F448202

General Info

Members Datasets Scaffolds Average Seq Length
458 225 916 175

Family's Representative Sequence

Representative Sequence 3300025917|Ga0207660_10314148|Ga0207660_103141483
Length 220
Sequence MTDSRVGQPLFFAKSLSAAQVARLVAGIEEALDVDVVEFTGDAGGDVMRWLLWLPLALFALIIAVVMSGLIHPASTDIRSQLVGKPLPEFALPAGVPSHPPLAKADLRGGPRLINIFASWCLPCAVEAPQLMVLKRAGVVIDGIAIRDRPEDLAAFLARYGDPYSRIGSDANSRVQLALGSSGVPESFVVDGRGVIRLQHIGDIREENIPTILAAIEAAK

Samples

Sample ID Description Type Environment
1 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
85 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
167 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
174 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
177 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
178 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
181 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
182 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
189 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
190 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
209 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
217 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
218 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
219 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
220 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
221 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
222 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
223 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
224 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
225 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.24
Nodule 0
Rhizoplane 2.18
Rhizosphere 87.55
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207660_10314148 3300025917 Bacteria 1250
2 JGI24741J21665_1008122 3300001915 Bacteria 1995
3 JGI24741J21665_1009364 3300001915 Bacteria 1802
4 JGI24752J21851_1000242 3300001976 Bacteria 7530
5 JGI24740J21852_10011002 3300001979 Bacteria 3459
6 JGI24740J21852_10011194 3300001979 Bacteria 3423
7 JGI24737J22298_10002896 3300001990 Bacteria 6085
8 JGI24742J22300_10012191 3300002244 Bacteria 1431
9 JGI25153J46596_10000002 3300003215 Bacteria 653569
10 rootH1_10192496 3300003323 Bacteria 1011
11 Ga0055525_1000104 3300003759 Bacteria 134560
12 Ga0055542_1000037 3300003762 Bacteria 225640
13 Ga0055529_1000042 3300003763 Bacteria 225663
14 Ga0065704_10073578 3300005289 Bacteria 6987
15 Ga0065715_10003484 3300005293 Bacteria 5985
16 Ga0065715_10205784 3300005293 Bacteria 1338
17 Ga0070658_10000001 3300005327 Bacteria 856789
18 Ga0070658_10005620 3300005327 Bacteria 10170
19 Ga0070658_10140211 3300005327 Bacteria 2019
20 Ga0070676_10119402 3300005328 Bacteria 1653
21 Ga0070683_100053304 3300005329 Bacteria 3748
22 Ga0070683_100245806 3300005329 Bacteria 1702
23 Ga0070670_100000021 3300005331 Bacteria 202776
24 Ga0070670_100016348 3300005331 Bacteria 6372
25 Ga0070670_100024180 3300005331 Bacteria 5227
26 Ga0070677_10001614 3300005333 Bacteria 7126
27 Ga0070680_100000587 3300005336 Bacteria 25132
28 Ga0070680_100043759 3300005336 Bacteria 3637
29 Ga0070680_100091068 3300005336 Bacteria 2524
30 Ga0070660_100000441 3300005339 Bacteria 27579
31 Ga0070660_100004924 3300005339 Bacteria 9236
32 Ga0070660_100014616 3300005339 Bacteria 5662
33 Ga0070660_100159900 3300005339 Bacteria 1815
34 Ga0070661_100000028 3300005344 Bacteria 117932
35 Ga0070661_100031923 3300005344 Bacteria 3810
36 Ga0070661_100226022 3300005344 Bacteria 1437
37 Ga0070661_100414549 3300005344 Bacteria 1067
38 Ga0070692_10001382 3300005345 Bacteria 8772
39 Ga0070692_10067412 3300005345 Bacteria 1900
40 Ga0070668_100009253 3300005347 Bacteria 7306
41 Ga0070668_100010572 3300005347 Bacteria 6865
42 Ga0070669_100000937 3300005353 Bacteria 21274
43 Ga0070675_100001185 3300005354 Bacteria 18941
44 Ga0070671_100236372 3300005355 Bacteria 1551
45 Ga0070671_100307630 3300005355 Bacteria 1350
