F448278

General Info

Members Datasets Scaffolds Average Seq Length
458 313 383 421

Family's Representative Sequence

Representative Sequence 3300053125|Ga0500618_000410|Ga0500618_000410_18149_19642
Length 497
Sequence LDNVGQALILGFADDANRPFLLPLRNLRRSAVRQTRASFDELCMISALAWQLHRAWHCLTQETDMTLQTAASFAEPDMTLARHLFDQMRRDNTELNGDSPGITRDTYGHGEQRAHALMRDTAHKLGLEISTDAALNLYLTLPGRDRTAAVVMTGSHLDSVPRGGNYDGAAGVVAGLAVLAGWINSGLQPQCDVTVMGIRAEESAWFPVSYIGSKSAFGLLPADTLDILRLDTRRSLRRHLQECGGRPDDIGVTPPHLVAASIACFLELHIEQGPVLVEAGQQVGVVTGICGSLRYRHAQVTGEYAHSGATPRTHRRDAVVALAEVITRLQQDWAAMEEQGHELTLTLGQVFTDAGQADISKVSGLVSFGVDIRSRSTDSLQCMERHLFDAVAVAQERHGVHFALGERTGSQPAQMDALLQDQLQAAAQQFALSQRRLPSGAGHDSALFANQGIPTGMLFVRNGNGSHNPDEAMELDDFAAGTRVLAQVMAARAGLTD

