F448280

General Info

Members Datasets Scaffolds Average Seq Length
458 365 380 219

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2582581316|2585333631
Length 266
Sequence DSVARFKSQLVTSAARTLDSVFEFLEDDVGAAASQTSFAHDPRSTEDIMRKVIAATFISLDGVIQAPGGPQEDPTGGFEHGGWTFHYFDEATGKALFAIFDKPFDLLLGRKTYDIFAAHWPHAGDDDPIAKQFNRVTKYVATRGNRKLDWNNSQSLGSDVVAGIRELKAGEGPNLLIQGSSDLIQTLLRNGLIDEFNLLIFPLVLGGGKKLFGDGAMPAAMKLLRTQSSPTGVIMATYQPDGPVKTGSFALPDPSDEEIDRRNRLK

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
3 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
4 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
5 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
6 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
7 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
8 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
9 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
10 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
11 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
12 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
13 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
14 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
15 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
16 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
17 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
18 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
19 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
20 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
21 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
22 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
23 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
24 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
25 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
26 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
27 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
28 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
29 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
30 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
31 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
32 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
33 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
34 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
35 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
36 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
37 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
38 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
39 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
40 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
41 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
42 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
43 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
44 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
45 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
46 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
47 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
48 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
49 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
50 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
51 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
52 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
53 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
54 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
55 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
56 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
57 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
58 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
59 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
60 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
61 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
62 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
63 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
64 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
65 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
66 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
67 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
68 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
69 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
70 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
71 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
72 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
73 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
74 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
75 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
76 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
77 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
78 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
79 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
80 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
81 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
82 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
83 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
84 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
85 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
86 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
87 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
88 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
89 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
90 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
91 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
92 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
93 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
94 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
95 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
96 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
97 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
98 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
99 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
100 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
101 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
102 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
103 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
104 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
105 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
106 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
107 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
108 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
109 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
110 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
111 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
112 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
113 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
114 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
115 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
116 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
117 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
118 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
119 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
120 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
121 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
122 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
123 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
124 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
125 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
126 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
127 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
128 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
129 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
130 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
131 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
132 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
133 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
134 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