46 Ga0070671_101079424 3300005355 Bacteria 705
47 Ga0070674_100009326 3300005356 Bacteria 5874
48 Ga0070674_100009392 3300005356 Bacteria 5855
49 Ga0070674_100049058 3300005356 Bacteria 2901
50 Ga0070674_100356658 3300005356 Bacteria 1183
51 Ga0070673_100045471 3300005364 Bacteria 3405
52 Ga0070673_100204735 3300005364 Bacteria 1701
53 Ga0070688_100704503 3300005365 Bacteria 782
54 Ga0070659_100041715 3300005366 Bacteria 3588
55 Ga0070659_100042737 3300005366 Bacteria 3544
56 Ga0070659_100043718 3300005366 Bacteria 3504
57 Ga0070659_100083428 3300005366 Bacteria 2554
58 Ga0070659_100088185 3300005366 Bacteria 2484
59 Ga0070667_100000221 3300005367 Bacteria 65664
60 Ga0070667_100042504 3300005367 Bacteria 3813
61 Ga0070667_100127963 3300005367 Bacteria 2215
62 Ga0070700_100087528 3300005441 Bacteria 2025
63 Ga0070663_100007682 3300005455 Bacteria 6583
64 Ga0070663_100123227 3300005455 Bacteria 1960
65 Ga0070663_100277369 3300005455 Bacteria 1335
66 Ga0070663_100290313 3300005455 Bacteria 1306
67 Ga0070678_100005834 3300005456 Bacteria 7164
68 Ga0070678_100076643 3300005456 Bacteria 2519
69 Ga0070662_100004518 3300005457 Bacteria 8816
70 Ga0070662_100062222 3300005457 Bacteria 2726
71 Ga0070662_100087326 3300005457 Bacteria 2334
72 Ga0070662_100344075 3300005457 Bacteria 1220
73 Ga0070662_100872980 3300005457 Bacteria 767
74 Ga0070681_10033289 3300005458 Bacteria 5174
75 Ga0070681_10085836 3300005458 Bacteria 3100
76 Ga0070681_10598544 3300005458 Bacteria 1017
77 Ga0068867_100150593 3300005459 Bacteria 1827
78 Ga0070679_100000010 3300005530 Bacteria 166632
79 Ga0070679_100084102 3300005530 Bacteria 3170
80 Ga0070679_100215445 3300005530 Bacteria 1883
81 Ga0068853_100072459 3300005539 Bacteria 3002
82 Ga0068853_100174604 3300005539 Bacteria 1946
83 Ga0070672_100047162 3300005543 Bacteria 3343
84 Ga0070672_100089372 3300005543 Bacteria 2482
85 Ga0070672_100785584 3300005543 Bacteria 837
86 Ga0070665_100002410 3300005548 Bacteria 20612
87 Ga0068855_100036336 3300005563 Bacteria 5864
88 Ga0068855_100120630 3300005563 Bacteria 3001
89 Ga0068855_100317368 3300005563 Bacteria 1723
90 Ga0068855_101049947 3300005563 Bacteria 854
91 Ga0070664_100086710 3300005564 Bacteria 2705
92 Ga0070664_100166266 3300005564 Bacteria 1955
93 Ga0068854_100009240 3300005578 Bacteria 6360
94 Ga0068854_100055840 3300005578 Bacteria 2845
95 Ga0068854_100137243 3300005578 Bacteria 1873
96 Ga0068854_100208171 3300005578 Bacteria 1541
97 Ga0068854_101164493 3300005578 Bacteria 689
98 Ga0068856_101021232 3300005614 Bacteria 845
99 Ga0068852_100293930 3300005616 Bacteria 1570
100 Ga0068852_100879884 3300005616 Unclassified 912
101 Ga0068859_100013822 3300005617 Bacteria 8095
102 Ga0068859_100314660 3300005617 Bacteria 1659
103 Ga0068864_100000004 3300005618 Bacteria 489341
104 Ga0068864_100090561 3300005618 Bacteria 2697
105 Ga0068864_100111865 3300005618 Bacteria 2433
106 Ga0068864_100394580 3300005618 Bacteria 1314
107 Ga0068861_100317448 3300005719 Bacteria 1356
108 Ga0068851_10032579 3300005834 Bacteria 2593
109 Ga0068863_100000002 3300005841 Bacteria 489510
110 Ga0068862_100000002 3300005844 Bacteria 489341
111 Ga0068862_100358717 3300005844 Bacteria 1354
112 Ga0068862_100364278 3300005844 Bacteria 1344
113 Ga0068862_100465937 3300005844 Bacteria 1193
114 Ga0068862_100873135 3300005844 Bacteria 883
115 Ga0075366_10284255 3300006195 Bacteria 1011
116 Ga0097621_100107713 3300006237 Bacteria 2352
117 Ga0075430_101024091 3300006846 Bacteria 680
118 Ga0068865_100012798 3300006881 Bacteria 5289
119 Ga0068865_100203858 3300006881 Bacteria 1537
120 Ga0097620_100013822 3300006931 Bacteria 8095
121 Ga0097620_100314679 3300006931 Bacteria 1659
122 Ga0105251_10002504 3300009011 Bacteria 14365
123 Ga0105240_10000433 3300009093 Bacteria 77418
124 Ga0105240_10168812 3300009093 Bacteria 2593
125 Ga0105240_10638380 3300009093 Bacteria 1168
126 Ga0111539_10024750 3300009094 Bacteria 7362
127 Ga0111539_12217497 3300009094 Bacteria 637