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
4 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
5 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
6 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
7 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
8 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
9 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
10 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
11 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
12 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
13 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
14 2855730933 Achromobacter sp. HZ28 Isolate Nodule
15 2855767633 Achromobacter sp. HZ34 Isolate Nodule
16 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
17 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
18 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
19 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
20 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
21 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
22 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
23 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
24 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
25 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
26 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
27 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
28 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
29 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
30 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
31 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
32 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
33 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
34 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
35 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
36 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
37 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
38 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
39 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
40 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
41 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
42 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
43 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
44 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
45 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
46 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
47 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
48 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
49 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
50 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
51 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
52 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
53 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
54 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
55 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
56 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
57 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
58 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
59 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
60 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
61 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
62 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
63 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
64 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
65 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
66 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
67 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
68 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
69 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
70 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
71 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
72 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
73 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
74 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
75 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
76 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
77 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
78 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
79 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
80 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
81 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
82 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
83 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
84 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
85 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
86 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
87 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
88 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
89 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
90 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
91 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
92 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
93 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
94 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
95 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
96 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
97 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
98 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
99 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
100 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
101 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
102 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
103 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
104 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
105 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
106 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
107 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
108 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
109 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
110 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
111 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
112 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
113 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
114 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
115 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
116 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
117 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
118 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
119 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
120 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
121 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
122 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
124 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
125 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
126 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
127 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
128 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
129 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
130 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
131 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
132 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
134 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
135 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
136 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
137 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
138 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
139 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
140 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
141 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
142 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
143 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
144 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
145 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
146 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
147 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
148 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
149 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
150 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
151 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
152 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
153 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
158 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
160 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
161 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
204 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
205 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
206 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
207 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
208 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
211 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
220 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
221 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
222 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
223 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
224 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
228 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
229 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
230 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
231 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
232 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
233 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
234 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
235 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
236 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
239 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
240 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
241 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
246 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
247 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
250 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
251 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
268 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
269 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
270 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
271 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
272 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
273 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
276 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
281 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
282 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
283 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
284 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
287 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
288 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
292 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
295 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
296 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
297 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
298 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
299 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
300 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
301 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
302 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
303 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
304 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
305 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
306 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
307 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
308 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
309 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
310 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
311 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
312 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
313 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.62
Metatranscriptomes 0
Isolates 16.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.73
Nodule 11.57
Rhizoplane 7.42
Rhizosphere 62.88
Stem 0
Stem Tuber 0
Unclassified 9.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007833 3300001979 Bacteria 4310
2 JGI25156J39149_1004459 3300002705 Bacteria 4261
3 JGI25157J39369_1000509 3300002741 Bacteria 23973
4 JGI25151J46595_10000437 3300003187 Bacteria 41251
5 JGI25151J46595_10001720 3300003187 Bacteria 14296
6 JGI25165J46597_1000062 3300003214 Bacteria 206459
7 JGI25153J46596_10000010 3300003215 Bacteria 337769
8 rootH1_10115634 3300003316 Bacteria 3961
9 rootH2_10139111 3300003320 Bacteria 2298
10 rootH1_10283499 3300003323 Bacteria 2832
11 Ga0055538_1000053 3300003751 Bacteria 127408
12 Ga0055539_1000078 3300003752 Bacteria 127408
13 Ga0055533_1000084 3300003756 Bacteria 127408
14 Ga0055525_1000112 3300003759 Bacteria 127408
15 Ga0055541_1000055 3300003841 Bacteria 127408
16 Ga0070670_100003160 3300005331 Bacteria 13622
17 Ga0070666_10001092 3300005335 Bacteria 16566
18 Ga0070666_10026662 3300005335 Bacteria 3778
19 Ga0070666_10156723 3300005335 Bacteria 1590
20 Ga0068868_100009167 3300005338 Bacteria 7107
21 Ga0068868_100148000 3300005338 Bacteria 1932
22 Ga0070660_100089709 3300005339 Bacteria 2422
23 Ga0070675_100011959 3300005354 Bacteria 6802
24 Ga0070671_100033438 3300005355 Bacteria 4252
25 Ga0070671_100099234 3300005355 Bacteria 2442
26 Ga0070674_100047298 3300005356 Bacteria 2946
27 Ga0070673_100020692 3300005364 Bacteria 4749
28 Ga0070667_100027248 3300005367 Bacteria 4754
29 Ga0070709_10001998 3300005434 Bacteria 11100
30 Ga0070709_10003026 3300005434 Bacteria 9026
31 Ga0070713_100001479 3300005436 Bacteria 14975
32 Ga0070713_100033122 3300005436 Bacteria 4136
33 Ga0070713_100072325 3300005436 Bacteria 2916
34 Ga0070713_100076717 3300005436 Bacteria 2839
35 Ga0070711_100007052 3300005439 Bacteria 6816
36 Ga0070711_100028910 3300005439 Bacteria 3651
37 Ga0070694_100050943 3300005444 Bacteria 2793
38 Ga0070694_100070811 3300005444 Bacteria 2402
39 Ga0070708_100228467 3300005445 Bacteria 1746
40 Ga0070678_100040150 3300005456 Bacteria 3309
41 Ga0070681_10040618 3300005458 Bacteria 4660
42 Ga0070699_100040097 3300005518 Bacteria 4055
43 Ga0070679_100100644 3300005530 Bacteria 2876
44 Ga0068853_100068750 3300005539 Bacteria 3079
45 Ga0070672_100057312 3300005543 Bacteria 3058
46 Ga0070695_100005487 3300005545 Bacteria 7470
47 Ga0070695_100025417 3300005545 Bacteria 3656
48 Ga0070696_100001492 3300005546 Bacteria 15339
49 Ga0070665_100002513 3300005548 Bacteria 20153
50 Ga0070665_100003649 3300005548 Bacteria 16306
51 Ga0070665_100007777 3300005548 Bacteria 10889
52 Ga0070665_100026088 3300005548 Bacteria 5884
53 Ga0070665_100032447 3300005548 Bacteria 5256
54 Ga0070665_100043918 3300005548 Bacteria 4489
55 Ga0068855_100000578 3300005563 Bacteria 44980
56 Ga0068855_100312919 3300005563 Bacteria 1737
57 Ga0070664_100108759 3300005564 Unclassified 2418
58 Ga0068856_100015934 3300005614 Bacteria 7267
59 Ga0068856_100182886 3300005614 Bacteria 2110
60 Ga0068852_100011701 3300005616 Bacteria 6620
61 Ga0068864_100001645 3300005618 Bacteria 18403
62 Ga0068863_100007382 3300005841 Bacteria 10757