135 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
136 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
137 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
138 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
139 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
140 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
141 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
142 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
143 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
144 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
145 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
146 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
147 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
148 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
149 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
150 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
151 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
152 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
153 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
154 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
155 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
156 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
157 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
158 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
159 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
160 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
161 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
162 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
163 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
164 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
165 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
166 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
167 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
168 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
169 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
170 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
171 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
172 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
173 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
174 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
175 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
176 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
177 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
178 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
179 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
180 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
181 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
182 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
183 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
184 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
186 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
187 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
236 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
240 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
241 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
242 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
243 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
244 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
245 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
246 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
247 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
248 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
249 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
250 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
251 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
252 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
253 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
254 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
255 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
256 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
257 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
258 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
259 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
260 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
262 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
263 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
264 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
265 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
266 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
267 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
268 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
269 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
270 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
271 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
272 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
273 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
274 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
275 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
276 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
277 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
278 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
279 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
280 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
281 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
282 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
283 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
284 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
285 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
286 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
287 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
288 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
289 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
290 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
291 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
294 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
295 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
296 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
297 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
298 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
299 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
300 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
301 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
302 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
305 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
306 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
307 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
308 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
309 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
310 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
311 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
312 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
316 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
317 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
318 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
319 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
320 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
322 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
323 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
324 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
325 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
326 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
327 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
328 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
329 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
330 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
331 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
332 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
333 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
334 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