128 Ga0105247_10106507 3300009101 Bacteria 1799
129 Ga0105243_10000082 3300009148 Bacteria 108252
130 Ga0105241_10049342 3300009174 Bacteria 3205
131 Ga0105242_10670270 3300009176 Bacteria 1011
132 Ga0105248_10000010 3300009177 Bacteria 344314
133 Ga0105248_10039462 3300009177 Bacteria 5288
134 Ga0105248_10099642 3300009177 Bacteria 3274
135 Ga0105237_10199980 3300009545 Bacteria 1998
136 Ga0105237_10437664 3300009545 Bacteria 1313
137 Ga0105238_10257043 3300009551 Bacteria 1726
138 Ga0105238_10557265 3300009551 Bacteria 1151
139 Ga0105249_10000122 3300009553 Bacteria 105623
140 Ga0105249_10113449 3300009553 Bacteria 2564
141 Ga0105239_10000279 3300010375 Bacteria 75291
142 Ga0105239_10908777 3300010375 Bacteria 1011
143 Ga0157373_10187693 3300013100 Bacteria 1456
144 Ga0157371_10000183 3300013102 Bacteria 92426
145 Ga0157369_10069615 3300013105 Bacteria 3780
146 Ga0157369_10072097 3300013105 Bacteria 3707
147 Ga0157374_12395875 3300013296 Bacteria 555
148 Ga0163162_10047626 3300013306 Bacteria 4296
149 Ga0163162_10208264 3300013306 Bacteria 2085
150 Ga0157375_10620561 3300013308 Bacteria 1239
151 Ga0163163_10305346 3300014325 Bacteria 1644
152 Ga0157380_10004293 3300014326 Bacteria 9874
153 Ga0157380_10111187 3300014326 Bacteria 2303
154 Ga0157380_10407059 3300014326 Bacteria 1293
155 Ga0182008_10247646 3300014497 Bacteria 918
156 Ga0157379_10025566 3300014968 Bacteria 5246
157 Ga0157376_10604446 3300014969 Bacteria 1092
158 Ga0163161_10044597 3300017792 Bacteria 3194
159 Ga0213876_10000766 3300021384 Bacteria 22166
160 Ga0209563_100116 3300025230 Bacteria 134661
161 Ga0209026_1013842 3300025250 Bacteria 1362
162 Ga0209677_108619 3300025253 Bacteria 1946
163 Ga0209148_1000026 3300025254 Bacteria 629213
164 Ga0209233_1021259 3300025261 Bacteria 1684
165 Ga0209455_1000005 3300025272 Bacteria 1416756
166 Ga0209455_1012760 3300025272 Bacteria 1990
167 Ga0209758_1000001 3300025297 Bacteria 1981790
168 Ga0209758_1132548 3300025297 Bacteria 657
169 Ga0207697_10001553 3300025315 Bacteria 12409
170 Ga0207656_10023174 3300025321 Bacteria 2497
171 Ga0207713_1003344 3300025735 Bacteria 11010
172 Ga0207682_10003978 3300025893 Bacteria 6292
173 Ga0207710_10056697 3300025900 Bacteria 1768
174 Ga0207688_10026842 3300025901 Bacteria 3168
175 Ga0207688_10053916 3300025901 Bacteria 2255
176 Ga0207647_10055333 3300025904 Bacteria 2439
177 Ga0207645_10012515 3300025907 Bacteria 5754
178 Ga0207705_10000002 3300025909 Bacteria 2046852
179 Ga0207705_10000397 3300025909 Bacteria 38200
180 Ga0207705_10001479 3300025909 Bacteria 18709
181 Ga0207707_10046798 3300025912 Bacteria 3768
182 Ga0207707_10114770 3300025912 Bacteria 2354
183 Ga0207707_10530690 3300025912 Bacteria 1001
184 Ga0207695_10000285 3300025913 Bacteria 125917
185 Ga0207695_10134056 3300025913 Bacteria 2432
186 Ga0207695_10180319 3300025913 Bacteria 2033
187 Ga0207671_10007571 3300025914 Bacteria 9404
188 Ga0207671_10092953 3300025914 Bacteria 2275
189 Ga0207671_10183874 3300025914 Bacteria 1628
190 Ga0207660_10002232 3300025917 Bacteria 12807
191 Ga0207660_10040817 3300025917 Bacteria 3250
192 Ga0207657_10001100 3300025919 Bacteria 28711
193 Ga0207657_10006640 3300025919 Bacteria 11974
194 Ga0207657_10044420 3300025919 Bacteria 3906
195 Ga0207657_10088426 3300025919 Bacteria 2589
196 Ga0207657_10096262 3300025919 Bacteria 2462
197 Ga0207657_10510332 3300025919 Bacteria 941
198 Ga0207649_10000079 3300025920 Bacteria 82899
199 Ga0207649_10000472 3300025920 Bacteria 28723
200 Ga0207649_10009506 3300025920 Bacteria 5321
201 Ga0207649_10467794 3300025920 Bacteria 954
202 Ga0207652_10000005 3300025921 Bacteria 343384
203 Ga0207652_10000006 3300025921 Bacteria 302991
204 Ga0207652_10000007 3300025921 Bacteria 301303
205 Ga0207652_10000009 3300025921 Bacteria 257234
206 Ga0207652_10001258 3300025921 Bacteria 22543
207 Ga0207694_10024798 3300025924 Bacteria 4555
208 Ga0207694_10091803 3300025924 Bacteria 2396