63 Ga0068863_100015779 3300005841 Bacteria 7250
64 Ga0068863_100077765 3300005841 Bacteria 3140
65 Ga0068863_100132658 3300005841 Bacteria 2378
66 Ga0068858_100033449 3300005842 Bacteria 4770
67 Ga0068858_100045221 3300005842 Bacteria 4079
68 Ga0068858_100092117 3300005842 Bacteria 2821
69 Ga0068858_100093564 3300005842 Bacteria 2798
70 Ga0068860_100000967 3300005843 Bacteria 31813
71 Ga0068860_100015315 3300005843 Bacteria 7490
72 Ga0068860_100183895 3300005843 Bacteria 2020
73 Ga0070717_10003466 3300006028 Bacteria 11292
74 Ga0075365_10032997 3300006038 Bacteria 3333
75 Ga0075365_10074772 3300006038 Bacteria 2285
76 Ga0070715_10001135 3300006163 Bacteria 7598
77 Ga0070716_100001440 3300006173 Bacteria 10577
78 Ga0070712_100017270 3300006175 Bacteria 4669
79 Ga0075362_10023539 3300006177 Bacteria 2606
80 Ga0075367_10036779 3300006178 Bacteria 2841
81 Ga0097621_100030249 3300006237 Bacteria 4285
82 Ga0075370_10035317 3300006353 Bacteria 2805
83 Ga0068871_100029928 3300006358 Bacteria 4282
84 Ga0068871_100106656 3300006358 Bacteria 2352
85 Ga0075428_100007110 3300006844 Bacteria 12394
86 Ga0075428_100256037 3300006844 Bacteria 1885
87 Ga0075431_100019336 3300006847 Bacteria 6942
88 Ga0075431_100103494 3300006847 Bacteria 2939
89 Ga0075434_100108366 3300006871 Unclassified 2788
90 Ga0075429_100008461 3300006880 Bacteria 8957
91 Ga0075429_100038497 3300006880 Bacteria 4163
92 Ga0068865_100008073 3300006881 Bacteria 6498
93 Ga0068865_100044627 3300006881 Bacteria 3035
94 Ga0068865_100060952 3300006881 Bacteria 2643
95 Ga0075435_100268751 3300007076 Bacteria 1454
96 Ga0105240_10001958 3300009093 Bacteria 34069
97 Ga0105240_10006926 3300009093 Bacteria 16559
98 Ga0105240_10150059 3300009093 Bacteria 2777
99 Ga0105240_10338988 3300009093 Bacteria 1708
100 Ga0105240_10482099 3300009093 Bacteria 1382
101 Ga0111539_10008336 3300009094 Bacteria 13191
102 Ga0111539_10033377 3300009094 Bacteria 6248
103 Ga0111539_10069930 3300009094 Bacteria 4144
104 Ga0105245_10039038 3300009098 Bacteria 4226
105 Ga0105245_10040661 3300009098 Bacteria 4143
106 Ga0105247_10004216 3300009101 Bacteria 9220
107 Ga0114129_10076283 3300009147 Unclassified 4667
108 Ga0105241_10032331 3300009174 Bacteria 3922
109 Ga0105242_10012628 3300009176 Bacteria 6505
110 Ga0105248_10041124 3300009177 Bacteria 5182
111 Ga0105248_10052280 3300009177 Bacteria 4584
112 Ga0105237_10003794 3300009545 Bacteria 17752
113 Ga0105237_10021160 3300009545 Bacteria 6690
114 Ga0105238_10051054 3300009551 Bacteria 4161
115 Ga0105238_10100218 3300009551 Bacteria 2880
116 Ga0105249_10029834 3300009553 Bacteria 4927
117 Ga0105249_10068361 3300009553 Bacteria 3276
118 Ga0099796_10000718 3300010159 Bacteria 5876
119 Ga0099796_10002773 3300010159 Bacteria 3931
120 Ga0105239_10065682 3300010375 Bacteria 3985
121 Ga0105239_10323399 3300010375 Bacteria 1739
122 Ga0157370_10062361 3300013104 Bacteria 3536
123 Ga0157374_10018761 3300013296 Bacteria 6112
124 Ga0157374_10034872 3300013296 Bacteria 4600
125 Ga0157374_10089616 3300013296 Bacteria 2931
126 Ga0157378_10014520 3300013297 Bacteria 6896
127 Ga0157378_10093437 3300013297 Bacteria 2738
128 Ga0163162_10072233 3300013306 Bacteria 3505
129 Ga0157375_10012922 3300013308 Bacteria 7417
130 Ga0157375_10013243 3300013308 Bacteria 7332
131 Ga0157375_10016757 3300013308 Bacteria 6594
132 Ga0163163_10009634 3300014325 Bacteria 8638
133 Ga0163163_10029568 3300014325 Bacteria 5273
134 Ga0163163_10077183 3300014325 Bacteria 3327
135 Ga0157379_10002825 3300014968 Bacteria 14630
136 Ga0157376_10020344 3300014969 Bacteria 5132
137 Ga0213872_10001953 3300021361 Bacteria 12576
138 Ga0209784_100035 3300025224 Bacteria 299760
139 Ga0209566_100040 3300025225 Bacteria 299760
140 Ga0209674_100057 3300025226 Bacteria 299760
141 Ga0209563_100059 3300025230 Bacteria 299760
142 Ga0209026_1000107 3300025250 Bacteria 148993
143 Ga0209677_100036 3300025253 Bacteria 299760
144 Ga0209759_1000197 3300025256 Bacteria 95422
145 Ga0209233_1000129 3300025261 Bacteria 206511
146 Ga0209025_1000018 3300025294 Bacteria 686898
147 Ga0209025_1000027 3300025294 Bacteria 505882
148 Ga0209758_1000033 3300025297 Bacteria 469998
149 Ga0207692_10034701 3300025898 Bacteria 2444
150 Ga0207710_10007501 3300025900 Bacteria 4619
151 Ga0207647_10061554 3300025904 Bacteria 2290
152 Ga0207685_10007658 3300025905 Bacteria 3024
153 Ga0207699_10002058 3300025906 Bacteria 9498
154 Ga0207699_10004857 3300025906 Bacteria 6433
155 Ga0207699_10012825 3300025906 Bacteria 4270
156 Ga0207654_10093187 3300025911 Bacteria 1841
157 Ga0207707_10018188 3300025912 Bacteria 6125
158 Ga0207695_10009535 3300025913 Bacteria 12003
159 Ga0207695_10030415 3300025913 Bacteria 5943
160 Ga0207695_10055856 3300025913 Bacteria 4112
161 Ga0207671_10026639 3300025914 Bacteria 4330
162 Ga0207671_10032968 3300025914 Bacteria 3855
163 Ga0207693_10001132 3300025915 Bacteria 23882
164 Ga0207693_10042413 3300025915 Bacteria 3582
165 Ga0207663_10024224 3300025916 Bacteria 3494
166 Ga0207663_10054502 3300025916 Bacteria 2504
167 Ga0207657_10055897 3300025919 Bacteria 3407
168 Ga0207681_10016529 3300025923 Bacteria 4617
169 Ga0207650_10000953 3300025925 Bacteria 21746
170 Ga0207659_10000823 3300025926 Bacteria 18384
171 Ga0207687_10022085 3300025927 Bacteria 4233
172 Ga0207700_10047704 3300025928 Bacteria 3176
173 Ga0207700_10189937 3300025928 Bacteria 1726
174 Ga0207664_10004659 3300025929 Bacteria 9303
175 Ga0207644_10077750 3300025931 Bacteria 2444
176 Ga0207686_10056248 3300025934 Bacteria 2472
177 Ga0207670_10107952 3300025936 Bacteria 2000
178 Ga0207669_10031768 3300025937 Bacteria 2955
179 Ga0207669_10193388 3300025937 Bacteria 1470
180 Ga0207704_10048411 3300025938 Bacteria 2548
181 Ga0207665_10001187 3300025939 Bacteria 17539
182 Ga0207665_10027790 3300025939 Bacteria 3737
183 Ga0207691_10022849 3300025940 Bacteria 5895
184 Ga0207691_10064912 3300025940 Bacteria 3306
185 Ga0207711_10002260 3300025941 Bacteria 17290
186 Ga0207711_10133308 3300025941 Bacteria 2229
187 Ga0207689_10274525 3300025942 Bacteria 1396
188 Ga0207667_10016166 3300025949 Bacteria 8438
189 Ga0207651_10039786 3300025960 Bacteria 3104
190 Ga0207658_10043398 3300025986 Bacteria 3268
191 Ga0207703_10000441 3300026035 Bacteria 43739
192 Ga0207703_10010691 3300026035 Bacteria 7165
193 Ga0207639_10071402 3300026041 Bacteria 2715
194 Ga0207639_10201559 3300026041 Bacteria 1707
195 Ga0207702_10254884 3300026078 Bacteria 1649
196 Ga0207641_10000878 3300026088 Bacteria 31489
197 Ga0207641_10006392 3300026088 Bacteria 9934
198 Ga0207641_10150434 3300026088 Bacteria 2108
199 Ga0207641_10192140 3300026088 Bacteria 1877
200 Ga0207676_10025781 3300026095 Bacteria 4365
201 Ga0207676_10042206 3300026095 Bacteria 3507
202 Ga0207683_10003890 3300026121 Bacteria 12952
203 Ga0207683_10005689 3300026121 Bacteria 10693
204 Ga0207698_10035605 3300026142 Bacteria 3644
205 Ga0207428_10004005 3300027907 Bacteria 14145
206 Ga0268266_10004156 3300028379 Bacteria 13961
207 Ga0268266_10011428 3300028379 Bacteria 7722
208 Ga0268266_10027012 3300028379 Bacteria 4884
209 Ga0268266_10042561 3300028379 Bacteria 3880
210 Ga0268264_10000025 3300028381 Bacteria 468619
211 Ga0265334_10025818 3300028573 Bacteria 2376
212 Ga0265338_10007774 3300028800 Bacteria 13192
213 Ga0307511_10005843 3300030521 Bacteria 12440
214 Ga0265327_10023792 3300031251 Bacteria 3616
215 Ga0307513_10012818 3300031456 Bacteria 10325
216 Ga0307509_10000021 3300031507 Bacteria 250589
217 Ga0307415_100158616 3300032126 Bacteria 1751
218 Ga0307510_10000007 3300033180 Bacteria 558582
219 Ga0307510_10003221 3300033180 Bacteria 18977
220 Ga0373936_0016335 3300035113 Bacteria 2855
221 Ga0373935_0093016 3300035692 Bacteria 1977
222 Ga0373927_0055751 3300035695 Bacteria 2555
223 Ga0373937_0005016 3300036401 Bacteria 11267
224 Ga0373937_0126882 3300036401 Unclassified 2381
225 Ga0395900_0197558 3300037418 Bacteria 2037
226 Ga0395905_0224510 3300037471 Bacteria 1758
227 Ga0395901_0053505 3300038443 Bacteria 4194
228 Ga0395901_0295559 3300038443 Bacteria 1680
229 Ga0436365_0217389 3300039437 Bacteria 2864
230 Ga0436365_0420242 3300039437 Bacteria 11569
231 Ga0436360_1185384 3300039438 Bacteria 1838
232 Ga0436361_0419956 3300039447 Bacteria 5026
233 Ga0436361_1048389 3300039447 Bacteria 13674
234 Ga0436363_0220896 3300039450 Bacteria 7392
235 Ga0436363_1117213 3300039450 Bacteria 1997
236 Ga0436363_1499254 3300039450 Bacteria 1859
237 Ga0466960_0017541 3300044901 Bacteria 3123
238 Ga0495627_000164 3300046453 Bacteria 75744
239 Ga0495627_000677 3300046453 Bacteria 26224
240 Ga0495591_000002 3300046458 Bacteria 455013
241 Ga0495653_0000256 3300046463 Bacteria 42712
242 Ga0495580_0000382 3300046472 Bacteria 36329
243 Ga0495580_0051908 3300046472 Bacteria 2897
244 Ga0495605_0000052 3300046474 Bacteria 162723
245 Ga0495605_0000550 3300046474 Bacteria 30682
246 Ga0495605_0051160 3300046474 Bacteria 2012
247 Ga0495607_0000007 3300046501 Bacteria 272517
248 Ga0495607_0000045 3300046501 Bacteria 125217
249 Ga0495607_0000052 3300046501 Bacteria 118863
250 Ga0495607_0049887 3300046501 Bacteria 2439
251 Ga0495583_0000089 3300046506 Bacteria 163349
252 Ga0495583_0000747 3300046506 Bacteria 41311
253 Ga0495606_0000398 3300046507 Bacteria 73352
254 Ga0495610_0044822 3300046512 Bacteria 2193
255 Ga0495616_0075390 3300046513 Bacteria 1623
256 Ga0495618_0126178 3300046514 Bacteria 1639
257 Ga0495631_0000582 3300046518 Bacteria 24350
258 Ga0495632_0000158 3300046519 Bacteria 70148
259 Ga0495632_0022141 3300046519 Bacteria 3410
260 Ga0495637_0000143 3300046520 Bacteria 53795
261 Ga0495637_0000987 3300046520 Bacteria 18000
262 Ga0495637_0009549 3300046520 Bacteria 4729
263 Ga0495637_0017868 3300046520 Bacteria 3297
264 Ga0495652_0071528 3300046529 Bacteria 2895
265 Ga0495654_0000200 3300046530 Bacteria 57799
266 Ga0495654_0000664 3300046530 Bacteria 27101
267 Ga0495654_0033204 3300046530 Bacteria 2613
268 Ga0495654_0053321 3300046530 Bacteria 1966
269 Ga0495640_0033543 3300046533 Bacteria 3646
270 Ga0495609_0000033 3300046538 Bacteria 208889
271 Ga0495609_0052375 3300046538 Bacteria 1816
272 Ga0495597_0000023 3300046542 Bacteria 149302
273 Ga0495634_0101166 3300046642 Bacteria 1862
274 Ga0495661_0000670 3300046665 Bacteria 34283
275 Ga0495623_0069871 3300046679 Bacteria 2188
276 Ga0495649_0107720 3300046694 Bacteria 1479
277 Ga0495660_0000088 3300046810 Bacteria 98970
278 Ga0495660_0002686 3300046810 Bacteria 11244
279 Ga0495660_0003407 3300046810 Bacteria 9840
280 Ga0495604_0275332 3300047317 Bacteria 1139
281 Ga0495674_0092355 3300047319 Bacteria 2584
282 Ga0495672_0000761 3300047320 Bacteria 35155
283 Ga0495672_0001464 3300047320 Bacteria 23176
284 Ga0495672_0001928 3300047320 Bacteria 19617
285 Ga0495672_0015546 3300047320 Bacteria 5163
286 Ga0495673_0000490 3300047469 Bacteria 42198
287 Ga0495673_0000538 3300047469 Bacteria 39158
288 Ga0495673_0004403 3300047469 Bacteria 8829
289 Ga0495686_0087380 3300047472 Bacteria 1896
290 Ga0496100_0026578 3300048903 Bacteria 3549
291 Ga0496100_0066781 3300048903 Bacteria 2387
292 Ga0496101_0002879 3300048904 Bacteria 10584
293 Ga0496101_0018494 3300048904 Bacteria 4739
294 Ga0496102_0013972 3300048905 Bacteria 6970
295 Ga0496102_0029452 3300048905 Bacteria 4912
296 Ga0496102_0248224 3300048905 Bacteria 1678
297 Ga0496103_0104277 3300048906 Bacteria 1797
298 Ga0496104_0011750 3300048907 Bacteria 7855
299 Ga0496104_0024861 3300048907 Bacteria 5515
300 Ga0496104_0113249 3300048907 Bacteria 2601
301 Ga0496105_0001577 3300048908 Bacteria 16168
302 Ga0496106_0000376 3300048909 Bacteria 31754
303 Ga0496106_0019886 3300048909 Bacteria 4979
304 Ga0496107_0004183 3300048910 Bacteria 9748
305 Ga0496107_0027100 3300048910 Bacteria 4068
306 Ga0496108_0017196 3300048911 Bacteria 5916
307 Ga0496108_0076434 3300048911 Bacteria 2830
308 Ga0496109_0036574 3300048912 Bacteria 4432
309 Ga0496109_0052159 3300048912 Bacteria 3727
310 Ga0496109_0155110 3300048912 Unclassified 2145
311 Ga0496110_0025073 3300048913 Bacteria 5091
312 Ga0496110_0025948 3300048913 Bacteria 5009
313 Ga0496110_0037229 3300048913 Bacteria 4228
314 Ga0496110_0099450 3300048913 Bacteria 2607
315 Ga0496111_0024777 3300048914 Bacteria 4231
316 Ga0496111_0038241 3300048914 Bacteria 3437
317 Ga0496111_0138740 3300048914 Bacteria 1801
318 Ga0496112_0020051 3300048915 Bacteria 6330
319 Ga0496112_0150324 3300048915 Bacteria 2296
320 Ga0496114_0000240 3300048917 Bacteria 39991
321 Ga0496114_0037839 3300048917 Bacteria 3991
322 Ga0496115_0047962 3300048918 Bacteria 3417
323 Ga0496115_0096832 3300048918 Bacteria 2416
324 Ga0496116_0015836 3300048919 Bacteria 5936
325 Ga0496116_0019147 3300048919 Bacteria 5249
326 Ga0496117_0000573 3300048920 Bacteria 60369
327 Ga0496118_0000170 3300048921 Bacteria 117661
328 Ga0496119_0002300 3300048922 Bacteria 21125
329 Ga0496119_0068014 3300048922 Bacteria 2099
330 Ga0496120_0000018 3300048923 Bacteria 263952
331 Ga0496120_0018120 3300048923 Bacteria 4546
332 Ga0496121_0057812 3300048924 Bacteria 3211
333 Ga0496125_0000250 3300048928 Bacteria 110567
334 Ga0496125_0001743 3300048928 Bacteria 30228
335 Ga0496125_0005273 3300048928 Bacteria 14473
336 Ga0496126_0016881 3300048929 Bacteria 7286
337 Ga0495678_000382 3300049459 Bacteria 44896
338 Ga0495678_003524 3300049459 Bacteria 9621
339 Ga0501033_0087732 3300049570 Bacteria 2277
340 Ga0501034_0062500 3300049571 Bacteria 3739
341 Ga0501034_0104762 3300049571 Bacteria 2822
342 Ga0501036_0167551 3300049572 Bacteria 1851
343 Ga0501042_0178675 3300049578 Bacteria 1531
344 Ga0501067_0045437 3300049583 Bacteria 2439
345 Ga0501070_0147604 3300049586 Bacteria 1941
346 Ga0501073_0044945 3300049589 Bacteria 3112
347 Ga0501076_0257797 3300049592 Bacteria 1427
348 Ga0501079_0026332 3300049741 Bacteria 4460
349 Ga0501083_0006155 3300049744 Bacteria 8514
350 Ga0501083_0025299 3300049744 Bacteria 4109
351 nmdc:mga0yw44_2147_c1 3300050492 Bacteria 8275
352 nmdc:mga05p37_9030_c1 3300050507 Bacteria 11790
353 nmdc:mga09592_7538_c1 3300050508 Bacteria 8854
354 nmdc:mga06r32_18723_c1 3300050510 Bacteria 6345
355 nmdc:mga06r32_92451_c1 3300050510 Bacteria 2958
356 nmdc:mga08y16_12410_c1 3300050511 Bacteria 8963
357 nmdc:mga08y16_48104_c1 3300050511 Bacteria 4463
358 nmdc:mga08y16_49601_c1 3300050511 Bacteria 4393
359 nmdc:mga08y16_89105_c1 3300050511 Bacteria 3215
360 nmdc:mga0n895_49454_c1 3300050512 Bacteria 4119
361 nmdc:mga0n895_52704_c1 3300050512 Bacteria 3994
362 nmdc:mga0rr50_45143_c1 3300050513 Bacteria 3236
363 nmdc:mga0a205_236215_c1 3300050515 Unclassified 1710
364 Ga0500610_0061587 3300053079 Bacteria 1959
365 Ga0500583_0058029 3300053092 Bacteria 1819
366 Ga0500583_0075504 3300053092 Bacteria 1619
367 Ga0500651_0010553 3300053093 Bacteria 5541
368 Ga0500651_0018540 3300053093 Bacteria 4309
369 Ga0500650_0060122 3300053098 Bacteria 1774
370 Ga0500555_013748 3300053103 Bacteria 2335
371 Ga0500595_002223 3300053119 Bacteria 9856
372 Ga0500618_000130 3300053125 Bacteria 62583
373 Ga0500618_000410 3300053125 Bacteria 29005
374 Ga0500618_002254 3300053125 Bacteria 7501
375 Ga0500618_002325 3300053125 Bacteria 7293
376 Ga0500568_0000019 3300053139 Bacteria 195696
377 Ga0500577_0052403 3300053142 Bacteria 1538
378 Ga0500604_0000802 3300053151 Bacteria 8679
379 Ga0500634_0007460 3300053161 Bacteria 5397
380 Ga0501084_0091367 3300054114 Unclassified 2556
381 Ga0501084_0144755 3300054114 Bacteria 2002
382 Ga0501082_0079832 3300060353 Bacteria 2823
383 Ga0530510_0109419 3300061734 Bacteria 2023