335 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
336 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
337 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
338 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
339 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
340 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
341 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
342 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
343 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
344 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
345 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
346 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
347 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
348 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
349 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
350 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
351 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
352 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
353 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
354 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
355 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
356 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
357 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
358 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
359 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
360 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
361 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
362 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
363 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
364 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
365 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.97
Metatranscriptomes 0
Isolates 17.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.86
Nodule 11.57
Rhizoplane 1.97
Rhizosphere 68.56
Stem 0
Stem Tuber 0
Unclassified 10.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002553 3300001979 Bacteria 8212
2 JGI25155J39150_1000011 3300002704 Bacteria 207685
3 JGI25156J39149_1000030 3300002705 Bacteria 126029
4 JGI25162J39368_1001401 3300002737 Bacteria 13172
5 JGI25162J39368_1001515 3300002737 Bacteria 12058
6 JGI25154J39366_1000289 3300002738 Bacteria 30213
7 JGI25157J39369_1000010 3300002741 Bacteria 207685
8 JGI25159J45721_1007706 3300002987 Bacteria 3051
9 JGI25165J46597_1001229 3300003214 Bacteria 15248
10 JGI25165J46597_1004859 3300003214 Bacteria 2734
11 rootH1_10105689 3300003316 Bacteria 3620
12 rootH2_10001490 3300003320 Bacteria 9345
13 rootL2_10075208 3300003322 Bacteria 17065
14 rootH1_10006224 3300003323 Bacteria 10205
15 JGI25160J50197_1000004 3300003354 Bacteria 419797
16 JGI25161J50226_1000003 3300003374 Bacteria 413345
17 Ga0055543_1000001 3300004625 Bacteria 419949
18 Ga0065165_1001508 3300005262 Bacteria 24628
19 Ga0065712_10080891 3300005290 Bacteria 3060
20 Ga0065715_10173728 3300005293 Bacteria 1528
21 Ga0070676_10014118 3300005328 Bacteria 4386
22 Ga0070690_100009348 3300005330 Bacteria 5677
23 Ga0068869_100001572 3300005334 Bacteria 13583
24 Ga0068869_100235695 3300005334 Bacteria 1456
25 Ga0070666_10087456 3300005335 Bacteria 2136
26 Ga0070680_100000978 3300005336 Bacteria 20273
27 Ga0068868_100000036 3300005338 Bacteria 74490
28 Ga0068868_100013619 3300005338 Bacteria 5971
29 Ga0070689_100000194 3300005340 Bacteria 37040
30 Ga0070687_100003801 3300005343 Bacteria 5927
31 Ga0070661_100001270 3300005344 Bacteria 17731
32 Ga0070692_10055450 3300005345 Bacteria 2072
33 Ga0070669_100002925 3300005353 Bacteria 12302
34 Ga0070675_100000517 3300005354 Bacteria 26306
35 Ga0070675_100008116 3300005354 Bacteria 8140
36 Ga0070671_100013385 3300005355 Bacteria 6613
37 Ga0070674_100514148 3300005356 Bacteria 999
38 Ga0070673_100010045 3300005364 Bacteria 6387
39 Ga0070688_100000635 3300005365 Bacteria 17475
40 Ga0070659_100000025 3300005366 Bacteria 144955
41 Ga0070667_100215632 3300005367 Bacteria 1707
42 Ga0070709_10277111 3300005434 Bacteria 1217
43 Ga0070714_100031652 3300005435 Bacteria 4415
44 Ga0070713_100009452 3300005436 Bacteria 6982
45 Ga0070710_10035956 3300005437 Bacteria 2704
46 Ga0070701_10036456 3300005438 Bacteria 2478
47 Ga0070708_100587921 3300005445 Bacteria 1049
48 Ga0070662_100082560 3300005457 Bacteria 2397
49 Ga0070662_100164999 3300005457 Bacteria 1735
50 Ga0070681_10008557 3300005458 Bacteria 10024
51 Ga0070685_10006204 3300005466 Bacteria 6086
52 Ga0070706_100058938 3300005467 Bacteria 3543
53 Ga0070707_100015169 3300005468 Bacteria 7233
54 Ga0070698_100452570 3300005471 Bacteria 1219
55 Ga0070699_100294083 3300005518 Bacteria 1456
56 Ga0070679_100010187 3300005530 Bacteria 8909
57 Ga0070679_100211417 3300005530 Bacteria 1904
58 Ga0070684_100007975 3300005535 Bacteria 8266
59 Ga0070672_100010341 3300005543 Bacteria 6471
60 Ga0070686_100002576 3300005544 Bacteria 9999
61 Ga0070696_100579585 3300005546 Bacteria 902
62 Ga0070665_100053253 3300005548 Bacteria 4058
63 Ga0070665_100690150 3300005548 Bacteria 1034
64 Ga0068855_100125276 3300005563 Bacteria 2938
65 Ga0070664_100000173 3300005564 Bacteria 45248
66 Ga0068857_100027285 3300005577 Bacteria 5036
67 Ga0068854_100098202 3300005578 Bacteria 2191
68 Ga0068856_100070180 3300005614 Bacteria 3465
69 Ga0068856_100144007 3300005614 Bacteria 2391
70 Ga0070702_100011978 3300005615 Bacteria 4329
71 Ga0068859_100002708 3300005617 Bacteria 17978
72 Ga0068864_100000829 3300005618 Bacteria 26078
73 Ga0068864_100846123 3300005618 Bacteria 901
74 Ga0068861_100001405 3300005719 Bacteria 15143
75 Ga0068861_100006525 3300005719 Bacteria 7958
76 Ga0068870_10050717 3300005840 Bacteria 2194
77 Ga0068863_100004115 3300005841 Bacteria 14374
78 Ga0068858_100031834 3300005842 Bacteria 4902
79 Ga0068860_100026455 3300005843 Bacteria 5593
80 Ga0068862_100001554 3300005844 Bacteria 20983
81 Ga0068862_100003156 3300005844 Bacteria 14322
82 Ga0081538_10003863 3300005981 Bacteria 13989
83 Ga0081538_10006679 3300005981 Bacteria 10107
84 Ga0081540_1038002 3300005983 Bacteria 2544
85 Ga0081539_10011340 3300005985 Bacteria 7066
86 Ga0075365_10109918 3300006038 Bacteria 1894
87 Ga0070716_100593532 3300006173 Bacteria 832
88 Ga0070712_100019369 3300006175 Bacteria 4438
89 Ga0075369_10106207 3300006186 Bacteria 1263
90 Ga0075427_10019608 3300006194 Bacteria 1067
91 Ga0075366_10094065 3300006195 Bacteria 1796
92 Ga0068871_100099029 3300006358 Bacteria 2440
93 Ga0075428_100003456 3300006844 Bacteria 17283
94 Ga0075428_100017618 3300006844 Bacteria 7890
95 Ga0075428_100139720 3300006844 Bacteria 2633
96 Ga0075430_100001023 3300006846 Bacteria 22134
97 Ga0075430_100001510 3300006846 Bacteria 18988
98 Ga0075430_100243630 3300006846 Bacteria 1490
99 Ga0075431_100000690 3300006847 Bacteria 29038
100 Ga0075431_100001463 3300006847 Bacteria 21778
101 Ga0075431_100220561 3300006847 Bacteria 1934
102 Ga0075434_100211293 3300006871 Bacteria 1960
103 Ga0075429_100001468 3300006880 Bacteria 19384
104 Ga0068865_100010229 3300006881 Bacteria 5833
105 Ga0097620_100002708 3300006931 Bacteria 17978
106 Ga0105240_10000005 3300009093 Bacteria 702630
107 Ga0105240_10035922 3300009093 Bacteria 6380
108 Ga0105240_10075688 3300009093 Bacteria 4151
109 Ga0111539_10022489 3300009094 Bacteria 7746
110 Ga0111539_10027306 3300009094 Bacteria 6971
111 Ga0111539_10039175 3300009094 Bacteria 5713
112 Ga0111539_10910500 3300009094 Bacteria 1023
113 Ga0105245_10018593 3300009098 Bacteria 6078
114 Ga0105245_10020493 3300009098 Bacteria 5799
115 Ga0105245_10059129 3300009098 Bacteria 3451
116 Ga0114129_10001484 3300009147 Bacteria 31760
117 Ga0114129_10931738 3300009147 Bacteria 1098
118 Ga0114129_11316356 3300009147 Bacteria 895
119 Ga0105243_10687498 3300009148 Bacteria 996
120 Ga0105248_10003681 3300009177 Bacteria 16984
121 Ga0105237_10000773 3300009545 Bacteria 43739
122 Ga0105237_10284099 3300009545 Bacteria 1657
123 Ga0105238_10314482 3300009551 Bacteria 1551
124 Ga0105249_10007372 3300009553 Bacteria 9594
125 Ga0105239_10014053 3300010375 Bacteria 8887