209 Ga0207650_10000298 3300025925 Bacteria 49421
210 Ga0207650_10003435 3300025925 Bacteria 10893
211 Ga0207650_10087462 3300025925 Bacteria 2374
212 Ga0207659_10803635 3300025926 Bacteria 808
213 Ga0207644_10227013 3300025931 Bacteria 1482
214 Ga0207644_10300102 3300025931 Bacteria 1294
215 Ga0207644_10726109 3300025931 Bacteria 829
216 Ga0207690_10001240 3300025932 Bacteria 16125
217 Ga0207690_10001443 3300025932 Bacteria 14876
218 Ga0207690_10061560 3300025932 Bacteria 2552
219 Ga0207690_10101896 3300025932 Bacteria 2052
220 Ga0207690_10190197 3300025932 Bacteria 1552
221 Ga0207690_10826154 3300025932 Bacteria 766
222 Ga0207706_10001405 3300025933 Bacteria 24086
223 Ga0207706_10005272 3300025933 Bacteria 12055
224 Ga0207706_10015511 3300025933 Bacteria 6885
225 Ga0207706_10282040 3300025933 Bacteria 1449
226 Ga0207709_10000507 3300025935 Bacteria 34401
227 Ga0207669_10000061 3300025937 Bacteria 54347
228 Ga0207669_10002470 3300025937 Bacteria 7884
229 Ga0207669_10105603 3300025937 Bacteria 1874
230 Ga0207669_10404579 3300025937 Bacteria 1070
231 Ga0207669_10428830 3300025937 Bacteria 1043
232 Ga0207704_10050188 3300025938 Bacteria 2515
233 Ga0207704_10166657 3300025938 Bacteria 1575
234 Ga0207691_10000696 3300025940 Bacteria 33255
235 Ga0207691_10126278 3300025940 Bacteria 2263
236 Ga0207711_10000038 3300025941 Bacteria 163520
237 Ga0207711_10319726 3300025941 Bacteria 1434
238 Ga0207661_11223701 3300025944 Bacteria 691
239 Ga0207679_10324477 3300025945 Bacteria 1334
240 Ga0207667_10000107 3300025949 Bacteria 133066
241 Ga0207667_10094958 3300025949 Bacteria 3078
242 Ga0207667_10112727 3300025949 Bacteria 2804
243 Ga0207651_10050555 3300025960 Bacteria 2823
244 Ga0207651_10117002 3300025960 Bacteria 2013
245 Ga0207712_10001466 3300025961 Bacteria 16096
246 Ga0207712_10114943 3300025961 Bacteria 2025
247 Ga0207668_10109474 3300025972 Bacteria 2069
248 Ga0207668_10142997 3300025972 Bacteria 1842
249 Ga0207668_10268042 3300025972 Bacteria 1395
250 Ga0207640_10003657 3300025981 Bacteria 8295
251 Ga0207640_10038215 3300025981 Bacteria 3027
252 Ga0207640_10096212 3300025981 Bacteria 2064
253 Ga0207640_10105808 3300025981 Bacteria 1983
254 Ga0207658_10000256 3300025986 Bacteria 55417
255 Ga0207658_10031887 3300025986 Bacteria 3747
256 Ga0207658_10247214 3300025986 Bacteria 1514
257 Ga0207639_10000692 3300026041 Bacteria 23191
258 Ga0207639_10137066 3300026041 Bacteria 2034
259 Ga0207639_10145473 3300026041 Bacteria 1980
260 Ga0207678_10001575 3300026067 Bacteria 20968
261 Ga0207678_10002472 3300026067 Bacteria 16788
262 Ga0207678_10086333 3300026067 Bacteria 2682
263 Ga0207708_10048265 3300026075 Bacteria 3241
264 Ga0207702_10007468 3300026078 Bacteria 9323
265 Ga0207702_10572967 3300026078 Bacteria 1106
266 Ga0207641_10000002 3300026088 Bacteria 981004
267 Ga0207648_10039503 3300026089 Bacteria 4149
268 Ga0207648_10295073 3300026089 Bacteria 1452
269 Ga0207676_10000005 3300026095 Bacteria 698744
270 Ga0207676_10144400 3300026095 Bacteria 2042
271 Ga0207676_10200499 3300026095 Bacteria 1763
272 Ga0207674_10266143 3300026116 Bacteria 1662
273 Ga0207675_100387570 3300026118 Bacteria 1375
274 Ga0207683_10015483 3300026121 Bacteria 6495
275 Ga0207683_10173269 3300026121 Bacteria 1955
276 Ga0207698_10193764 3300026142 Bacteria 1813
277 Ga0207698_10615747 3300026142 Bacteria 1072
278 Ga0268266_10000002 3300028379 Bacteria 3059047
279 Ga0268266_10013502 3300028379 Bacteria 7031
280 Ga0268265_10000003 3300028380 Bacteria 949201
281 Ga0268265_10266783 3300028380 Bacteria 1525
282 Ga0268265_10335060 3300028380 Bacteria 1375
283 Ga0268264_10025669 3300028381 Bacteria 4813
284 Ga0307517_10027451 3300028786 Bacteria 6838
285 Ga0316182_1064081 3300030745 Bacteria 2674
286 Ga0307513_10008724 3300031456 Bacteria 12912
287 Ga0307408_100023121 3300031548 Bacteria 4231
288 Ga0307408_100139021 3300031548 Bacteria 1904
289 Ga0307408_100152759 3300031548 Bacteria 1824
290 Ga0307408_100595169 3300031548 Bacteria 982