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050511 nmdc:mga08y16_49601_c1 nmdc:mga08y16_49601_c1_3328_4362 343
2 iso_pu_bacteria 2924710171 2924710764 348
3 3300047317 Ga0495604_0275332 Ga0495604_0275332_57_1115 352
4 3300038443 Ga0395901_0295559 Ga0395901_0295559_556_1626 356
5 iso_pu_bacteria 2977907340 2977913518 361
6 3300036401 Ga0373937_0126882 Ga0373937_0126882_1239_2363 374
7 3300053125 Ga0500618_000130 Ga0500618_000130_11662_12978 386
8 iso_pu_bacteria 3004248173 3004254317 389
9 3300046530 Ga0495654_0000200 Ga0495654_0000200_2579_3895 393
10 3300010159 Ga0099796_10000718 Ga0099796_100007182 395
11 3300049570 Ga0501033_0087732 Ga0501033_0087732_614_1873 401
12 3300049744 Ga0501083_0025299 Ga0501083_0025299_1443_2702 401
13 3300054114 Ga0501084_0144755 Ga0501084_0144755_91_1350 401
14 3300046520 Ga0495637_0017868 Ga0495637_0017868_1641_2894 402
15 3300003215 JGI25153J46596_10000010 JGI25153J46596_10000010261 403
16 3300025297 Ga0209758_1000033 Ga0209758_1000033403 403
17 3300007076 Ga0075435_100268751 Ga0075435_1002687511 404
18 3300046501 Ga0495607_0000045 Ga0495607_0000045_120658_121929 404
19 3300047320 Ga0495672_0015546 Ga0495672_0015546_2891_4162 404
20 3300050512 nmdc:mga0n895_52704_c1 nmdc:mga0n895_52704_c1_517_1770 404
21 3300050513 nmdc:mga0rr50_45143_c1 nmdc:mga0rr50_45143_c1_1807_3060 404
22 3300005458 Ga0070681_10040618 Ga0070681_100406184 407
23 3300005530 Ga0070679_100100644 Ga0070679_1001006442 407
24 3300025912 Ga0207707_10018188 Ga0207707_100181882 407
25 3300025916 Ga0207663_10024224 Ga0207663_100242243 409
26 3300046506 Ga0495583_0000089 Ga0495583_0000089_12716_13996 409
27 3300046519 Ga0495632_0000158 Ga0495632_0000158_44177_45457 409
28 3300046520 Ga0495637_0009549 Ga0495637_0009549_3332_4612 409
29 3300046642 Ga0495634_0101166 Ga0495634_0101166_181_1410 409
30 3300053092 Ga0500583_0058029 Ga0500583_0058029_146_1414 409
31 3300053151 Ga0500604_0000802 Ga0500604_0000802_576_1844 409
32 3300005548 Ga0070665_100043918 Ga0070665_1000439184 410
33 3300028379 Ga0268266_10042561 Ga0268266_100425614 410
34 3300005434 Ga0070709_10003026 Ga0070709_100030269 411
35 3300005436 Ga0070713_100001479 Ga0070713_1000014799 411
36 3300005614 Ga0068856_100182886 Ga0068856_1001828861 411
37 3300006028 Ga0070717_10003466 Ga0070717_100034663 411
38 3300025906 Ga0207699_10004857 Ga0207699_100048574 411
39 3300025929 Ga0207664_10004659 Ga0207664_100046595 411
40 3300037471 Ga0395905_0224510 Ga0395905_0224510_51_1352 411
41 3300006844 Ga0075428_100007110 Ga0075428_1000071109 412
42 3300006847 Ga0075431_100019336 Ga0075431_1000193363 412
43 3300006871 Ga0075434_100108366 Ga0075434_1001083662 412
44 3300006880 Ga0075429_100008461 Ga0075429_1000084617 412
45 3300009094 Ga0111539_10008336 Ga0111539_1000833610 412
46 3300009147 Ga0114129_10076283 Ga0114129_100762832 412
47 3300027907 Ga0207428_10004005 Ga0207428_100040052 412
48 3300046472 Ga0495580_0000382 Ga0495580_0000382_16825_18078 412
49 3300046474 Ga0495605_0051160 Ga0495605_0051160_258_1568 412
50 3300046501 Ga0495607_0000052 Ga0495607_0000052_98348_99625 412
51 3300046665 Ga0495661_0000670 Ga0495661_0000670_24951_26231 412
52 3300050507 nmdc:mga05p37_9030_c1 nmdc:mga05p37_9030_c1_2376_3689 412
53 3300050508 nmdc:mga09592_7538_c1 nmdc:mga09592_7538_c1_834_2147 412
54 3300050510 nmdc:mga06r32_18723_c1 nmdc:mga06r32_18723_c1_1957_3270 412
55 3300050511 nmdc:mga08y16_12410_c1 nmdc:mga08y16_12410_c1_7293_8606 412
56 3300050512 nmdc:mga0n895_49454_c1 nmdc:mga0n895_49454_c1_1959_3272 412
57 3300050515 nmdc:mga0a205_236215_c1 nmdc:mga0a205_236215_c1_402_1694 412
58 3300005444 Ga0070694_100070811 Ga0070694_1000708112 413
59 iso_pu_bacteria 2883577096 2883577164 413
60 3300003316 rootH1_10115634 rootH1_101156344 414
61 3300003320 rootH2_10139111 rootH2_101391112 414
62 3300003323 rootH1_10283499 rootH1_102834992 414
63 3300005335 Ga0070666_10001092 Ga0070666_1000109215 414
64 3300005335 Ga0070666_10156723 Ga0070666_101567232 414
65 3300005338 Ga0068868_100148000 Ga0068868_1001480002 414
66 3300005355 Ga0070671_100033438 Ga0070671_1000334383 414
67 3300005436 Ga0070713_100076717 Ga0070713_1000767172 414
68 3300005539 Ga0068853_100068750 Ga0068853_1000687503 414
69 3300005548 Ga0070665_100003649 Ga0070665_10000364914 414
70 3300005563 Ga0068855_100000578 Ga0068855_1000005785 414
71 3300005841 Ga0068863_100015779 Ga0068863_1000157792 414
72 3300005841 Ga0068863_100132658 Ga0068863_1001326582 414
73 3300005842 Ga0068858_100033449 Ga0068858_1000334494 414
74 3300005842 Ga0068858_100045221 Ga0068858_1000452214 414
75 3300005843 Ga0068860_100000967 Ga0068860_10000096720 414
76 3300005843 Ga0068860_100015315 Ga0068860_1000153152 414
77 3300006358 Ga0068871_100029928 Ga0068871_1000299283 414
78 3300006881 Ga0068865_100044627 Ga0068865_1000446272 414
79 3300009093 Ga0105240_10001958 Ga0105240_1000195825 414
80 3300009093 Ga0105240_10006926 Ga0105240_100069269 414
81 3300009093 Ga0105240_10150059 Ga0105240_101500592 414
82 3300009093 Ga0105240_10482099 Ga0105240_104820992 414
83 3300009098 Ga0105245_10040661 Ga0105245_100406613 414
84 3300009177 Ga0105248_10052280 Ga0105248_100522803 414
85 3300009545 Ga0105237_10003794 Ga0105237_100037947 414
86 3300009551 Ga0105238_10051054 Ga0105238_100510542 414
87 3300009551 Ga0105238_10100218 Ga0105238_101002181 414
88 3300009553 Ga0105249_10029834 Ga0105249_100298343 414
89 3300009553 Ga0105249_10068361 Ga0105249_100683612 414
90 3300010159 Ga0099796_10002773 Ga0099796_100027732 414
91 3300013296 Ga0157374_10089616 Ga0157374_100896162 414
92 3300013306 Ga0163162_10072233 Ga0163162_100722333 414
93 3300013308 Ga0157375_10016757 Ga0157375_100167574 414
94 3300014325 Ga0163163_10009634 Ga0163163_100096346 414
95 3300014968 Ga0157379_10002825 Ga0157379_1000282511 414
96 3300025913 Ga0207695_10009535 Ga0207695_100095358 414
97 3300025913 Ga0207695_10055856 Ga0207695_100558562 414
98 3300025914 Ga0207671_10032968 Ga0207671_100329684 414
99 3300025927 Ga0207687_10022085 Ga0207687_100220854 414
100 3300025938 Ga0207704_10048411 Ga0207704_100484112 414
101 3300025941 Ga0207711_10002260 Ga0207711_100022602 414
102 3300025949 Ga0207667_10016166 Ga0207667_100161665 414
103 3300025960 Ga0207651_10039786 Ga0207651_100397862 414
104 3300026035 Ga0207703_10000441 Ga0207703_1000044121 414
105 3300026035 Ga0207703_10010691 Ga0207703_100106912 414
106 3300026041 Ga0207639_10071402 Ga0207639_100714022 414
107 3300026088 Ga0207641_10000878 Ga0207641_1000087816 414
108 3300026095 Ga0207676_10042206 Ga0207676_100422064 414
109 3300028379 Ga0268266_10004156 Ga0268266_100041567 414
110 3300028381 Ga0268264_10000025 Ga0268264_10000025349 414
111 3300033180 Ga0307510_10000007 Ga0307510_10000007454 414
112 3300048905 Ga0496102_0029452 Ga0496102_0029452_1632_2876 414