126 Ga0105239_10049965 3300010375 Bacteria 4586
127 Ga0105239_11159443 3300010375 Bacteria 890
128 Ga0157370_10001070 3300013104 Bacteria 34278
129 Ga0157370_10026380 3300013104 Bacteria 5738
130 Ga0157370_10182989 3300013104 Bacteria 1947
131 Ga0157369_10072192 3300013105 Bacteria 3705
132 Ga0157374_10250153 3300013296 Bacteria 1744
133 Ga0163162_10027016 3300013306 Bacteria 5676
134 Ga0157372_10320094 3300013307 Bacteria 1806
135 Ga0163163_10004763 3300014325 Bacteria 11640
136 Ga0163163_10616078 3300014325 Bacteria 1149
137 Ga0182008_10074860 3300014497 Bacteria 1666
138 Ga0157377_10004716 3300014745 Bacteria 6313
139 Ga0157377_10528628 3300014745 Bacteria 829
140 Ga0182007_10008279 3300015262 Bacteria 4280
141 Ga0182005_1002283 3300015265 Bacteria 7020
142 Ga0163161_10013418 3300017792 Bacteria 5701
143 Ga0209435_100022 3300025206 Bacteria 207766
144 Ga0209436_110482 3300025208 Bacteria 1693
145 Ga0209437_100160 3300025233 Bacteria 149451
146 Ga0209646_1000078 3300025246 Bacteria 207766
147 Ga0209646_1008366 3300025246 Bacteria 1664
148 Ga0209026_1000065 3300025250 Bacteria 207766
149 Ga0209759_1000055 3300025256 Bacteria 207766
150 Ga0209233_1000168 3300025261 Bacteria 149312
151 Ga0209233_1000297 3300025261 Bacteria 61773
152 Ga0209455_1009217 3300025272 Bacteria 2609
153 Ga0209130_1000012 3300025284 Bacteria 421329
154 Ga0207426_1000010 3300025302 Bacteria 796003
155 Ga0207692_10014251 3300025898 Bacteria 3470
156 Ga0207688_10020352 3300025901 Bacteria 3623
157 Ga0207680_10096390 3300025903 Bacteria 1892
158 Ga0207699_10015874 3300025906 Bacteria 3924
159 Ga0207643_10035508 3300025908 Bacteria 2795
160 Ga0207643_10074048 3300025908 Bacteria 1963
161 Ga0207684_10026128 3300025910 Bacteria 4976
162 Ga0207707_10027004 3300025912 Bacteria 5017
163 Ga0207695_10000011 3300025913 Bacteria 910221
164 Ga0207695_10644683 3300025913 Bacteria 940
165 Ga0207671_10001637 3300025914 Bacteria 25476
166 Ga0207693_10075550 3300025915 Bacteria 2638
167 Ga0207660_10096644 3300025917 Bacteria 2199
168 Ga0207662_10006575 3300025918 Bacteria 6275
169 Ga0207649_10010266 3300025920 Bacteria 5141
170 Ga0207652_10017076 3300025921 Bacteria 5936
171 Ga0207652_10256268 3300025921 Bacteria 1578
172 Ga0207646_10019715 3300025922 Bacteria 6260
173 Ga0207681_10003623 3300025923 Bacteria 9604
174 Ga0207694_10365750 3300025924 Bacteria 1196
175 Ga0207650_10036424 3300025925 Bacteria 3580
176 Ga0207650_10897655 3300025925 Bacteria 752
177 Ga0207659_10090989 3300025926 Bacteria 2278
178 Ga0207659_10150176 3300025926 Bacteria 1819
179 Ga0207687_10078687 3300025927 Bacteria 2375
180 Ga0207687_10119062 3300025927 Bacteria 1972
181 Ga0207700_10248996 3300025928 Bacteria 1517
182 Ga0207664_10024085 3300025929 Bacteria 4571
183 Ga0207644_10005288 3300025931 Bacteria 8425
184 Ga0207690_10000005 3300025932 Bacteria 581199
185 Ga0207706_10098626 3300025933 Bacteria 2570
186 Ga0207670_10003717 3300025936 Bacteria 8099
187 Ga0207669_10471080 3300025937 Bacteria 999
188 Ga0207704_10047885 3300025938 Bacteria 2559
189 Ga0207665_10268727 3300025939 Bacteria 1266
190 Ga0207691_10018172 3300025940 Bacteria 6661
191 Ga0207711_10035062 3300025941 Bacteria 4251
192 Ga0207689_10004557 3300025942 Bacteria 12545
193 Ga0207689_10145868 3300025942 Archaea 1950
194 Ga0207661_10375820 3300025944 Bacteria 1286
195 Ga0207679_10004316 3300025945 Bacteria 8843
196 Ga0207712_10009442 3300025961 Bacteria 6173
197 Ga0207668_10006832 3300025972 Bacteria 6765
198 Ga0207640_10496958 3300025981 Bacteria 1015
199 Ga0207658_10148917 3300025986 Bacteria 1904
200 Ga0207658_10834102 3300025986 Bacteria 838
201 Ga0207677_10000044 3300026023 Bacteria 107614
202 Ga0207677_10632458 3300026023 Bacteria 942
203 Ga0207703_10173926 3300026035 Bacteria 1896
204 Ga0207639_10080703 3300026041 Bacteria 2574
205 Ga0207708_10071538 3300026075 Bacteria 2657
206 Ga0207702_10120436 3300026078 Bacteria 2348
207 Ga0207641_10013775 3300026088 Bacteria 6631
208 Ga0207648_10120375 3300026089 Bacteria 2308
209 Ga0207676_10046386 3300026095 Bacteria 3362
210 Ga0207674_10034896 3300026116 Bacteria 5253
211 Ga0207674_10064429 3300026116 Bacteria 3696
212 Ga0207675_100005214 3300026118 Bacteria 12511
213 Ga0207675_100011841 3300026118 Bacteria 8152
214 Ga0207675_100364222 3300026118 Bacteria 1419
215 Ga0207428_10019799 3300027907 Bacteria 5732
216 Ga0207428_10074775 3300027907 Bacteria 2656
217 Ga0207428_10114399 3300027907 Bacteria 2073
218 Ga0268266_10084743 3300028379 Bacteria 2768
219 Ga0268265_10002382 3300028380 Bacteria 14221
220 Ga0268265_10008148 3300028380 Bacteria 7080
221 Ga0268264_10269365 3300028381 Bacteria 1590
222 Ga0307515_10220688 3300028794 Bacteria 1715
223 Ga0265338_10312722 3300028800 Bacteria 1139
224 Ga0265331_10004264 3300031250 Bacteria 8952
225 Ga0307408_100012699 3300031548 Bacteria 5586
226 Ga0307408_100019349 3300031548 Bacteria 4584
227 Ga0307408_100225745 3300031548 Bacteria 1531
228 Ga0307408_100890188 3300031548 Bacteria 814
229 Ga0265313_10000149 3300031595 Bacteria 73203
230 Ga0265314_10083088 3300031711 Bacteria 2106
231 Ga0265342_10060017 3300031712 Bacteria 2244
232 Ga0307405_10050738 3300031731 Bacteria 2571
233 Ga0307405_10293984 3300031731 Bacteria 1229
234 Ga0307405_10912622 3300031731 Bacteria 744
235 Ga0307406_10083279 3300031901 Bacteria 2133
236 Ga0307412_10194763 3300031911 Bacteria 1535
237 Ga0307412_10300560 3300031911 Bacteria 1268
238 Ga0307412_10503868 3300031911 Bacteria 1008
239 Ga0307409_100154280 3300031995 Bacteria 1999
240 Ga0307416_100090247 3300032002 Bacteria 2627
241 Ga0307416_100455977 3300032002 Bacteria 1332
242 Ga0307411_10647252 3300032005 Bacteria 915
243 Ga0307415_100031322 3300032126 Bacteria 3425
244 Ga0307415_100993411 3300032126 Bacteria 780
245 Ga0373958_0012508 3300034819 Bacteria 1453
246 Ga0373953_0006700 3300035117 Bacteria 3813
247 Ga0373943_0061389 3300035170 Bacteria 1879
248 Ga0373955_0017563 3300035172 Bacteria 3544
249 Ga0373955_0029146 3300035172 Bacteria 2868
250 Ga0373931_0017546 3300035691 Bacteria 3544
251 Ga0373927_0061164 3300035695 Bacteria 2437
252 Ga0373933_0004056 3300035724 Bacteria 8073
253 Ga0373933_0122230 3300035724 Bacteria 1631
254 Ga0373937_0004039 3300036401 Bacteria 12429
255 Ga0373937_0009699 3300036401 Bacteria 8391
256 Ga0395899_0107351 3300037312 Bacteria 2009
257 Ga0395900_0104231 3300037418 Bacteria 2914
258 Ga0395898_0317346 3300037466 Bacteria 1487
259 Ga0395898_0649283 3300037466 Bacteria 997
260 Ga0395905_0000386 3300037471 Bacteria 62786
261 Ga0395905_0042368 3300037471 Bacteria 4272
262 Ga0395905_0047392 3300037471 Bacteria 4028
263 Ga0395905_0860525 3300037471 Bacteria 809
264 Ga0395901_0102976 3300038443 Bacteria 2995
265 Ga0395901_0845398 3300038443 Bacteria 901
266 Ga0436361_0188754 3300039447 Bacteria 2310
267 Ga0439442_010319 3300042002 Bacteria 1893
268 Ga0453684_0722808 3300044712 Bacteria 1080
269 Ga0466968_0041937 3300044735 Bacteria 1933
270 Ga0451576_0011354 3300045051 Bacteria 10134
271 Ga0466967_0145652 3300045976 Bacteria 2210
272 Ga0495638_0000163 3300046460 Bacteria 103363
273 Ga0495651_0088167 3300046462 Bacteria 2332
274 Ga0495653_0168337 3300046463 Bacteria 1515
275 Ga0495662_0164500 3300046476 Bacteria 1093
276 Ga0495664_0003721 3300046477 Bacteria 8317
277 Ga0495583_0016919 3300046506 Bacteria 3895
278 Ga0495606_0026761 3300046507 Bacteria 4104
279 Ga0495608_0005604 3300046511 Bacteria 8972
280 Ga0495608_0183180 3300046511 Bacteria 1324
281 Ga0495618_0048967 3300046514 Bacteria 2669
282 Ga0495652_0032279 3300046529 Bacteria 4581
283 Ga0495652_0212812 3300046529 Bacteria 1458
284 Ga0495640_0048320 3300046533 Bacteria 2941
285 Ga0495587_0008034 3300046536 Bacteria 6812
286 Ga0495587_0204691 3300046536 Bacteria 1115
287 Ga0495645_0025902 3300046543 Bacteria 4257
288 Ga0495667_0008964 3300046559 Bacteria 6801
289 Ga0495668_0004661 3300046616 Bacteria 9625
290 Ga0495625_0011026 3300046660 Bacteria 7412
291 Ga0495657_0011588 3300046675 Bacteria 6588
292 Ga0495623_0147325 3300046679 Bacteria 1395
293 Ga0495600_0131457 3300046809 Bacteria 1627
294 Ga0495660_0019203 3300046810 Bacteria 3925
