843 315
302 3300025909 Ga0207705_10209126 Ga0207705_102091262 315
303 3300025910 Ga0207684_10046224 Ga0207684_100462245 315
304 3300025911 Ga0207654_10002565 Ga0207654_100025658 315
305 3300025911 Ga0207654_10066613 Ga0207654_100666132 315
306 3300025912 Ga0207707_10000952 Ga0207707_1000095214 315
307 3300025912 Ga0207707_10005301 Ga0207707_100053013 315
308 3300025913 Ga0207695_10009526 Ga0207695_100095264 315
309 3300025914 Ga0207671_10021840 Ga0207671_100218401 315
310 3300025915 Ga0207693_10001209 Ga0207693_1000120915 315
311 3300025917 Ga0207660_10001956 Ga0207660_100019566 315
312 3300025919 Ga0207657_10000245 Ga0207657_1000024541 315
313 3300025919 Ga0207657_10002473 Ga0207657_1000247318 315
314 3300025921 Ga0207652_10002834 Ga0207652_100028343 315
315 3300025921 Ga0207652_10062901 Ga0207652_100629014 315
316 3300025921 Ga0207652_10144496 Ga0207652_101444962 315
317 3300025923 Ga0207681_10039640 Ga0207681_100396402 315
318 3300025923 Ga0207681_10164649 Ga0207681_101646492 315
319 3300025924 Ga0207694_10049984 Ga0207694_100499842 315
320 3300025925 Ga0207650_10000711 Ga0207650_1000071120 315
321 3300025925 Ga0207650_10064152 Ga0207650_100641522 315
322 3300025925 Ga0207650_10071157 Ga0207650_100711572 315
323 3300025925 Ga0207650_10226118 Ga0207650_102261182 315
324 3300025926 Ga0207659_10036803 Ga0207659_100368032 315
325 3300025927 Ga0207687_10026453 Ga0207687_100264532 315
326 3300025929 Ga0207664_10122170 Ga0207664_101221703 315
327 3300025931 Ga0207644_10013103 Ga0207644_100131034 315
328 3300025932 Ga0207690_10021219 Ga0207690_100212194 315
329 3300025932 Ga0207690_10028513 Ga0207690_100285132 315
330 3300025933 Ga0207706_10033987 Ga0207706_100339874 315
331 3300025933 Ga0207706_10041834 Ga0207706_100418343 315
332 3300025933 Ga0207706_10227872 Ga0207706_102278722 315
333 3300025936 Ga0207670_10039316 Ga0207670_100393162 315
334 3300025936 Ga0207670_10133077 Ga0207670_101330772 315
335 3300025937 Ga0207669_10018531 Ga0207669_100185312 315
336 3300025939 Ga0207665_10094769 Ga0207665_100947693 315
337 3300025940 Ga0207691_10000706 Ga0207691_100007062 315
338 3300025940 Ga0207691_10011247 Ga0207691_100112475 315
339 3300025940 Ga0207691_10095026 Ga0207691_100950262 315
340 3300025941 Ga0207711_10305931 Ga0207711_103059312 315
341 3300025942 Ga0207689_10003727 Ga0207689_100037276 315
342 3300025944 Ga0207661_10144509 Ga0207661_101445091 315
343 3300025949 Ga0207667_10004566 Ga0207667_1000456613 315
344 3300025949 Ga0207667_10215151 Ga0207667_102151512 315
345 3300025960 Ga0207651_10120320 Ga0207651_101203202 315
346 3300025960 Ga0207651_10142035 Ga0207651_101420352 315
347 3300025972 Ga0207668_10047795 Ga0207668_100477952 315
348 3300025972 Ga0207668_10173866 Ga0207668_101738662 315
349 3300025981 Ga0207640_10006031 Ga0207640_100060315 315
350 3300025981 Ga0207640_10031660 Ga0207640_100316602 315