113 3300048911 Ga0496108_0017196 Ga0496108_0017196_4397_5641 414
114 3300048912 Ga0496109_0052159 Ga0496109_0052159_726_1970 414
115 3300048913 Ga0496110_0025073 Ga0496110_0025073_1296_2540 414
116 3300048914 Ga0496111_0138740 Ga0496111_0138740_32_1276 414
117 3300048919 Ga0496116_0015836 Ga0496116_0015836_2580_3824 414
118 3300048920 Ga0496117_0000573 Ga0496117_0000573_2104_3348 414
119 3300048921 Ga0496118_0000170 Ga0496118_0000170_114215_115459 414
120 3300048922 Ga0496119_0002300 Ga0496119_0002300_9220_10467 414
121 3300048923 Ga0496120_0000018 Ga0496120_0000018_16770_18017 414
122 3300048924 Ga0496121_0057812 Ga0496121_0057812_225_1469 414
123 3300048928 Ga0496125_0001743 Ga0496125_0001743_11477_12721 414
124 3300048928 Ga0496125_0005273 Ga0496125_0005273_7957_9201 414
125 3300048929 Ga0496126_0016881 Ga0496126_0016881_5847_7094 414
126 iso_pu_bacteria 2854681122 2854684657 415
127 iso_pu_bacteria 2871466892 2871472111 415
128 3300053161 Ga0500634_0007460 Ga0500634_0007460_2983_4236 416
129 3300005335 Ga0070666_10026662 Ga0070666_100266623 417
130 3300005338 Ga0068868_100009167 Ga0068868_1000091677 417
131 3300005355 Ga0070671_100099234 Ga0070671_1000992342 417
132 3300005367 Ga0070667_100027248 Ga0070667_1000272483 417
133 3300005434 Ga0070709_10001998 Ga0070709_1000199811 417
134 3300005436 Ga0070713_100072325 Ga0070713_1000723252 417
135 3300005439 Ga0070711_100007052 Ga0070711_1000070523 417
136 3300005439 Ga0070711_100028910 Ga0070711_1000289104 417
137 3300005444 Ga0070694_100050943 Ga0070694_1000509432 417
138 3300005518 Ga0070699_100040097 Ga0070699_1000400972 417
139 3300005545 Ga0070695_100005487 Ga0070695_1000054874 417
140 3300005545 Ga0070695_100025417 Ga0070695_1000254173 417
141 3300005546 Ga0070696_100001492 Ga0070696_1000014928 417
142 3300005548 Ga0070665_100032447 Ga0070665_1000324474 417
143 3300005563 Ga0068855_100312919 Ga0068855_1003129192 417
144 3300005614 Ga0068856_100015934 Ga0068856_1000159344 417
145 3300005842 Ga0068858_100093564 Ga0068858_1000935642 417
146 3300005843 Ga0068860_100183895 Ga0068860_1001838952 417
147 3300006163 Ga0070715_10001135 Ga0070715_100011357 417
148 3300006173 Ga0070716_100001440 Ga0070716_1000014402 417
149 3300006175 Ga0070712_100017270 Ga0070712_1000172704 417
150 3300006881 Ga0068865_100008073 Ga0068865_1000080733 417
151 3300009098 Ga0105245_10039038 Ga0105245_100390382 417
152 3300009101 Ga0105247_10004216 Ga0105247_100042165 417
153 3300009174 Ga0105241_10032331 Ga0105241_100323313 417
154 3300009176 Ga0105242_10012628 Ga0105242_100126283 417
155 3300009177 Ga0105248_10041124 Ga0105248_100411243 417
156 3300009545 Ga0105237_10021160 Ga0105237_100211603 417
157 3300010375 Ga0105239_10065682 Ga0105239_100656822 417
158 3300013297 Ga0157378_10014520 Ga0157378_100145203 417
159 3300014325 Ga0163163_10077183 Ga0163163_100771832 417
160 3300025898 Ga0207692_10034701 Ga0207692_100347012 417
161 3300025900 Ga0207710_10007501 Ga0207710_100075012 417
162 3300025905 Ga0207685_10007658 Ga0207685_100076582 417
163 3300025906 Ga0207699_10002058 Ga0207699_100020585 417
164 3300025906 Ga0207699_10012825 Ga0207699_100128252 417
165 3300025914 Ga0207671_10026639 Ga0207671_100266393 417
166 3300025915 Ga0207693_10001132 Ga0207693_100011326 417
167 3300025915 Ga0207693_10042413 Ga0207693_100424133 417
168 3300025916 Ga0207663_10054502 Ga0207663_100545022 417
169 3300025928 Ga0207700_10047704 Ga0207700_100477042 417
170 3300025931 Ga0207644_10077750 Ga0207644_100777501 417
171 3300025934 Ga0207686_10056248 Ga0207686_100562482 417
172 3300025939 Ga0207665_10001187 Ga0207665_100011875 417
173 3300025939 Ga0207665_10027790 Ga0207665_100277902 417
174 3300025941 Ga0207711_10133308 Ga0207711_101333082 417
175 3300025942 Ga0207689_10274525 Ga0207689_102745251 417
176 3300025986 Ga0207658_10043398 Ga0207658_100433982 417
177 3300026088 Ga0207641_10150434 Ga0207641_101504341 417
178 3300026121 Ga0207683_10005689 Ga0207683_100056897 417
179 3300035695 Ga0373927_0055751 Ga0373927_0055751_581_1834 417
180 3300036401 Ga0373937_0005016 Ga0373937_0005016_2794_4050 417
181 3300039437 Ga0436365_0217389 Ga0436365_0217389_1473_2726 417
182 3300039450 Ga0436363_0220896 Ga0436363_0220896_2461_3714 417
183 3300039450 Ga0436363_1499254 Ga0436363_1499254_98_1351 417
184 3300046472 Ga0495580_0051908 Ga0495580_0051908_1495_2751 417
185 3300046514 Ga0495618_0126178 Ga0495618_0126178_101_1354 417
186 3300046529 Ga0495652_0071528 Ga0495652_0071528_606_1859 417
187 3300046679 Ga0495623_0069871 Ga0495623_0069871_374_1630 417
188 3300047319 Ga0495674_0092355 Ga0495674_0092355_60_1313 417
189 3300048903 Ga0496100_0026578 Ga0496100_0026578_998_2251 417
190 3300048904 Ga0496101_0018494 Ga0496101_0018494_1059_2312 417
191 3300048907 Ga0496104_0113249 Ga0496104_0113249_1141_2394 417
192 3300048909 Ga0496106_0019886 Ga0496106_0019886_3164_4417 417
193 3300048910 Ga0496107_0027100 Ga0496107_0027100_2339_3592 417
194 3300048912 Ga0496109_0036574 Ga0496109_0036574_2779_4032 417
195 3300048913 Ga0496110_0025948 Ga0496110_0025948_3051_4304 417
196 3300048914 Ga0496111_0024777 Ga0496111_0024777_1113_2366 417
197 3300048915 Ga0496112_0020051 Ga0496112_0020051_2659_3912 417
198 3300048917 Ga0496114_0037839 Ga0496114_0037839_757_2010 417
199 iso_pu_bacteria 641228493 641334173 417
200 iso_pu_bacteria 643348555 643391806 417
201 3300005548 Ga0070665_100007777 Ga0070665_1000077779 418
202 3300025928 Ga0207700_10189937 Ga0207700_101899372 418
203 3300028379 Ga0268266_10027012 Ga0268266_100270123 418
204 3300028800 Ga0265338_10007774 Ga0265338_1000777415 418
205 3300031507 Ga0307509_10000021 Ga0307509_10000021163 418
206 3300033180 Ga0307510_10003221 Ga0307510_100032219 418
207 3300035113 Ga0373936_0016335 Ga0373936_0016335_1100_2365 418
208 3300035692 Ga0373935_0093016 Ga0373935_0093016_558_1850 418
209 3300039437 Ga0436365_0420242 Ga0436365_0420242_3740_5005 418
210 3300039450 Ga0436363_1117213 Ga0436363_1117213_70_1335 418
211 3300046474 Ga0495605_0000052 Ga0495605_0000052_54238_55518 418
212 3300046501 Ga0495607_0049887 Ga0495607_0049887_829_2109 418
213 3300046506 Ga0495583_0000747 Ga0495583_0000747_3783_5063 418
214 3300046512 Ga0495610_0044822 Ga0495610_0044822_606_1886 418
215 3300046520 Ga0495637_0000143 Ga0495637_0000143_7975_9255 418
216 3300046520 Ga0495637_0000987 Ga0495637_0000987_755_2038 418
217 3300046530 Ga0495654_0033204 Ga0495654_0033204_1077_2357 418
218 3300046533 Ga0495640_0033543 Ga0495640_0033543_105_1397 418
219 3300046538 Ga0495609_0000033 Ga0495609_0000033_165629_166903 418
220 3300046538 Ga0495609_0052375 Ga0495609_0052375_144_1424 418
221 3300046810 Ga0495660_0003407 Ga0495660_0003407_2319_3599 418
222 3300047320 Ga0495672_0001464 Ga0495672_0001464_20255_21538 418
223 3300047469 Ga0495673_0000490 Ga0495673_0000490_9127_10410 418