295 Ga0495604_0038549 3300047317 Bacteria 3759
296 Ga0495675_0031531 3300047444 Bacteria 3383
297 Ga0495677_0013471 3300047445 Bacteria 2977
298 Ga0495684_0036562 3300047471 Bacteria 3764
299 Ga0495602_0000369 3300048088 Bacteria 41909
300 Ga0495602_0048152 3300048088 Bacteria 3835
301 Ga0496100_0009147 3300048903 Bacteria 5558
302 Ga0496101_0332436 3300048904 Bacteria 1193
303 Ga0496102_0007969 3300048905 Bacteria 9053
304 Ga0496103_0005133 3300048906 Bacteria 7882
305 Ga0496109_0013832 3300048912 Bacteria 7012
306 Ga0496111_0114753 3300048914 Bacteria 1986
307 Ga0496113_0031366 3300048916 Bacteria 3857
308 Ga0496113_0534838 3300048916 Bacteria 940
309 Ga0496116_0059830 3300048919 Bacteria 2474
310 Ga0496116_0110229 3300048919 Bacteria 1620
311 Ga0496117_0002298 3300048920 Bacteria 24600
312 Ga0496117_0085273 3300048920 Bacteria 2057
313 Ga0496118_0007362 3300048921 Bacteria 11698
314 Ga0496119_0007114 3300048922 Bacteria 10169
315 Ga0496119_0018252 3300048922 Bacteria 5236
316 Ga0496120_0007864 3300048923 Bacteria 7855
317 Ga0496120_0044855 3300048923 Bacteria 2566
318 Ga0496121_0002309 3300048924 Bacteria 29564
319 Ga0496121_0091527 3300048924 Bacteria 2374
320 Ga0496122_0022897 3300048925 Bacteria 5531
321 Ga0496122_0055277 3300048925 Bacteria 2971
322 Ga0496123_0017051 3300048926 Bacteria 5864
323 Ga0496123_0152174 3300048926 Bacteria 1246
324 Ga0496124_0013120 3300048927 Bacteria 8111
325 Ga0496124_0035429 3300048927 Bacteria 4367
326 Ga0496125_0370245 3300048928 Bacteria 848
327 Ga0496126_0089660 3300048929 Bacteria 2706
328 Ga0495678_098127 3300049459 Bacteria 1019
329 Ga0501292_001880 3300049515 Bacteria 2634
330 Ga0501294_006059 3300049517 Bacteria 1153
331 Ga0501298_009264 3300049521 Bacteria 1671
332 Ga0501303_000707 3300049526 Bacteria 2542
333 Ga0501042_0068510 3300049578 Bacteria 2537
334 Ga0501042_0073974 3300049578 Bacteria 2438
335 Ga0501072_0372770 3300049588 Bacteria 1133
336 Ga0501206_002283 3300049653 Bacteria 2415
337 Ga0501222_014911 3300049662 Bacteria 1026
338 Ga0501223_035384 3300049663 Bacteria 971
339 Ga0501255_003717 3300049684 Bacteria 1436
340 Ga0501262_001375 3300049759 Bacteria 2727
341 Ga0501265_001987 3300049762 Bacteria 2329
342 Ga0501281_01776 3300049777 Bacteria 1639
343 Ga0501045_0099231 3300049824 Bacteria 2155
344 nmdc:mga0yw44_108991_c1 3300050492 Bacteria 1772
345 nmdc:mga07m45_199679_c1 3300050496 Bacteria 1163
346 nmdc:mga05p37_620_c1 3300050507 Bacteria 39253
347 nmdc:mga09592_58785_c1 3300050508 Bacteria 3251
348 nmdc:mga09592_949_c1 3300050508 Bacteria 22803
349 nmdc:mga0qj67_506_c1 3300050509 Bacteria 26635
350 nmdc:mga0qj67_568173_c1 3300050509 Bacteria 909
351 nmdc:mga0qj67_673838_c1 3300050509 Bacteria 824
352 nmdc:mga0qj67_887_c1 3300050509 Bacteria 20521
353 nmdc:mga06r32_644_c1 3300050510 Bacteria 30414
354 nmdc:mga06r32_934_c1 3300050510 Bacteria 25991
355 nmdc:mga08y16_42176_c2 3300050511 Bacteria 3657
356 nmdc:mga08y16_72725_c1 3300050511 Bacteria 3583
357 nmdc:mga08y16_76259_c1 3300050511 Bacteria 3494
358 nmdc:mga0n895_218909_c1 3300050512 Bacteria 1933
359 nmdc:mga08x19_234629_c1 3300050514 Bacteria 1263
360 nmdc:mga0sz30_139672_c1 3300050516 Bacteria 1069
361 nmdc:mga0sz30_66970_c1 3300050516 Bacteria 1198
362 Ga0495601_0073772 3300053077 Bacteria 2182
363 Ga0495612_0001320 3300053078 Bacteria 10215
364 Ga0500610_0042067 3300053079 Bacteria 2364
365 Ga0500635_0023898 3300053080 Bacteria 1912
366 Ga0495595_0025425 3300053084 Bacteria 2624
367 Ga0495619_0003423 3300053085 Bacteria 10240
368 Ga0495619_0051015 3300053085 Bacteria 2733
369 Ga0500646_0015226 3300053090 Bacteria 2002
370 Ga0500647_0065532 3300053091 Bacteria 1747
371 Ga0500569_002060 3300053109 Bacteria 3910
372 Ga0500594_0001291 3300053118 Bacteria 5440
373 Ga0500618_002464 3300053125 Bacteria 6965
374 Ga0500568_0009261 3300053139 Bacteria 4692
375 Ga0500604_0000109 3300053151 Bacteria 25338
376 Ga0500616_0000483 3300053153 Bacteria 51655
377 Ga0500616_0175919 3300053153 Bacteria 968
378 Ga0500636_0036883 3300053177 Bacteria 2893
379 Ga0500587_000506 3300053739 Bacteria 4707
380 Ga0590071_066060 3300059421 Bacteria 888

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2878788777 2878789607 176
2 3300039447 Ga0436361_0188754 Ga0436361_0188754_540_1199 186
3 3300025925 Ga0207650_10897655 Ga0207650_108976551 187
4 3300025939 Ga0207665_10268727 Ga0207665_102687272 192
5 3300035691 Ga0373931_0017546 Ga0373931_0017546_2087_2701 192
6 iso_pu_bacteria 2965119406 2965121817 192
7 3300025986 Ga0207658_10834102 Ga0207658_108341021 193
8 3300050516 nmdc:mga0sz30_139672_c1 nmdc:mga0sz30_139672_c1_116_775 194
9 3300005336 Ga0070680_100000978 Ga0070680_1000009786 197
10 3300005458 Ga0070681_10008557 Ga0070681_100085576 197
11 3300005530 Ga0070679_100010187 Ga0070679_1000101875 197
12 3300009093 Ga0105240_10075688 Ga0105240_100756882 197
13 3300013307 Ga0157372_10320094 Ga0157372_103200942 197
14 3300025912 Ga0207707_10027004 Ga0207707_100270042 197
15 3300025913 Ga0207695_10644683 Ga0207695_106446831 197
16 3300025917 Ga0207660_10096644 Ga0207660_100966442 197
17 3300025921 Ga0207652_10017076 Ga0207652_100170764 197
18 3300037471 Ga0395905_0860525 Ga0395905_0860525_11_628 199
19 3300044712 Ga0453684_0722808 Ga0453684_0722808_13_618 201
20 3300049588 Ga0501072_0372770 Ga0501072_0372770_453_1106 202
21 3300032126 Ga0307415_100993411 Ga0307415_1009934111 207
22 3300031548 Ga0307408_100890188 Ga0307408_1008901881 209
23 3300009098 Ga0105245_10018593 Ga0105245_100185935 210
24 iso_pu_bacteria 2884791551 2884794310 211
25 3300050509 nmdc:mga0qj67_568173_c1 nmdc:mga0qj67_568173_c1_109_756 212
26 iso_pu_bacteria 2856364286 2856366256 212
27 iso_pu_bacteria 2857349434 2857351425 212
28 iso_pu_bacteria 2869285874 2869287291 212
29 iso_pu_bacteria 2871429161 2871430590 212
30 iso_pu_bacteria 2874146452 2874149131 212
31 iso_pu_bacteria 2874155637 2874156082 212
32 iso_pu_bacteria 2876413966 2876415445 212
33 iso_pu_bacteria 2878745973 2878747023 212
34 iso_pu_bacteria 2888350351 2888355493 212
35 iso_pu_bacteria 2889010040 2889010464 212
36 iso_pu_bacteria 2889016732 2889017869 212
37 iso_pu_bacteria 2889306138 2889309943 212
38 iso_pu_bacteria 2903492973 2903500460 212
39 iso_pu_bacteria 2906308376 2906309836 212
40 iso_pu_bacteria 2906321335 2906322471 212
41 iso_pu_bacteria 2906354277 2906354320 212
42 iso_pu_bacteria 2922130491 2922133019 212
43 iso_pu_bacteria 2922185730 2922191332 212
44 iso_pu_bacteria 2937813078 2937814865 212
45 iso_pu_bacteria 2958100919 2958102834 212
46 iso_pu_bacteria 2958130278 2958131791 212
47 iso_pu_bacteria 2958172287 2958176671 212
48 iso_pu_bacteria 2958179912 2958180851 212
49 iso_pu_bacteria 2961077736 2961078689 212
50 iso_pu_bacteria 2968117919 2968119711 212
51 iso_pu_bacteria 2977843712 2977845674 212
52 iso_pu_bacteria 2977942078 2977945245 212
53 iso_pu_bacteria 2977971508 2977978403 212
54 iso_pu_bacteria 2979710463 2979716453 212
55 iso_pu_bacteria 2979742915 2979747738 212
56 iso_pu_bacteria 2987636660 2987638609 212
57 iso_pu_bacteria 2987652177 2987655006 212
58 iso_pu_bacteria 3000135777 3000139988 212
59 iso_pu_bacteria 3004203850 3004205148 212
60 iso_pu_bacteria 8004387939 8004389128 212
61 iso_pu_bacteria 8004714634 8004716191 212
62 iso_pu_bacteria 2522125168 2522550796 213
63 iso_pu_bacteria 2597489875 2597812416 213
64 iso_pu_bacteria 2791355123 2792752106 213
65 iso_pu_bacteria 2841734538 2841738433 213
66 iso_pu_bacteria 2871474448 2871479941 213
67 iso_pu_bacteria 2874168670 2874169051 213
68 iso_pu_bacteria 2885312484 2885312551 213
69 iso_pu_bacteria 2888343758 2888346185 213
70 iso_pu_bacteria 2937836603 2937841713 213
71 iso_pu_bacteria 2958071322 2958077948 213
72 iso_pu_bacteria 2970540015 2970542306 213
73 iso_pu_bacteria 8004633249 8004636950 213
74 iso_pu_bacteria 8055617313 8055619911 213
75 3300005338 Ga0068868_100000036 Ga0068868_10000003641 214
76 3300005354 Ga0070675_100008116 Ga0070675_1000081163 214
77 3300005366 Ga0070659_100000025 Ga0070659_100000025118 214
78 3300005618 Ga0068864_100846123 Ga0068864_1008461232 214