351 3300025986 Ga0207658_10233797 Ga0207658_102337972 315
352 3300026023 Ga0207677_10006877 Ga0207677_100068775 315
353 3300026023 Ga0207677_10115232 Ga0207677_101152322 315
354 3300026041 Ga0207639_10005943 Ga0207639_100059434 315
355 3300026041 Ga0207639_10041349 Ga0207639_100413494 315
356 3300026067 Ga0207678_10003144 Ga0207678_100031446 315
357 3300026067 Ga0207678_10044110 Ga0207678_100441102 315
358 3300026078 Ga0207702_10020697 Ga0207702_100206973 315
359 3300026088 Ga0207641_10003755 Ga0207641_100037556 315
360 3300026088 Ga0207641_10028078 Ga0207641_100280782 315
361 3300026088 Ga0207641_10079298 Ga0207641_100792982 315
362 3300026089 Ga0207648_10018056 Ga0207648_100180563 315
363 3300026089 Ga0207648_10096887 Ga0207648_100968872 315
364 3300026095 Ga0207676_10219412 Ga0207676_102194122 315
365 3300026116 Ga0207674_10000253 Ga0207674_100002533 315
366 3300026116 Ga0207674_10001876 Ga0207674_1000187616 315
367 3300026116 Ga0207674_10223461 Ga0207674_102234612 315
368 3300026118 Ga0207675_100379827 Ga0207675_1003798272 315
369 3300026121 Ga0207683_10000261 Ga0207683_1000026126 315
370 3300026121 Ga0207683_10007772 Ga0207683_100077725 315
371 3300026121 Ga0207683_10089709 Ga0207683_100897092 315
372 3300026142 Ga0207698_10005430 Ga0207698_100054303 315
373 3300026142 Ga0207698_10037481 Ga0207698_100374812 315
374 3300027907 Ga0207428_10007750 Ga0207428_100077503 315
375 3300027907 Ga0207428_10022708 Ga0207428_100227086 315
376 3300028379 Ga0268266_10013186 Ga0268266_100131867 315
377 3300028379 Ga0268266_10042859 Ga0268266_100428592 315
378 3300028380 Ga0268265_10257902 Ga0268265_102579022 315
379 3300028380 Ga0268265_10334742 Ga0268265_103347421 315
380 3300028381 Ga0268264_10203057 Ga0268264_102030572 315
381 3300028381 Ga0268264_10382108 Ga0268264_103821081 315
382 3300031249 Ga0265339_10005501 Ga0265339_100055018 315
383 3300031903 Ga0307407_10012448 Ga0307407_100124482 315
384 3300034819 Ga0373958_0008540 Ga0373958_0008540_487_1434 315
385 3300035083 Ga0373926_0000366 Ga0373926_0000366_7946_8893 315
386 3300035085 Ga0373929_0029890 Ga0373929_0029890_83_1090 315
387 3300035091 Ga0373951_0007992 Ga0373951_0007992_342_1289 315
388 3300035114 Ga0373939_0025685 Ga0373939_0025685_234_1181 315
389 3300035171 Ga0373946_0000833 Ga0373946_0000833_9330_10277 315
390 3300035242 Ga0373962_0012046 Ga0373962_0012046_696_1643 315
391 3300035691 Ga0373931_0019522 Ga0373931_0019522_2112_3059 315
392 3300035691 Ga0373931_0144317 Ga0373931_0144317_276_1223 315
393 3300035692 Ga0373935_0103297 Ga0373935_0103297_639_1628 315
394 3300035695 Ga0373927_0040907 Ga0373927_0040907_104_1051 315
395 3300037068 Ga0373925_0127722 Ga0373925_0127722_203_1150 315
396 3300037471 Ga0395905_0046355 Ga0395905_0046355_1766_2758 315
397 3300037853 Ga0436364_1047360 Ga0436364_1047360_112_1101 315
398 3300038443 Ga0395901_0041311 Ga0395901_0041311_2111_3103 315