291 Ga0307408_100772636 3300031548 Bacteria 870
292 Ga0307408_101607055 3300031548 Bacteria 617
293 Ga0307405_10294867 3300031731 Bacteria 1227
294 Ga0307405_10370888 3300031731 Bacteria 1111
295 Ga0307413_10000223 3300031824 Bacteria 16635
296 Ga0307413_10092926 3300031824 Bacteria 1970
297 Ga0307413_10133015 3300031824 Bacteria 1705
298 Ga0307413_10165558 3300031824 Bacteria 1559
299 Ga0307413_10174893 3300031824 Bacteria 1524
300 Ga0307413_10354637 3300031824 Bacteria 1133
301 Ga0307413_10919256 3300031824 Bacteria 744
302 Ga0307410_10047077 3300031852 Bacteria 2880
303 Ga0307410_10075530 3300031852 Bacteria 2349
304 Ga0307410_10154911 3300031852 Bacteria 1710
305 Ga0307410_10156601 3300031852 Bacteria 1702
306 Ga0307410_10194099 3300031852 Bacteria 1546
307 Ga0307406_10149734 3300031901 Bacteria 1663
308 Ga0307406_10180566 3300031901 Bacteria 1536
309 Ga0307406_10313916 3300031901 Bacteria 1210
310 Ga0307406_10384608 3300031901 Bacteria 1107
311 Ga0307407_10041510 3300031903 Bacteria 2573
312 Ga0307407_10056086 3300031903 Bacteria 2279
313 Ga0307407_10100801 3300031903 Bacteria 1792
314 Ga0307407_10335651 3300031903 Bacteria 1065
315 Ga0307407_10624909 3300031903 Bacteria 804
316 Ga0307412_10037457 3300031911 Bacteria 3116
317 Ga0307412_10095777 3300031911 Bacteria 2087
318 Ga0307412_10114454 3300031911 Bacteria 1931
319 Ga0307412_10149968 3300031911 Bacteria 1719
320 Ga0307412_10154007 3300031911 Bacteria 1699
321 Ga0307412_10418891 3300031911 Bacteria 1095
322 Ga0307412_10890768 3300031911 Bacteria 779
323 Ga0307412_11169767 3300031911 Bacteria 687
324 Ga0307409_100030576 3300031995 Bacteria 3871
325 Ga0307409_100087812 3300031995 Bacteria 2536
326 Ga0307409_100179127 3300031995 Bacteria 1874
327 Ga0307409_100741281 3300031995 Bacteria 985
328 Ga0307409_100762465 3300031995 Bacteria 972
329 Ga0307409_100763600 3300031995 Bacteria 971
330 Ga0307409_100992263 3300031995 Bacteria 857
331 Ga0307416_100041477 3300032002 Bacteria 3585
332 Ga0307416_100145275 3300032002 Bacteria 2164
333 Ga0307414_10054730 3300032004 Bacteria 2790
334 Ga0307414_10101496 3300032004 Bacteria 2166
335 Ga0307414_10138424 3300032004 Bacteria 1902
336 Ga0307414_10191815 3300032004 Bacteria 1654
337 Ga0307414_10202474 3300032004 Bacteria 1616
338 Ga0307414_10209628 3300032004 Bacteria 1591
339 Ga0307414_10239016 3300032004 Bacteria 1502
340 Ga0307414_10285225 3300032004 Bacteria 1389
341 Ga0307414_10376913 3300032004 Bacteria 1225
342 Ga0307414_10473527 3300032004 Bacteria 1103
343 Ga0307414_10827845 3300032004 Bacteria 845
344 Ga0307414_11322659 3300032004 Bacteria 669
345 Ga0307411_10002034 3300032005 Bacteria 8674
346 Ga0307411_10026369 3300032005 Bacteria 3499
347 Ga0307411_10033317 3300032005 Bacteria 3194
348 Ga0307411_10082645 3300032005 Bacteria 2216
349 Ga0307411_10207172 3300032005 Bacteria 1511
350 Ga0307411_10433780 3300032005 Bacteria 1095
351 Ga0307411_10534446 3300032005 Bacteria 997
352 Ga0307411_10655816 3300032005 Bacteria 909
353 Ga0307411_11015152 3300032005 Bacteria 743
354 Ga0307415_100188951 3300032126 Bacteria 1624
355 Ga0307415_100189070 3300032126 Bacteria 1623
356 Ga0307415_100238820 3300032126 Bacteria 1468
357 Ga0307415_100507566 3300032126 Bacteria 1055
358 Ga0307415_100785662 3300032126 Bacteria 867
359 Ga0307415_101251112 3300032126 Bacteria 701
360 Ga0395899_0000916 3300037312 Bacteria 27731
361 Ga0395899_0060887 3300037312 Bacteria 2781
362 Ga0395900_0001285 3300037418 Bacteria 30628
363 Ga0395898_0001920 3300037466 Bacteria 26462
364 Ga0395905_0001547 3300037471 Bacteria 27515
365 Ga0395901_0000671 3300038443 Bacteria 39338
366 Ga0436365_1596642 3300039437 Bacteria 39428
367 Ga0439435_0165461 3300042436 Bacteria 716
368 Ga0466966_0000027 3300044684 Bacteria 106520
369 Ga0466959_0149686 3300045049 Bacteria 1646
370 Ga0495638_0129332 3300046460 Bacteria 1485
371 Ga0495650_0000461 3300046471 Bacteria 63382
372 Ga0495584_0051595 3300046491 Bacteria 2071