79 3300006871 Ga0075434_100211293 Ga0075434_1002112933 214
80 3300009098 Ga0105245_10020493 Ga0105245_100204932 214
81 3300009148 Ga0105243_10687498 Ga0105243_106874982 214
82 3300013104 Ga0157370_10182989 Ga0157370_101829892 214
83 3300013105 Ga0157369_10072192 Ga0157369_100721924 214
84 3300025926 Ga0207659_10150176 Ga0207659_101501761 214
85 3300025927 Ga0207687_10078687 Ga0207687_100786873 214
86 3300025932 Ga0207690_10000005 Ga0207690_10000005356 214
87 3300026023 Ga0207677_10000044 Ga0207677_100000448 214
88 3300031548 Ga0307408_100019349 Ga0307408_1000193492 214
89 3300037312 Ga0395899_0107351 Ga0395899_0107351_519_1181 214
90 3300037466 Ga0395898_0649283 Ga0395898_0649283_238_900 214
91 3300038443 Ga0395901_0102976 Ga0395901_0102976_1604_2266 214
92 3300047445 Ga0495677_0013471 Ga0495677_0013471_316_978 214
93 3300050512 nmdc:mga0n895_218909_c1 nmdc:mga0n895_218909_c1_292_951 214
94 3300050514 nmdc:mga08x19_234629_c1 nmdc:mga08x19_234629_c1_19_678 214
95 iso_pu_bacteria 2582581308 2585277021 214
96 iso_pu_bacteria 2582581315 2585323973 214
97 iso_pu_bacteria 2585427527 2585537032 214
98 iso_pu_bacteria 2585427530 2585551883 214
99 iso_pu_bacteria 2615840626 2616308395 214
100 iso_pu_bacteria 2615840698 2616556534 214
101 iso_pu_bacteria 2617270742 2617385882 214
102 iso_pu_bacteria 2667528174 2671115795 214
103 iso_pu_bacteria 2757320392 2757569363 214
104 iso_pu_bacteria 2775507266 2778176534 214
105 iso_pu_bacteria 2818991448 2819610349 214
106 iso_pu_bacteria 2818991453 2819638089 214
107 iso_pu_bacteria 2838029111 2838035078 214
108 iso_pu_bacteria 2842475841 2842481870 214
109 iso_pu_bacteria 2842502639 2842508745 214
110 iso_pu_bacteria 2852387548 2852389684 214
111 iso_pu_bacteria 2896384573 2896384955 214
112 iso_pu_bacteria 2919408235 2919409850 214
113 iso_pu_bacteria 2937843397 2937846797 214
114 iso_pu_bacteria 3005416602 3005420287 214
115 iso_pu_bacteria 8005314921 8005317238 214
116 iso_pu_bacteria 8005484373 8005486700 214
117 iso_pu_bacteria 8005645114 8005646160 214
118 iso_pu_bacteria 8005682033 8005686290 214
119 iso_pu_bacteria 8046767195 8046773960 214
120 3300005356 Ga0070674_100514148 Ga0070674_1005141481 215
121 3300025942 Ga0207689_10145868 Ga0207689_101458682 215
122 3300005290 Ga0065712_10080891 Ga0065712_100808915 216
123 3300005293 Ga0065715_10173728 Ga0065715_101737282 216
124 3300005328 Ga0070676_10014118 Ga0070676_100141183 216
125 3300005330 Ga0070690_100009348 Ga0070690_1000093483 216
126 3300005334 Ga0068869_100001572 Ga0068869_10000157213 216
127 3300005334 Ga0068869_100235695 Ga0068869_1002356952 216
128 3300005335 Ga0070666_10087456 Ga0070666_100874562 216
129 3300005338 Ga0068868_100013619 Ga0068868_1000136195 216
130 3300005340 Ga0070689_100000194 Ga0070689_1000001941 216
131 3300005343 Ga0070687_100003801 Ga0070687_1000038013 216
132 3300005344 Ga0070661_100001270 Ga0070661_10000127013 216
133 3300005345 Ga0070692_10055450 Ga0070692_100554503 216
134 3300005353 Ga0070669_100002925 Ga0070669_1000029256 216
135 3300005354 Ga0070675_100000517 Ga0070675_1000005175 216
136 3300005355 Ga0070671_100013385 Ga0070671_1000133856 216
137 3300005364 Ga0070673_100010045 Ga0070673_1000100455 216
138 3300005365 Ga0070688_100000635 Ga0070688_1000006353 216
139 3300005367 Ga0070667_100215632 Ga0070667_1002156322 216
140 3300005438 Ga0070701_10036456 Ga0070701_100364562 216
141 3300005457 Ga0070662_100082560 Ga0070662_1000825603 216
142 3300005457 Ga0070662_100164999 Ga0070662_1001649993 216
143 3300005466 Ga0070685_10006204 Ga0070685_100062045 216
144 3300005530 Ga0070679_100211417 Ga0070679_1002114172 216
145 3300005535 Ga0070684_100007975 Ga0070684_1000079754 216
146 3300005543 Ga0070672_100010341 Ga0070672_1000103412 216
147 3300005544 Ga0070686_100002576 Ga0070686_1000025766 216
148 3300005546 Ga0070696_100579585 Ga0070696_1005795851 216
149 3300005564 Ga0070664_100000173 Ga0070664_10000017325 216
150 3300005577 Ga0068857_100027285 Ga0068857_1000272855 216
151 3300005615 Ga0070702_100011978 Ga0070702_1000119785 216
152 3300005617 Ga0068859_100002708 Ga0068859_10000270817 216
153 3300005618 Ga0068864_100000829 Ga0068864_1000008295 216
154 3300005719 Ga0068861_100001405 Ga0068861_10000140511 216
155 3300005719 Ga0068861_100006525 Ga0068861_1000065259 216
156 3300005840 Ga0068870_10050717 Ga0068870_100507173 216
157 3300005841 Ga0068863_100004115 Ga0068863_10000411511 216
158 3300005842 Ga0068858_100031834 Ga0068858_1000318346 216
159 3300005843 Ga0068860_100026455 Ga0068860_1000264554 216
160 3300005844 Ga0068862_100001554 Ga0068862_10000155413 216
161 3300005844 Ga0068862_100003156 Ga0068862_1000031569 216
162 3300005981 Ga0081538_10003863 Ga0081538_1000386313 216
163 3300005981 Ga0081538_10006679 Ga0081538_100066795 216
164 3300006194 Ga0075427_10019608 Ga0075427_100196082 216
165 3300006358 Ga0068871_100099029 Ga0068871_1000990294 216
166 3300006844 Ga0075428_100003456 Ga0075428_10000345611 216
167 3300006844 Ga0075428_100017618 Ga0075428_1000176182 216
168 3300006844 Ga0075428_100139720 Ga0075428_1001397202 216
169 3300006846 Ga0075430_100001023 Ga0075430_1000010239 216
170 3300006846 Ga0075430_100001510 Ga0075430_1000015108 216
171 3300006846 Ga0075430_100243630 Ga0075430_1002436302 216
172 3300006847 Ga0075431_100000690 Ga0075431_10000069018 216
173 3300006847 Ga0075431_100001463 Ga0075431_10000146314 216
174 3300006847 Ga0075431_100220561 Ga0075431_1002205612 216
175 3300006880 Ga0075429_100001468 Ga0075429_10000146810 216
176 3300006881 Ga0068865_100010229 Ga0068865_1000102294 216
177 3300006931 Ga0097620_100002708 Ga0097620_10000270817 216
178 3300009094 Ga0111539_10022489 Ga0111539_100224894 216
179 3300009094 Ga0111539_10027306 Ga0111539_100273063 216
180 3300009094 Ga0111539_10039175 Ga0111539_100391754 216
181 3300009098 Ga0105245_10059129 Ga0105245_100591295 216
182 3300009147 Ga0114129_10001484 Ga0114129_1000148418 216
183 3300009147 Ga0114129_10931738 Ga0114129_109317381 216
184 3300009177 Ga0105248_10003681 Ga0105248_100036818 216
185 3300009545 Ga0105237_10284099 Ga0105237_102840992 216
186 3300009551 Ga0105238_10314482 Ga0105238_103144822 216
187 3300009553 Ga0105249_10007372 Ga0105249_100073723 216
188 3300010375 Ga0105239_10049965 Ga0105239_100499653 216
189 3300013296 Ga0157374_10250153 Ga0157374_102501533 216
190 3300013306 Ga0163162_10027016 Ga0163162_100270162 216
191 3300014325 Ga0163163_10004763 Ga0163163_100047631 216
192 3300014745 Ga0157377_10004716 Ga0157377_100047164 216
193 3300014745 Ga0157377_10528628 Ga0157377_105286281 216
194 3300017792 Ga0163161_10013418 Ga0163161_100134182 216
195 3300025901 Ga0207688_10020352 Ga0207688_100203523 216
196 3300025903 Ga0207680_10096390 Ga0207680_100963901 216
197 3300025908 Ga0207643_10035508 Ga0207643_100355083 216
198 3300025908 Ga0207643_10074048 Ga0207643_100740482 216
199 3300025918 Ga0207662_10006575 Ga0207662_100065756 216
200 3300025920 Ga0207649_10010266 Ga0207649_100102664 216
201 3300025921 Ga0207652_10256268 Ga0207652_102562682 216
202 3300025923 Ga0207681_10003623 Ga0207681_100036236 216
203 3300025924 Ga0207694_10365750 Ga0207694_103657502 216
204 3300025925 Ga0207650_10036424 Ga0207650_100364243 216
205 3300025926 Ga0207659_10090989 Ga0207659_100909891 216
206 3300025927 Ga0207687_10119062 Ga0207687_101190622 216
207 3300025931 Ga0207644_10005288 Ga0207644_100052885 216
208 3300025933 Ga0207706_10098626 Ga0207706_100986263 216
209 3300025936 Ga0207670_10003717 Ga0207670_100037175 216
210 3300025937 Ga0207669_10471080 Ga0207669_104710802 216
211 3300025938 Ga0207704_10047885 Ga0207704_100478852 216
212 3300025940 Ga0207691_10018172 Ga0207691_100181722 216
213 3300025941 Ga0207711_10035062 Ga0207711_100350624 216
214 3300025942 Ga0207689_10004557 Ga0207689_100045574 216
215 3300025944 Ga0207661_10375820 Ga0207661_103758202 216
216 3300025945 Ga0207679_10004316 Ga0207679_100043164 216
217 3300025961 Ga0207712_10009442 Ga0207712_100094423 216
218 3300025972 Ga0207668_10006832 Ga0207668_100068324 216
219 3300025986 Ga0207658_10148917 Ga0207658_101489172 216
220 3300026023 Ga0207677_10632458 Ga0207677_106324581 216