399 3300038443 Ga0395901_0075488 Ga0395901_0075488_762_1754 315
400 3300042876 Ga0451577_0030656 Ga0451577_0030656_2391_3338 315
401 3300044656 Ga0466969_0111267 Ga0466969_0111267_273_1271 315
402 3300044842 Ga0466957_0006648 Ga0466957_0006648_1373_2371 315
403 3300045051 Ga0451576_0000220 Ga0451576_0000220_95995_96942 315
404 3300046455 Ga0495603_0005429 Ga0495603_0005429_1470_2417 315
405 3300046472 Ga0495580_0003516 Ga0495580_0003516_6645_7592 315
406 3300046475 Ga0495639_0006968 Ga0495639_0006968_1697_2644 315
407 3300046517 Ga0495630_0134280 Ga0495630_0134280_574_1521 315
408 3300046526 Ga0495666_0010218 Ga0495666_0010218_3262_4209 315
409 3300046531 Ga0495665_0017908 Ga0495665_0017908_1584_2531 315
410 3300046535 Ga0495586_0014175 Ga0495586_0014175_3074_4021 315
411 3300046557 Ga0495622_0109970 Ga0495622_0109970_127_1074 315
412 3300046678 Ga0495599_0006095 Ga0495599_0006095_2253_3242 315
413 3300046681 Ga0495647_0001389 Ga0495647_0001389_175_1122 315
414 3300046683 Ga0495658_0032949 Ga0495658_0032949_613_1560 315
415 3300047315 Ga0495581_0168172 Ga0495581_0168172_155_1102 315
416 3300047321 Ga0495676_0056364 Ga0495676_0056364_1559_2506 315
417 3300048905 Ga0496102_0034034 Ga0496102_0034034_1296_2288 315
418 3300048909 Ga0496106_0026428 Ga0496106_0026428_1968_2960 315
419 3300048912 Ga0496109_0319413 Ga0496109_0319413_75_1085 315
420 3300048924 Ga0496121_0008347 Ga0496121_0008347_6529_7524 315
421 3300048929 Ga0496126_0000122 Ga0496126_0000122_94977_95975 315
422 3300048929 Ga0496126_0027352 Ga0496126_0027352_2099_3091 315
423 3300049568 Ga0501031_0004981 Ga0501031_0004981_2537_3523 315
424 3300049573 Ga0501037_0008414 Ga0501037_0008414_1324_2310 315
425 3300049574 Ga0501038_0034252 Ga0501038_0034252_211_1197 315
426 3300049575 Ga0501039_0000671 Ga0501039_0000671_1682_2668 315
427 3300049577 Ga0501041_0004303 Ga0501041_0004303_1647_2633 315
428 3300049578 Ga0501042_0022391 Ga0501042_0022391_3338_4324 315
429 3300049584 Ga0501068_0009863 Ga0501068_0009863_464_1450 315
430 3300049587 Ga0501071_0008631 Ga0501071_0008631_5090_6076 315
431 3300049587 Ga0501071_0140320 Ga0501071_0140320_787_1785 315
432 3300049588 Ga0501072_0006550 Ga0501072_0006550_7735_8682 315
433 3300049589 Ga0501073_0093121 Ga0501073_0093121_844_1791 315
434 3300049590 Ga0501074_0012431 Ga0501074_0012431_2360_3346 315
435 3300049591 Ga0501075_0073664 Ga0501075_0073664_300_1286 315
436 3300049592 Ga0501076_0001724 Ga0501076_0001724_9274_10260 315
437 3300049741 Ga0501079_0000510 Ga0501079_0000510_23583_24569 315
438 3300049742 Ga0501080_0009100 Ga0501080_0009100_7812_8798 315
439 3300049743 Ga0501081_0219093 Ga0501081_0219093_364_1362 315
440 3300049744 Ga0501083_0137694 Ga0501083_0137694_384_1331 315
441 3300049823 Ga0501044_0200314 Ga0501044_0200314_826_1833 315
442 3300050507 nmdc:mga05p37_483112_c1 nmdc:mga05p37_483112_c1_220_1212 315