373 Ga0495585_0058227 3300046492 Bacteria 2131
374 Ga0495596_0006245 3300046500 Bacteria 5514
375 Ga0495583_0001174 3300046506 Bacteria 28270
376 Ga0495583_0007203 3300046506 Bacteria 7057
377 Ga0495583_0016431 3300046506 Bacteria 3978
378 Ga0495606_0003980 3300046507 Bacteria 15126
379 Ga0495606_0029846 3300046507 Bacteria 3821
380 Ga0495606_0188956 3300046507 Bacteria 1182
381 Ga0495610_0211225 3300046512 Bacteria 789
382 Ga0495616_0231304 3300046513 Bacteria 801
383 Ga0495631_0066205 3300046518 Bacteria 1563
384 Ga0495632_0230633 3300046519 Bacteria 835
385 Ga0495637_0041615 3300046520 Bacteria 1970
386 Ga0495643_0006051 3300046522 Bacteria 8060
387 Ga0495643_0006635 3300046522 Bacteria 7600
388 Ga0495643_0035015 3300046522 Bacteria 2766
389 Ga0495643_0066814 3300046522 Bacteria 1895
390 Ga0495648_0000111 3300046524 Bacteria 100648
391 Ga0495663_0000530 3300046525 Bacteria 13684
392 Ga0495663_0115838 3300046525 Bacteria 894
393 Ga0495642_0004819 3300046528 Bacteria 5214
394 Ga0495598_0003391 3300046537 Bacteria 3382
395 Ga0495598_0041201 3300046537 Bacteria 1350
396 Ga0495609_0045108 3300046538 Bacteria 1976
397 Ga0495621_0003234 3300046539 Bacteria 4477
398 Ga0495622_0023138 3300046557 Bacteria 2896
399 Ga0495633_0035401 3300046558 Bacteria 2397
400 Ga0495668_0000325 3300046616 Bacteria 65404
401 Ga0495611_0036929 3300046648 Bacteria 2170
402 Ga0495611_0069142 3300046648 Bacteria 1613
403 Ga0495625_0000221 3300046660 Bacteria 90175
404 Ga0495625_0065990 3300046660 Bacteria 2550
405 Ga0495669_0000159 3300046684 Bacteria 43128
406 Ga0495670_0022564 3300046691 Bacteria 3108
407 Ga0495670_0048982 3300046691 Bacteria 2113
408 Ga0495671_0160406 3300046692 Bacteria 1094
409 Ga0495660_0047010 3300046810 Bacteria 2365
410 Ga0495683_0004709 3300047323 Bacteria 7671
411 Ga0495683_0058042 3300047323 Bacteria 1923
412 Ga0495687_000089 3300047443 Bacteria 141448
413 Ga0495687_001092 3300047443 Bacteria 26544
414 Ga0495677_0011904 3300047445 Bacteria 3175
415 Ga0495677_0023183 3300047445 Bacteria 2253
416 Ga0495681_0005617 3300047470 Bacteria 8363
417 Ga0495681_0088038 3300047470 Bacteria 1376
418 Ga0496101_0071614 3300048904 Bacteria 2542
419 Ga0496102_0000067 3300048905 Bacteria 156790
420 Ga0496102_0746163 3300048905 Bacteria 902
421 Ga0496103_0000222 3300048906 Bacteria 56372
422 Ga0496103_0228213 3300048906 Bacteria 1197
423 Ga0496104_0003479 3300048907 Bacteria 13583
424 Ga0496105_0000662 3300048908 Bacteria 23132
425 Ga0496110_0012321 3300048913 Bacteria 7029
426 Ga0496114_0007367 3300048917 Bacteria 8693
427 Ga0496115_0000056 3300048918 Bacteria 104434
428 Ga0496116_0039774 3300048919 Bacteria 3246
429 Ga0496117_0000114 3300048920 Bacteria 180658
430 Ga0496117_0010075 3300048920 Bacteria 8679
431 Ga0496118_0000082 3300048921 Bacteria 185820
432 Ga0496118_0000327 3300048921 Bacteria 82033
433 Ga0496118_0142492 3300048921 Bacteria 1516
434 Ga0496119_0004578 3300048922 Bacteria 13669
435 Ga0496120_0040137 3300048923 Bacteria 2753
436 Ga0496121_0000344 3300048924 Bacteria 96865
437 Ga0496121_0014959 3300048924 Bacteria 8173
438 Ga0496121_0039648 3300048924 Bacteria 4145
439 Ga0496122_0018243 3300048925 Bacteria 6497
440 Ga0496123_0033485 3300048926 Bacteria 3697
441 Ga0496124_0000068 3300048927 Bacteria 221819
442 Ga0496125_0002303 3300048928 Bacteria 25208
443 Ga0496126_0000157 3300048929 Bacteria 156203
444 Ga0496126_0020862 3300048929 Bacteria 6414
445 nmdc:mga0k408_593036_c1 3300050493 Bacteria 654
446 nmdc:mga06r32_10173_c1 3300050510 Bacteria 8491
447 nmdc:mga08y16_1441416_c1 3300050511 Bacteria 651
448 Ga0500610_0000206 3300053079 Bacteria 18104
449 Ga0500643_045054 3300053087 Bacteria 1279
450 Ga0500583_0211290 3300053092 Bacteria 963
451 Ga0500595_000935 3300053119 Bacteria 16547
452 Ga0500642_0000817 3300053130 Bacteria 9122
453 Ga0500619_023512 3300053154 Bacteria 1802
454 Ga0500636_0007450 3300053177 Bacteria 6336
455 Ga0500645_000585 3300053730 Bacteria 23518