224 3300047469 Ga0495673_0000538 Ga0495673_0000538_32174_33454 418
225 3300047469 Ga0495673_0004403 Ga0495673_0004403_6233_7507 418
226 3300048912 Ga0496109_0155110 Ga0496109_0155110_324_1583 418
227 3300049459 Ga0495678_000382 Ga0495678_000382_35769_37049 418
228 iso_pu_bacteria 2906354277 2906355091 418
229 iso_pu_bacteria 8001845381 8001847298 418
230 3300005331 Ga0070670_100003160 Ga0070670_1000031607 419
231 3300005354 Ga0070675_100011959 Ga0070675_1000119592 419
232 3300005364 Ga0070673_100020692 Ga0070673_1000206923 419
233 3300005436 Ga0070713_100033122 Ga0070713_1000331222 419
234 3300005564 Ga0070664_100108759 Ga0070664_1001087591 419
235 3300005618 Ga0068864_100001645 Ga0068864_10000164513 419
236 3300005841 Ga0068863_100007382 Ga0068863_1000073827 419
237 3300006237 Ga0097621_100030249 Ga0097621_1000302493 419
238 3300006844 Ga0075428_100256037 Ga0075428_1002560371 419
239 3300006881 Ga0068865_100060952 Ga0068865_1000609522 419
240 3300009094 Ga0111539_10033377 Ga0111539_100333775 419
241 3300013296 Ga0157374_10018761 Ga0157374_100187612 419
242 3300013308 Ga0157375_10013243 Ga0157375_100132435 419
243 3300014325 Ga0163163_10029568 Ga0163163_100295685 419
244 3300014969 Ga0157376_10020344 Ga0157376_100203442 419
245 3300025923 Ga0207681_10016529 Ga0207681_100165291 419
246 3300025925 Ga0207650_10000953 Ga0207650_1000095312 419
247 3300025926 Ga0207659_10000823 Ga0207659_100008239 419
248 3300025940 Ga0207691_10064912 Ga0207691_100649122 419
249 3300026088 Ga0207641_10006392 Ga0207641_1000639210 419
250 3300026095 Ga0207676_10025781 Ga0207676_100257814 419
251 3300032126 Ga0307415_100158616 Ga0307415_1001586162 419
252 3300047472 Ga0495686_0087380 Ga0495686_0087380_385_1644 419
253 3300048903 Ga0496100_0066781 Ga0496100_0066781_105_1364 419
254 3300048907 Ga0496104_0024861 Ga0496104_0024861_4113_5372 419
255 3300048908 Ga0496105_0001577 Ga0496105_0001577_10165_11424 419
256 3300048917 Ga0496114_0000240 Ga0496114_0000240_6746_8005 419
257 3300048918 Ga0496115_0096832 Ga0496115_0096832_1061_2320 419
258 3300049589 Ga0501073_0044945 Ga0501073_0044945_851_2110 419
259 3300050511 nmdc:mga08y16_89105_c1 nmdc:mga08y16_89105_c1_1429_2715 419
260 3300053093 Ga0500651_0010553 Ga0500651_0010553_2015_3274 419
261 3300053098 Ga0500650_0060122 Ga0500650_0060122_254_1513 419
262 3300053103 Ga0500555_013748 Ga0500555_013748_447_1706 419
263 3300053119 Ga0500595_002223 Ga0500595_002223_5397_6656 419
264 3300053142 Ga0500577_0052403 Ga0500577_0052403_194_1453 419
265 iso_pu_bacteria 2857576091 2857577554 419
266 iso_pu_bacteria 2937822353 2937824036 419
267 3300003751 Ga0055538_1000053 Ga0055538_100005383 420
268 3300003752 Ga0055539_1000078 Ga0055539_100007883 420
269 3300003756 Ga0055533_1000084 Ga0055533_100008483 420
270 3300003759 Ga0055525_1000112 Ga0055525_100011239 420
271 3300003841 Ga0055541_1000055 Ga0055541_100005539 420
272 3300006847 Ga0075431_100103494 Ga0075431_1001034943 420
273 3300006880 Ga0075429_100038497 Ga0075429_1000384973 420
274 3300009094 Ga0111539_10069930 Ga0111539_100699303 420
275 3300025224 Ga0209784_100035 Ga0209784_10003539 420
276 3300025225 Ga0209566_100040 Ga0209566_10004039 420
277 3300025226 Ga0209674_100057 Ga0209674_10005739 420
278 3300025230 Ga0209563_100059 Ga0209563_10005939 420
279 3300025253 Ga0209677_100036 Ga0209677_10003639 420
280 3300030521 Ga0307511_10005843 Ga0307511_1000584312 420
281 3300039447 Ga0436361_0419956 Ga0436361_0419956_2591_3889 420
282 3300046453 Ga0495627_000164 Ga0495627_000164_33262_34539 420
283 3300046458 Ga0495591_000002 Ga0495591_000002_136969_138240 420
284 3300046463 Ga0495653_0000256 Ga0495653_0000256_6362_7636 420
285 3300046474 Ga0495605_0000550 Ga0495605_0000550_3943_5214 420
286 3300046507 Ga0495606_0000398 Ga0495606_0000398_42632_43906 420
287 3300046513 Ga0495616_0075390 Ga0495616_0075390_317_1591 420
288 3300046518 Ga0495631_0000582 Ga0495631_0000582_19332_20609 420
289 3300046519 Ga0495632_0022141 Ga0495632_0022141_688_1965 420
290 3300046530 Ga0495654_0000664 Ga0495654_0000664_15796_17073 420
291 3300046530 Ga0495654_0053321 Ga0495654_0053321_12_1283 420
292 3300046542 Ga0495597_0000023 Ga0495597_0000023_145163_146449 420
293 3300046810 Ga0495660_0002686 Ga0495660_0002686_422_1693 420
294 3300047320 Ga0495672_0000761 Ga0495672_0000761_33319_34596 420
295 3300049459 Ga0495678_003524 Ga0495678_003524_2422_3696 420
296 3300049571 Ga0501034_0062500 Ga0501034_0062500_1528_2805 420
297 3300049583 Ga0501067_0045437 Ga0501067_0045437_623_1888 420
298 3300049744 Ga0501083_0006155 Ga0501083_0006155_397_1662 420
299 3300050510 nmdc:mga06r32_92451_c1 nmdc:mga06r32_92451_c1_340_1632 420
300 3300050511 nmdc:mga08y16_48104_c1 nmdc:mga08y16_48104_c1_1093_2397 420
301 3300053092 Ga0500583_0075504 Ga0500583_0075504_14_1282 420
302 3300053125 Ga0500618_002254 Ga0500618_002254_1957_3219 420
303 3300053125 Ga0500618_002325 Ga0500618_002325_3906_5225 420
304 3300060353 Ga0501082_0079832 Ga0501082_0079832_1163_2428 420
305 iso_pu_bacteria 2513237305 2514420929 420
306 iso_pu_bacteria 2721755686 2723577986 420
307 iso_pu_bacteria 2882632389 2882637383 420
308 iso_pu_bacteria 2889010040 2889011073 420
309 3300031251 Ga0265327_10023792 Ga0265327_100237922 421
310 3300046501 Ga0495607_0000007 Ga0495607_0000007_28491_29801 421
311 3300046810 Ga0495660_0000088 Ga0495660_0000088_52288_53604 421
312 3300048928 Ga0496125_0000250 Ga0496125_0000250_99471_100742 421
313 3300053125 Ga0500618_000410 Ga0500618_000410_18149_19642 421
314 3300054114 Ga0501084_0091367 Ga0501084_0091367_840_2225 421
315 iso_pu_bacteria 2511231026 2511387557 421
316 iso_pu_bacteria 2874168670 2874169237 421
317 iso_pu_bacteria 2924762789 2924762811 421
318 iso_pu_bacteria 2987666974 2987669412 421
319 iso_pu_bacteria 8004640170 8004640434 421
320 3300025913 Ga0207695_10030415 Ga0207695_100304153 422
321 3300031456 Ga0307513_10012818 Ga0307513_100128182 422
322 3300039438 Ga0436360_1185384 Ga0436360_1185384_120_1406 422
323 3300047320 Ga0495672_0001928 Ga0495672_0001928_8174_9502 422
324 3300048905 Ga0496102_0248224 Ga0496102_0248224_54_1322 422
325 3300049586 Ga0501070_0147604 Ga0501070_0147604_415_1689 422
326 3300053139 Ga0500568_0000019 Ga0500568_0000019_72912_74180 422
327 iso_pu_bacteria 2765235838 2765567196 422
328 iso_pu_bacteria 2839094727 2839095136 422
329 3300003187 JGI25151J46595_10001720 JGI25151J46595_1000172012 423
330 3300005548 Ga0070665_100026088 Ga0070665_1000260886 423
331 3300005841 Ga0068863_100077765 Ga0068863_1000777653 423
332 3300005842 Ga0068858_100092117 Ga0068858_1000921171 423
333 3300009093 Ga0105240_10338988 Ga0105240_103389882 423
334 3300021361 Ga0213872_10001953 Ga0213872_100019536 423
335 3300025294 Ga0209025_1000018 Ga0209025_1000018287 423