221 3300026035 Ga0207703_10173926 Ga0207703_101739263 216
222 3300026041 Ga0207639_10080703 Ga0207639_100807033 216
223 3300026075 Ga0207708_10071538 Ga0207708_100715383 216
224 3300026088 Ga0207641_10013775 Ga0207641_100137755 216
225 3300026089 Ga0207648_10120375 Ga0207648_101203753 216
226 3300026095 Ga0207676_10046386 Ga0207676_100463862 216
227 3300026116 Ga0207674_10034896 Ga0207674_100348965 216
228 3300026116 Ga0207674_10064429 Ga0207674_100644292 216
229 3300026118 Ga0207675_100005214 Ga0207675_1000052147 216
230 3300026118 Ga0207675_100011841 Ga0207675_1000118412 216
231 3300026118 Ga0207675_100364222 Ga0207675_1003642221 216
232 3300027907 Ga0207428_10019799 Ga0207428_100197993 216
233 3300027907 Ga0207428_10074775 Ga0207428_100747752 216
234 3300027907 Ga0207428_10114399 Ga0207428_101143992 216
235 3300028380 Ga0268265_10002382 Ga0268265_1000238211 216
236 3300028380 Ga0268265_10008148 Ga0268265_100081483 216
237 3300028381 Ga0268264_10269365 Ga0268264_102693652 216
238 3300031548 Ga0307408_100012699 Ga0307408_1000126993 216
239 3300031731 Ga0307405_10293984 Ga0307405_102939841 216
240 3300031901 Ga0307406_10083279 Ga0307406_100832793 216
241 3300031911 Ga0307412_10503868 Ga0307412_105038681 216
242 3300031995 Ga0307409_100154280 Ga0307409_1001542802 216
243 3300032002 Ga0307416_100090247 Ga0307416_1000902471 216
244 3300032002 Ga0307416_100455977 Ga0307416_1004559772 216
245 3300034819 Ga0373958_0012508 Ga0373958_0012508_574_1233 216
246 3300037466 Ga0395898_0317346 Ga0395898_0317346_183_884 216
247 3300042002 Ga0439442_010319 Ga0439442_010319_717_1376 216
248 3300044735 Ga0466968_0041937 Ga0466968_0041937_38_703 216
249 3300045051 Ga0451576_0011354 Ga0451576_0011354_3525_4211 216
250 3300045976 Ga0466967_0145652 Ga0466967_0145652_382_1032 216
251 3300048912 Ga0496109_0013832 Ga0496109_0013832_523_1209 216
252 3300048914 Ga0496111_0114753 Ga0496111_0114753_874_1560 216
253 3300048916 Ga0496113_0031366 Ga0496113_0031366_2871_3557 216
254 3300049515 Ga0501292_001880 Ga0501292_001880_1817_2491 216
255 3300049517 Ga0501294_006059 Ga0501294_006059_447_1121 216
256 3300049521 Ga0501298_009264 Ga0501298_009264_859_1533 216
257 3300049526 Ga0501303_000707 Ga0501303_000707_1317_1991 216
258 3300049578 Ga0501042_0068510 Ga0501042_0068510_784_1440 216
259 3300049578 Ga0501042_0073974 Ga0501042_0073974_959_1612 216
260 3300049653 Ga0501206_002283 Ga0501206_002283_1251_1925 216
261 3300049662 Ga0501222_014911 Ga0501222_014911_61_735 216
262 3300049663 Ga0501223_035384 Ga0501223_035384_64_738 216
263 3300049684 Ga0501255_003717 Ga0501255_003717_296_970 216
264 3300049759 Ga0501262_001375 Ga0501262_001375_1383_2057 216
265 3300049762 Ga0501265_001987 Ga0501265_001987_583_1257 216
266 3300049777 Ga0501281_01776 Ga0501281_01776_845_1519 216
267 3300049824 Ga0501045_0099231 Ga0501045_0099231_627_1280 216
268 3300050507 nmdc:mga05p37_620_c1 nmdc:mga05p37_620_c1_18327_19001 216
269 3300050508 nmdc:mga09592_58785_c1 nmdc:mga09592_58785_c1_150_809 216
270 3300050508 nmdc:mga09592_949_c1 nmdc:mga09592_949_c1_13389_14063 216
271 3300050509 nmdc:mga0qj67_506_c1 nmdc:mga0qj67_506_c1_7763_8437 216
272 3300050509 nmdc:mga0qj67_673838_c1 nmdc:mga0qj67_673838_c1_72_731 216
273 3300050509 nmdc:mga0qj67_887_c1 nmdc:mga0qj67_887_c1_8122_8796 216
274 3300050510 nmdc:mga06r32_644_c1 nmdc:mga06r32_644_c1_14129_14803 216
275 3300050510 nmdc:mga06r32_934_c1 nmdc:mga06r32_934_c1_9259_9933 216
276 3300050511 nmdc:mga08y16_42176_c2 nmdc:mga08y16_42176_c2_992_1666 216
277 3300050511 nmdc:mga08y16_72725_c1 nmdc:mga08y16_72725_c1_1890_2549 216
278 3300053080 Ga0500635_0023898 Ga0500635_0023898_487_1158 216
279 3300053090 Ga0500646_0015226 Ga0500646_0015226_953_1615 216
280 3300053139 Ga0500568_0009261 Ga0500568_0009261_3057_3719 216
281 3300053151 Ga0500604_0000109 Ga0500604_0000109_14496_15161 216
282 3300053153 Ga0500616_0000483 Ga0500616_0000483_47940_48602 216
283 3300053739 Ga0500587_000506 Ga0500587_000506_724_1386 216
284 3300059421 Ga0590071_066060 Ga0590071_066060_40_699 216
285 3300005468 Ga0070707_100015169 Ga0070707_1000151698 217
286 3300005471 Ga0070698_100452570 Ga0070698_1004525702 217
287 3300005983 Ga0081540_1038002 Ga0081540_10380022 217
288 3300005985 Ga0081539_10011340 Ga0081539_100113404 217
289 3300006038 Ga0075365_10109918 Ga0075365_101099181 217
290 3300013104 Ga0157370_10026380 Ga0157370_100263808 217
291 3300025922 Ga0207646_10019715 Ga0207646_100197157 217
292 3300028794 Ga0307515_10220688 Ga0307515_102206882 217
293 3300031548 Ga0307408_100225745 Ga0307408_1002257452 217
294 3300031731 Ga0307405_10912622 Ga0307405_109126221 217
295 3300031911 Ga0307412_10194763 Ga0307412_101947632 217
296 3300037418 Ga0395900_0104231 Ga0395900_0104231_21_686 217
297 3300037471 Ga0395905_0000386 Ga0395905_0000386_28684_29337 217
298 3300037471 Ga0395905_0042368 Ga0395905_0042368_2457_3110 217
299 3300037471 Ga0395905_0047392 Ga0395905_0047392_2069_2734 217
300 3300038443 Ga0395901_0845398 Ga0395901_0845398_167_832 217
301 3300050492 nmdc:mga0yw44_108991_c1 nmdc:mga0yw44_108991_c1_373_1026 217
302 3300001979 JGI24740J21852_10002553 JGI24740J21852_100025535 218
303 3300002704 JGI25155J39150_1000011 JGI25155J39150_1000011201 218
304 3300002705 JGI25156J39149_1000030 JGI25156J39149_1000030115 218
305 3300002737 JGI25162J39368_1001401 JGI25162J39368_10014019 218
306 3300002737 JGI25162J39368_1001515 JGI25162J39368_10015152 218
307 3300002738 JGI25154J39366_1000289 JGI25154J39366_100028923 218
308 3300002741 JGI25157J39369_1000010 JGI25157J39369_100001011 218
309 3300002987 JGI25159J45721_1007706 JGI25159J45721_10077062 218
310 3300003214 JGI25165J46597_1001229 JGI25165J46597_10012297 218
311 3300003214 JGI25165J46597_1004859 JGI25165J46597_10048592 218
312 3300003316 rootH1_10105689 rootH1_101056894 218
313 3300003320 rootH2_10001490 rootH2_1000149010 218
314 3300003322 rootL2_10075208 rootL2_1007520810 218
315 3300003323 rootH1_10006224 rootH1_100062243 218
316 3300003354 JGI25160J50197_1000004 JGI25160J50197_100000416 218
317 3300003374 JGI25161J50226_1000003 JGI25161J50226_1000003412 218
318 3300004625 Ga0055543_1000001 Ga0055543_1000001418 218
319 3300005262 Ga0065165_1001508 Ga0065165_100150817 218
320 3300005434 Ga0070709_10277111 Ga0070709_102771112 218
321 3300005435 Ga0070714_100031652 Ga0070714_1000316523 218
322 3300005436 Ga0070713_100009452 Ga0070713_1000094523 218
323 3300005437 Ga0070710_10035956 Ga0070710_100359562 218
324 3300005445 Ga0070708_100587921 Ga0070708_1005879211 218
325 3300005467 Ga0070706_100058938 Ga0070706_1000589383 218
326 3300005518 Ga0070699_100294083 Ga0070699_1002940832 218
327 3300005548 Ga0070665_100053253 Ga0070665_1000532533 218
328 3300005548 Ga0070665_100690150 Ga0070665_1006901502 218
329 3300005563 Ga0068855_100125276 Ga0068855_1001252762 218
330 3300005578 Ga0068854_100098202 Ga0068854_1000982022 218
331 3300005614 Ga0068856_100070180 Ga0068856_1000701804 218
332 3300005614 Ga0068856_100144007 Ga0068856_1001440072 218
333 3300006173 Ga0070716_100593532 Ga0070716_1005935321 218
334 3300006175 Ga0070712_100019369 Ga0070712_1000193692 218
335 3300006186 Ga0075369_10106207 Ga0075369_101062072 218
336 3300006195 Ga0075366_10094065 Ga0075366_100940652 218
337 3300009093 Ga0105240_10000005 Ga0105240_10000005411 218
338 3300009093 Ga0105240_10035922 Ga0105240_100359226 218
339 3300009094 Ga0111539_10910500 Ga0111539_109105001 218
340 3300009147 Ga0114129_11316356 Ga0114129_113163562 218
341 3300009545 Ga0105237_10000773 Ga0105237_1000077333 218
342 3300010375 Ga0105239_10014053 Ga0105239_100140532 218
343 3300010375 Ga0105239_11159443 Ga0105239_111594431 218
344 3300013104 Ga0157370_10001070 Ga0157370_1000107031 218
345 3300014325 Ga0163163_10616078 Ga0163163_106160782 218
346 3300014497 Ga0182008_10074860 Ga0182008_100748602 218
347 3300015262 Ga0182007_10008279 Ga0182007_100082792 218
348 3300015265 Ga0182005_1002283 Ga0182005_10022836 218
349 3300025206 Ga0209435_100022 Ga0209435_1000229 218
350 3300025208 Ga0209436_110482 Ga0209436_1104822 218
351 3300025233 Ga0209437_100160 Ga0209437_1001606 218