456 Ga0500645_002731 3300053730 Bacteria 7658
457 Ga0500596_000088 3300053735 Bacteria 12460
458 8057105703 8057101203 Bacteria 5034064
459 Ga0207660_10314148
460 JGI24741J21665_1008122
461 JGI24741J21665_1009364
462 JGI24752J21851_1000242
463 JGI24740J21852_10011002
464 JGI24740J21852_10011194
465 JGI24737J22298_10002896
466 JGI24742J22300_10012191
467 JGI25153J46596_10000002
468 rootH1_10192496
469 Ga0055525_1000104
470 Ga0055542_1000037
471 Ga0055529_1000042
472 Ga0065704_10073578
473 Ga0065715_10003484
474 Ga0065715_10205784
475 Ga0070658_10000001
476 Ga0070658_10005620
477 Ga0070658_10140211
478 Ga0070676_10119402
479 Ga0070683_100053304
480 Ga0070683_100245806
481 Ga0070670_100000021
482 Ga0070670_100016348
483 Ga0070670_100024180
484 Ga0070677_10001614
485 Ga0070680_100000587
486 Ga0070680_100043759
487 Ga0070680_100091068
488 Ga0070660_100000441
489 Ga0070660_100004924
490 Ga0070660_100014616
491 Ga0070660_100159900
492 Ga0070661_100000028
493 Ga0070661_100031923
494 Ga0070661_100226022
495 Ga0070661_100414549
496 Ga0070692_10001382
497 Ga0070692_10067412
498 Ga0070668_100009253
499 Ga0070668_100010572
500 Ga0070669_100000937
501 Ga0070675_100001185
502 Ga0070671_100236372
503 Ga0070671_100307630
504 Ga0070671_101079424
505 Ga0070674_100009326
506 Ga0070674_100009392
507 Ga0070674_100049058
508 Ga0070674_100356658
509 Ga0070673_100045471
510 Ga0070673_100204735
511 Ga0070688_100704503
512 Ga0070659_100041715
513 Ga0070659_100042737
514 Ga0070659_100043718
515 Ga0070659_100083428
516 Ga0070659_100088185
517 Ga0070667_100000221
518 Ga0070667_100042504
519 Ga0070667_100127963
520 Ga0070700_100087528
521 Ga0070663_100007682
522 Ga0070663_100123227
523 Ga0070663_100277369
524 Ga0070663_100290313
525 Ga0070678_100005834
526 Ga0070678_100076643
527 Ga0070662_100004518
528 Ga0070662_100062222
529 Ga0070662_100087326
530 Ga0070662_100344075
531 Ga0070662_100872980
532 Ga0070681_10033289
533 Ga0070681_10085836
534 Ga0070681_10598544
535 Ga0068867_100150593
536 Ga0070679_100000010
537 Ga0070679_100084102
538 Ga0070679_100215445
539 Ga0068853_100072459
540 Ga0068853_100174604
541 Ga0070672_100047162
542 Ga0070672_100089372
543 Ga0070672_100785584
544 Ga0070665_100002410
545 Ga0068855_100036336
546 Ga0068855_100120630
547 Ga0068855_100317368
548 Ga0068855_101049947
549 Ga0070664_100086710
550 Ga0070664_100166266
551 Ga0068854_100009240
552 Ga0068854_100055840
553 Ga0068854_100137243
554 Ga0068854_100208171
555 Ga0068854_101164493
556 Ga0068856_101021232
557 Ga0068852_100293930
558 Ga0068852_100879884
559 Ga0068859_100013822
560 Ga0068859_100314660
561 Ga0068864_100000004
562 Ga0068864_100090561
563 Ga0068864_100111865
564 Ga0068864_100394580
565 Ga0068861_100317448
566 Ga0068851_10032579
567 Ga0068863_100000002
568 Ga0068862_100000002
569 Ga0068862_100358717
570 Ga0068862_100364278
571 Ga0068862_100465937
572 Ga0068862_100873135
573 Ga0075366_10284255
574 Ga0097621_100107713
575 Ga0075430_101024091
576 Ga0068865_100012798
577 Ga0068865_100203858
578 Ga0097620_100013822
579 Ga0097620_100314679
580 Ga0105251_10002504
581 Ga0105240_10000433
582 Ga0105240_10168812
583 Ga0105240_10638380
584 Ga0111539_10024750
585 Ga0111539_12217497
586 Ga0105247_10106507
587 Ga0105243_10000082
588 Ga0105241_10049342
589 Ga0105242_10670270
590 Ga0105248_10000010
591 Ga0105248_10039462
592 Ga0105248_10099642
593 Ga0105237_10199980
594 Ga0105237_10437664
595 Ga0105238_10257043
596 Ga0105238_10557265
597 Ga0105249_10000122
598 Ga0105249_10113449
599 Ga0105239_10000279
600 Ga0105239_10908777
601 Ga0157373_10187693
602 Ga0157371_10000183
603 Ga0157369_10069615
604 Ga0157369_10072097
605 Ga0157374_12395875
606 Ga0163162_10047626
607 Ga0163162_10208264
608 Ga0157375_10620561
609 Ga0163163_10305346
610 Ga0157380_10004293
611 Ga0157380_10111187
612 Ga0157380_10407059
613 Ga0182008_10247646
614 Ga0157379_10025566
615 Ga0157376_10604446
616 Ga0163161_10044597
617 Ga0213876_10000766
618 Ga0209563_100116