336 3300025936 Ga0207670_10107952 Ga0207670_101079522 423
337 3300025937 Ga0207669_10193388 Ga0207669_101933881 423
338 3300026088 Ga0207641_10192140 Ga0207641_101921402 423
339 3300028379 Ga0268266_10011428 Ga0268266_100114287 423
340 3300028573 Ga0265334_10025818 Ga0265334_100258182 423
341 3300039447 Ga0436361_1048389 Ga0436361_1048389_8669_9985 423
342 3300048919 Ga0496116_0019147 Ga0496116_0019147_2550_3857 423
343 3300049572 Ga0501036_0167551 Ga0501036_0167551_473_1789 423
344 3300049578 Ga0501042_0178675 Ga0501042_0178675_58_1374 423
345 3300049592 Ga0501076_0257797 Ga0501076_0257797_100_1416 423
346 3300049741 Ga0501079_0026332 Ga0501079_0026332_2613_3929 423
347 3300053079 Ga0500610_0061587 Ga0500610_0061587_673_1944 423
348 3300061734 Ga0530510_0109419 Ga0530510_0109419_205_1521 423
349 iso_pu_bacteria 2508501125 2509128547 423
350 iso_pu_bacteria 2588253730 2588514709 423
351 iso_pu_bacteria 2693429783 2694629860 423
352 iso_pu_bacteria 2693429784 2694636267 423
353 iso_pu_bacteria 2808606415 2809132138 423
354 iso_pu_bacteria 2808606419 2809151725 423
355 iso_pu_bacteria 2852618963 2852623078 423
356 iso_pu_bacteria 2857349434 2857350703 423
357 iso_pu_bacteria 2869162929 2869164453 423
358 iso_pu_bacteria 2869169390 2869170698 423
359 iso_pu_bacteria 2869242130 2869243895 423
360 iso_pu_bacteria 2871435913 2871441585 423
361 iso_pu_bacteria 2871481445 2871481850 423
362 iso_pu_bacteria 2874116593 2874119125 423
363 iso_pu_bacteria 2876386047 2876389442 423
364 iso_pu_bacteria 2876420981 2876423117 423
365 iso_pu_bacteria 2881412998 2881415675 423
366 iso_pu_bacteria 2888350351 2888356145 423
367 iso_pu_bacteria 2889016732 2889017233 423
368 iso_pu_bacteria 2906401398 2906403307 423
369 iso_pu_bacteria 2906427513 2906432396 423
370 iso_pu_bacteria 2922130491 2922130639 423
371 iso_pu_bacteria 2922185730 2922189499 423
372 iso_pu_bacteria 2924741084 2924746977 423
373 iso_pu_bacteria 2937861824 2937867972 423
374 iso_pu_bacteria 2937980651 2937984330 423
375 iso_pu_bacteria 2938014810 2938017076 423
376 iso_pu_bacteria 2958100919 2958104484 423
377 iso_pu_bacteria 2958108152 2958110303 423
378 iso_pu_bacteria 2958172287 2958174091 423
379 iso_pu_bacteria 2961183825 2961189843 423
380 iso_pu_bacteria 2965119406 2965122033 423
381 iso_pu_bacteria 2968117919 2968121061 423
382 iso_pu_bacteria 2970532167 2970537990 423
383 iso_pu_bacteria 2970627176 2970630327 423
384 iso_pu_bacteria 2977851361 2977853744 423
385 iso_pu_bacteria 2977898635 2977904413 423
386 iso_pu_bacteria 2977942078 2977947603 423
387 iso_pu_bacteria 2977971508 2977976788 423
388 iso_pu_bacteria 2979710463 2979716097 423
389 iso_pu_bacteria 2979764755 2979770110 423
390 iso_pu_bacteria 2979772303 2979777310 423
391 iso_pu_bacteria 2987636660 2987637887 423
392 iso_pu_bacteria 2987652177 2987655284 423
393 iso_pu_bacteria 2996386984 2996388627 423
394 iso_pu_bacteria 3004203850 3004205791 423
395 iso_pu_bacteria 3004334049 3004338392 423
396 iso_pu_bacteria 8004312739 8004320029 423
397 iso_pu_bacteria 8004727605 8004730512 423
398 3300003187 JGI25151J46595_10000437 JGI25151J46595_1000043734 424
399 3300006038 Ga0075365_10074772 Ga0075365_100747722 424
400 3300025294 Ga0209025_1000027 Ga0209025_1000027153 424
401 3300026078 Ga0207702_10254884 Ga0207702_102548841 424
402 3300046453 Ga0495627_000677 Ga0495627_000677_1751_3037 424
403 3300048904 Ga0496101_0002879 Ga0496101_0002879_8588_9874 424
404 3300048905 Ga0496102_0013972 Ga0496102_0013972_1312_2598 424
405 3300048906 Ga0496103_0104277 Ga0496103_0104277_464_1750 424
406 3300048907 Ga0496104_0011750 Ga0496104_0011750_817_2103 424
407 3300048909 Ga0496106_0000376 Ga0496106_0000376_848_2134 424
408 3300048910 Ga0496107_0004183 Ga0496107_0004183_4941_6227 424
409 3300048913 Ga0496110_0037229 Ga0496110_0037229_1207_2493 424
410 3300048918 Ga0496115_0047962 Ga0496115_0047962_44_1330 424
411 iso_pu_bacteria 2855730933 2855735865 424
412 iso_pu_bacteria 2855767633 2855772803 424
413 iso_pu_bacteria 2939631187 2939635148 424
414 3300037418 Ga0395900_0197558 Ga0395900_0197558_220_1497 425
415 3300038443 Ga0395901_0053505 Ga0395901_0053505_501_1778 425
416 3300046694 Ga0495649_0107720 Ga0495649_0107720_131_1408 425
417 3300048911 Ga0496108_0076434 Ga0496108_0076434_62_1351 425
418 3300048913 Ga0496110_0099450 Ga0496110_0099450_155_1444 425
419 3300048914 Ga0496111_0038241 Ga0496111_0038241_386_1681 425
420 3300048915 Ga0496112_0150324 Ga0496112_0150324_913_2190 425
421 3300048923 Ga0496120_0018120 Ga0496120_0018120_2682_3959 425
422 3300053093 Ga0500651_0018540 Ga0500651_0018540_1715_3022 425
423 3300005445 Ga0070708_100228467 Ga0070708_1002284672 426
424 3300006177 Ga0075362_10023539 Ga0075362_100235392 426
425 3300044901 Ga0466960_0017541 Ga0466960_0017541_454_1734 426
426 3300049571 Ga0501034_0104762 Ga0501034_0104762_1360_2670 426
427 3300001979 JGI24740J21852_10007833 JGI24740J21852_100078334 427
428 3300002705 JGI25156J39149_1004459 JGI25156J39149_10044594 427
429 3300002741 JGI25157J39369_1000509 JGI25157J39369_100050912 427
430 3300003214 JGI25165J46597_1000062 JGI25165J46597_100006288 427
431 3300005339 Ga0070660_100089709 Ga0070660_1000897092 427
432 3300005356 Ga0070674_100047298 Ga0070674_1000472981 427
433 3300005456 Ga0070678_100040150 Ga0070678_1000401503 427
434 3300005543 Ga0070672_100057312 Ga0070672_1000573122 427
435 3300005548 Ga0070665_100002513 Ga0070665_10000251316 427
436 3300005616 Ga0068852_100011701 Ga0068852_1000117013 427
437 3300006038 Ga0075365_10032997 Ga0075365_100329973 427
438 3300006178 Ga0075367_10036779 Ga0075367_100367793 427
439 3300006353 Ga0075370_10035317 Ga0075370_100353172 427
440 3300006358 Ga0068871_100106656 Ga0068871_1001066562 427
441 3300010375 Ga0105239_10323399 Ga0105239_103233992 427
442 3300013104 Ga0157370_10062361 Ga0157370_100623613 427
443 3300013296 Ga0157374_10034872 Ga0157374_100348723 427
444 3300013297 Ga0157378_10093437 Ga0157378_100934372 427
445 3300013308 Ga0157375_10012922 Ga0157375_100129224 427
446 3300025250 Ga0209026_1000107 Ga0209026_100010736 427
447 3300025256 Ga0209759_1000197 Ga0209759_100019767 427
448 3300025261 Ga0209233_1000129 Ga0209233_1000129105 427
449 3300025904 Ga0207647_10061554 Ga0207647_100615542 427
450 3300025911 Ga0207654_10093187 Ga0207654_100931872 427
451 3300025919 Ga0207657_10055897 Ga0207657_100558973 427
452 3300025937 Ga0207669_10031768 Ga0207669_100317683 427
453 3300025940 Ga0207691_10022849 Ga0207691_100228495 427
454 3300026041 Ga0207639_10201559 Ga0207639_102015592 427
455 3300026121 Ga0207683_10003890 Ga0207683_100038907 427
456 3300026142 Ga0207698_10035605 Ga0207698_100356052 427
457 3300048922 Ga0496119_0068014 Ga0496119_0068014_526_1809 427
458 3300050492 nmdc:mga0yw44_2147_c1 nmdc:mga0yw44_2147_c1_2128_3411 427