352 3300025246 Ga0209646_1000078 Ga0209646_10000789 218
353 3300025246 Ga0209646_1008366 Ga0209646_10083662 218
354 3300025250 Ga0209026_1000065 Ga0209026_10000659 218
355 3300025256 Ga0209759_1000055 Ga0209759_10000559 218
356 3300025261 Ga0209233_1000168 Ga0209233_1000168154 218
357 3300025261 Ga0209233_1000297 Ga0209233_10002978 218
358 3300025272 Ga0209455_1009217 Ga0209455_10092172 218
359 3300025284 Ga0209130_1000012 Ga0209130_100001216 218
360 3300025302 Ga0207426_1000010 Ga0207426_1000010375 218
361 3300025898 Ga0207692_10014251 Ga0207692_100142513 218
362 3300025906 Ga0207699_10015874 Ga0207699_100158743 218
363 3300025910 Ga0207684_10026128 Ga0207684_100261283 218
364 3300025913 Ga0207695_10000011 Ga0207695_10000011506 218
365 3300025914 Ga0207671_10001637 Ga0207671_1000163722 218
366 3300025915 Ga0207693_10075550 Ga0207693_100755502 218
367 3300025928 Ga0207700_10248996 Ga0207700_102489962 218
368 3300025929 Ga0207664_10024085 Ga0207664_100240854 218
369 3300025981 Ga0207640_10496958 Ga0207640_104969581 218
370 3300026078 Ga0207702_10120436 Ga0207702_101204362 218
371 3300028379 Ga0268266_10084743 Ga0268266_100847432 218
372 3300028800 Ga0265338_10312722 Ga0265338_103127222 218
373 3300031250 Ga0265331_10004264 Ga0265331_100042649 218
374 3300031595 Ga0265313_10000149 Ga0265313_1000014963 218
375 3300031711 Ga0265314_10083088 Ga0265314_100830882 218
376 3300031712 Ga0265342_10060017 Ga0265342_100600172 218
377 3300031731 Ga0307405_10050738 Ga0307405_100507382 218
378 3300031911 Ga0307412_10300560 Ga0307412_103005602 218
379 3300032005 Ga0307411_10647252 Ga0307411_106472522 218
380 3300032126 Ga0307415_100031322 Ga0307415_1000313223 218
381 3300035117 Ga0373953_0006700 Ga0373953_0006700_290_949 218
382 3300035170 Ga0373943_0061389 Ga0373943_0061389_962_1621 218
383 3300035172 Ga0373955_0017563 Ga0373955_0017563_2116_2775 218
384 3300035172 Ga0373955_0029146 Ga0373955_0029146_936_1595 218
385 3300035695 Ga0373927_0061164 Ga0373927_0061164_1506_2165 218
386 3300035724 Ga0373933_0004056 Ga0373933_0004056_4165_4824 218
387 3300035724 Ga0373933_0122230 Ga0373933_0122230_946_1605 218
388 3300036401 Ga0373937_0004039 Ga0373937_0004039_1308_1967 218
389 3300036401 Ga0373937_0009699 Ga0373937_0009699_3505_4164 218
390 3300046460 Ga0495638_0000163 Ga0495638_0000163_48235_48891 218
391 3300046462 Ga0495651_0088167 Ga0495651_0088167_113_772 218
392 3300046463 Ga0495653_0168337 Ga0495653_0168337_690_1349 218
393 3300046476 Ga0495662_0164500 Ga0495662_0164500_61_720 218
394 3300046477 Ga0495664_0003721 Ga0495664_0003721_7471_8130 218
395 3300046506 Ga0495583_0016919 Ga0495583_0016919_2359_3015 218
396 3300046507 Ga0495606_0026761 Ga0495606_0026761_1830_2498 218
397 3300046511 Ga0495608_0005604 Ga0495608_0005604_5038_5697 218
398 3300046511 Ga0495608_0183180 Ga0495608_0183180_512_1171 218
399 3300046514 Ga0495618_0048967 Ga0495618_0048967_1663_2322 218
400 3300046529 Ga0495652_0032279 Ga0495652_0032279_3309_3968 218
401 3300046529 Ga0495652_0212812 Ga0495652_0212812_675_1334 218
402 3300046533 Ga0495640_0048320 Ga0495640_0048320_1814_2473 218
403 3300046536 Ga0495587_0008034 Ga0495587_0008034_4210_4869 218
404 3300046536 Ga0495587_0204691 Ga0495587_0204691_200_859 218
405 3300046543 Ga0495645_0025902 Ga0495645_0025902_743_1402 218
406 3300046559 Ga0495667_0008964 Ga0495667_0008964_3808_4467 218
407 3300046616 Ga0495668_0004661 Ga0495668_0004661_3377_4033 218
408 3300046660 Ga0495625_0011026 Ga0495625_0011026_3467_4123 218
409 3300046675 Ga0495657_0011588 Ga0495657_0011588_2000_2659 218
410 3300046679 Ga0495623_0147325 Ga0495623_0147325_251_910 218
411 3300046809 Ga0495600_0131457 Ga0495600_0131457_755_1414 218
412 3300046810 Ga0495660_0019203 Ga0495660_0019203_2339_2995 218
413 3300047317 Ga0495604_0038549 Ga0495604_0038549_293_952 218
414 3300047444 Ga0495675_0031531 Ga0495675_0031531_1843_2502 218
415 3300047471 Ga0495684_0036562 Ga0495684_0036562_1697_2356 218
416 3300048088 Ga0495602_0000369 Ga0495602_0000369_28462_29121 218
417 3300048088 Ga0495602_0048152 Ga0495602_0048152_1820_2479 218
418 3300048903 Ga0496100_0009147 Ga0496100_0009147_1197_1853 218
419 3300048904 Ga0496101_0332436 Ga0496101_0332436_155_811 218
420 3300048905 Ga0496102_0007969 Ga0496102_0007969_2756_3412 218
421 3300048906 Ga0496103_0005133 Ga0496103_0005133_2785_3441 218
422 3300048916 Ga0496113_0534838 Ga0496113_0534838_202_858 218
423 3300048919 Ga0496116_0059830 Ga0496116_0059830_1611_2267 218
424 3300048919 Ga0496116_0110229 Ga0496116_0110229_835_1491 218
425 3300048920 Ga0496117_0002298 Ga0496117_0002298_21513_22169 218
426 3300048920 Ga0496117_0085273 Ga0496117_0085273_319_996 218
427 3300048921 Ga0496118_0007362 Ga0496118_0007362_8488_9144 218
428 3300048922 Ga0496119_0007114 Ga0496119_0007114_623_1300 218
429 3300048922 Ga0496119_0018252 Ga0496119_0018252_2149_2805 218
430 3300048923 Ga0496120_0007864 Ga0496120_0007864_4768_5424 218
431 3300048923 Ga0496120_0044855 Ga0496120_0044855_1240_1917 218
432 3300048924 Ga0496121_0002309 Ga0496121_0002309_26477_27133 218
433 3300048924 Ga0496121_0091527 Ga0496121_0091527_157_825 218
434 3300048925 Ga0496122_0022897 Ga0496122_0022897_717_1394 218
435 3300048925 Ga0496122_0055277 Ga0496122_0055277_1515_2171 218
436 3300048926 Ga0496123_0017051 Ga0496123_0017051_4600_5256 218
437 3300048926 Ga0496123_0152174 Ga0496123_0152174_29_706 218
438 3300048927 Ga0496124_0013120 Ga0496124_0013120_2432_3088 218
439 3300048927 Ga0496124_0035429 Ga0496124_0035429_3538_4215 218
440 3300048928 Ga0496125_0370245 Ga0496125_0370245_53_730 218
441 3300048929 Ga0496126_0089660 Ga0496126_0089660_197_853 218
442 3300049459 Ga0495678_098127 Ga0495678_098127_92_748 218
443 3300050496 nmdc:mga07m45_199679_c1 nmdc:mga07m45_199679_c1_14_673 218
444 3300050511 nmdc:mga08y16_76259_c1 nmdc:mga08y16_76259_c1_2236_2895 218
445 3300050516 nmdc:mga0sz30_66970_c1 nmdc:mga0sz30_66970_c1_187_846 218
446 3300053077 Ga0495601_0073772 Ga0495601_0073772_483_1142 218
447 3300053078 Ga0495612_0001320 Ga0495612_0001320_6770_7429 218
448 3300053079 Ga0500610_0042067 Ga0500610_0042067_446_1102 218
449 3300053084 Ga0495595_0025425 Ga0495595_0025425_704_1363 218
450 3300053085 Ga0495619_0003423 Ga0495619_0003423_6425_7084 218
451 3300053085 Ga0495619_0051015 Ga0495619_0051015_739_1398 218
452 3300053091 Ga0500647_0065532 Ga0500647_0065532_39_698 218
453 3300053109 Ga0500569_002060 Ga0500569_002060_2210_2866 218
454 3300053118 Ga0500594_0001291 Ga0500594_0001291_3310_3966 218
455 3300053125 Ga0500618_002464 Ga0500618_002464_261_965 218
456 3300053153 Ga0500616_0175919 Ga0500616_0175919_19_783 218
457 3300053177 Ga0500636_0036883 Ga0500636_0036883_1597_2253 218
458 iso_pu_bacteria 2582581316 2585333631 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

50

235

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8235 1 193
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8192 1 193
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8059 2 193
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.7917 3 193
2gd9-assembly1.cif.gz_A crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.7871 2 191
ID Description Score Start End Superfamily
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8177 1 193 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8133 2 190 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8133 1 193 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8086 2 190 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8039 4 191 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A530GKI4-F1-model_v4 Dihydrofolate reductase 0.9822 52 190 GO:0008703
GO:0009231
AF-A0A1T5ETS6-F1-model_v4 Dihydrofolate reductase 0.9717 1 201 GO:0008703
GO:0009231
AF-A0A1H6VBG3-F1-model_v4 Dihydrofolate reductase 0.9711 1 217 GO:0008703
GO:0009231
AF-A0A528A7F9-F1-model_v4 Dihydrofolate reductase 0.9707 1 158 GO:0008703
GO:0009231
AF-A0A530GKI4-F1-model_v4 Dihydrofolate reductase 0.9682 52 190 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
90.86 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map