443 3300050508 nmdc:mga09592_34624_c1 nmdc:mga09592_34624_c1_1993_2985 315
444 3300050508 nmdc:mga09592_381482_c1 nmdc:mga09592_381482_c1_134_1126 315
445 3300050509 nmdc:mga0qj67_38003_c1 nmdc:mga0qj67_38003_c1_2530_3522 315
446 3300050511 nmdc:mga08y16_10282_c1 nmdc:mga08y16_10282_c1_7685_8677 315
447 3300050511 nmdc:mga08y16_272003_c1 nmdc:mga08y16_272003_c1_188_1180 315
448 3300050512 nmdc:mga0n895_1623_c1 nmdc:mga0n895_1623_c1_443_1393 315
449 3300050512 nmdc:mga0n895_37570_c1 nmdc:mga0n895_37570_c1_1285_2277 315
450 3300050513 nmdc:mga0rr50_235_c1 nmdc:mga0rr50_235_c1_13443_14393 315
451 3300050513 nmdc:mga0rr50_585_c1 nmdc:mga0rr50_585_c1_16122_17114 315
452 3300050514 nmdc:mga08x19_19700_c1 nmdc:mga08x19_19700_c1_258_1250 315
453 3300050514 nmdc:mga08x19_45560_c1 nmdc:mga08x19_45560_c1_795_1745 315
454 3300050514 nmdc:mga08x19_55466_c1 nmdc:mga08x19_55466_c1_1452_2444 315
455 3300050515 nmdc:mga0a205_123_c1 nmdc:mga0a205_123_c1_32308_33300 315
456 3300053153 Ga0500616_0000108 Ga0500616_0000108_102513_103505 315
457 3300053158 Ga0500627_0065030 Ga0500627_0065030_417_1409 315
458 3300060353 Ga0501082_0007347 Ga0501082_0007347_4652_5638 315
459 3300061719 Ga0466962_0052175 Ga0466962_0052175_80_1078 315

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qnn-assembly1.cif.gz_D crystal structure of phospholipase a 1 from hornet(vespa basalis) venom 0.7392 109 135
2pqq-assembly1.cif.gz_C structural genomics, the crystal structure of the n-terminal domain of a transcriptional regulator from streptomyces coelicolor a3(2) 0.5941 205 238
3uif-assembly1.cif.gz_A crystal structure of putative sulfonate abc transporter, periplasmic sulfonate-binding protein ssua from methylobacillus flagellatus kt 0.5819 2 309
7an6-assembly1.cif.gz_B enzyme of biosynthetic pathway 0.57 1 301
7an9-assembly1.cif.gz_B enzyme of biosynthetic pathway 0.5671 4 301
ID Description Score Start End Superfamily
af_O33182_88_189_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.794 82 133 3.40.190.10
4qnnD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7392 109 135 3.40.50.1820
4dddA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.6483 2 74 3.40.190.10
af_Q2G1L7_145_252_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.6482 81 200 3.40.190.10
3hn0B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.6424 2 72 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A537E5D9-F1-model_v4 4,5-dihydroxyphthalate decarboxylase 0.9695 1 264
AF-A0A537RU90-F1-model_v4 4,5-dihydroxyphthalate decarboxylase 0.9682 2 228
AF-A0A536VYY1-F1-model_v4 4,5-dihydroxyphthalate decarboxylase 0.9661 2 315
AF-A0A2L0AE50-F1-model_v4 4,5-dihydroxyphthalate decarboxylase 0.9653 2 315
AF-A0A839E8B4-F1-model_v4 4,5-dihydroxyphthalate decarboxylase (EC 4.1.1.55) 0.9644 2 315 GO:0016829

Feature Viewer

pLDDT pTM Quality
93.2 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map