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

152

491

0.93

PF04389

Peptidase_M28

Peptidase family M28

136

227

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n5f-assembly1.cif.gz_B crystal structure of l-n-carbamoylase from geobacillus stearothermophilus cect43 0.9326 10 423
3n5f-assembly1.cif.gz_B crystal structure of l-n-carbamoylase from geobacillus stearothermophilus cect43 0.9282 10 423
2imo-assembly1.cif.gz_B crystal structure of allantoate amidohydrolase from escherichia coli at ph 4.6 0.9124 10 420
2imo-assembly1.cif.gz_A crystal structure of allantoate amidohydrolase from escherichia coli at ph 4.6 0.905 10 420
1z2l-assembly1.cif.gz_B crystal structure of allantoate-amidohydrolase from e.coli k12 in complex with substrate allantoate 0.9001 10 420
ID Description Score Start End Superfamily
3n5fA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9372 10 423 3.40.630.10
3n5fA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.931 10 423 3.40.630.10
5i4mB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9146 10 419 3.40.630.10
6c0dA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8916 10 420 3.40.630.10
4pxcA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8821 4 423 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A502TFF1-F1-model_v4 Hydantoinase/carbamoylase family amidase (EC 3.5.-.-) 0.988 5 427 GO:0016813
GO:0046872
AF-A0A502TFF1-F1-model_v4 Hydantoinase/carbamoylase family amidase (EC 3.5.-.-) 0.9811 5 427 GO:0016813
GO:0046872
AF-A0A3M2TD69-F1-model_v4 Beta-alanine synthase 0.9737 30 128 GO:0016813
AF-A0A1I4ZEL7-F1-model_v4 N-carbamoyl-L-amino-acid hydrolase 0.9698 9 418 GO:0016813
GO:0046872
AF-K1KEU6-F1-model_v4 Hydantoinase/carbamoylase family amidase 0.9662 6 421 GO:0016813
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.54 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map