619 Ga0209026_1013842
620 Ga0209677_108619
621 Ga0209148_1000026
622 Ga0209233_1021259
623 Ga0209455_1000005
624 Ga0209455_1012760
625 Ga0209758_1000001
626 Ga0209758_1132548
627 Ga0207697_10001553
628 Ga0207656_10023174
629 Ga0207713_1003344
630 Ga0207682_10003978
631 Ga0207710_10056697
632 Ga0207688_10026842
633 Ga0207688_10053916
634 Ga0207647_10055333
635 Ga0207645_10012515
636 Ga0207705_10000002
637 Ga0207705_10000397
638 Ga0207705_10001479
639 Ga0207707_10046798
640 Ga0207707_10114770
641 Ga0207707_10530690
642 Ga0207695_10000285
643 Ga0207695_10134056
644 Ga0207695_10180319
645 Ga0207671_10007571
646 Ga0207671_10092953
647 Ga0207671_10183874
648 Ga0207660_10002232
649 Ga0207660_10040817
650 Ga0207657_10001100
651 Ga0207657_10006640
652 Ga0207657_10044420
653 Ga0207657_10088426
654 Ga0207657_10096262
655 Ga0207657_10510332
656 Ga0207649_10000079
657 Ga0207649_10000472
658 Ga0207649_10009506
659 Ga0207649_10467794
660 Ga0207652_10000005
661 Ga0207652_10000006
662 Ga0207652_10000007
663 Ga0207652_10000009
664 Ga0207652_10001258
665 Ga0207694_10024798
666 Ga0207694_10091803
667 Ga0207650_10000298
668 Ga0207650_10003435
669 Ga0207650_10087462
670 Ga0207659_10803635
671 Ga0207644_10227013
672 Ga0207644_10300102
673 Ga0207644_10726109
674 Ga0207690_10001240
675 Ga0207690_10001443
676 Ga0207690_10061560
677 Ga0207690_10101896
678 Ga0207690_10190197
679 Ga0207690_10826154
680 Ga0207706_10001405
681 Ga0207706_10005272
682 Ga0207706_10015511
683 Ga0207706_10282040
684 Ga0207709_10000507
685 Ga0207669_10000061
686 Ga0207669_10002470
687 Ga0207669_10105603
688 Ga0207669_10404579
689 Ga0207669_10428830
690 Ga0207704_10050188
691 Ga0207704_10166657
692 Ga0207691_10000696
693 Ga0207691_10126278
694 Ga0207711_10000038
695 Ga0207711_10319726
696 Ga0207661_11223701
697 Ga0207679_10324477
698 Ga0207667_10000107
699 Ga0207667_10094958
700 Ga0207667_10112727
701 Ga0207651_10050555
702 Ga0207651_10117002
703 Ga0207712_10001466
704 Ga0207712_10114943
705 Ga0207668_10109474
706 Ga0207668_10142997
707 Ga0207668_10268042
708 Ga0207640_10003657
709 Ga0207640_10038215
710 Ga0207640_10096212
711 Ga0207640_10105808
712 Ga0207658_10000256
713 Ga0207658_10031887
714 Ga0207658_10247214
715 Ga0207639_10000692
716 Ga0207639_10137066
717 Ga0207639_10145473
718 Ga0207678_10001575
719 Ga0207678_10002472
720 Ga0207678_10086333
721 Ga0207708_10048265
722 Ga0207702_10007468
723 Ga0207702_10572967
724 Ga0207641_10000002
725 Ga0207648_10039503
726 Ga0207648_10295073
727 Ga0207676_10000005
728 Ga0207676_10144400
729 Ga0207676_10200499
730 Ga0207674_10266143
731 Ga0207675_100387570
732 Ga0207683_10015483
733 Ga0207683_10173269
734 Ga0207698_10193764
735 Ga0207698_10615747
736 Ga0268266_10000002
737 Ga0268266_10013502
738 Ga0268265_10000003
739 Ga0268265_10266783
740 Ga0268265_10335060
741 Ga0268264_10025669
742 Ga0307517_10027451
743 Ga0316182_1064081
744 Ga0307513_10008724
745 Ga0307408_100023121
746 Ga0307408_100139021
747 Ga0307408_100152759
748 Ga0307408_100595169
749 Ga0307408_100772636
750 Ga0307408_101607055
751 Ga0307405_10294867
752 Ga0307405_10370888
753 Ga0307413_10000223
754 Ga0307413_10092926
755 Ga0307413_10133015
756 Ga0307413_10165558
757 Ga0307413_10174893
758 Ga0307413_10354637
759 Ga0307413_10919256
760 Ga0307410_10047077
761 Ga0307410_10075530
762 Ga0307410_10154911
763 Ga0307410_10156601
764 Ga0307410_10194099
765 Ga0307406_10149734
766 Ga0307406_10180566
767 Ga0307406_10313916
768 Ga0307406_10384608
769 Ga0307407_10041510
770 Ga0307407_10056086
771 Ga0307407_10100801
772 Ga0307407_10335651
773 Ga0307407_10624909
774 Ga0307412_10037457
775 Ga0307412_10095777
776 Ga0307412_10114454
777 Ga0307412_10149968
778 Ga0307412_10154007
779 Ga0307412_10418891
780 Ga0307412_10890768
781 Ga0307412_11169767
782 Ga0307409_100030576
783 Ga0307409_100087812
784 Ga0307409_100179127
785 Ga0307409_100741281
786 Ga0307409_100762465
787 Ga0307409_100763600
788 Ga0307409_100992263
789 Ga0307416_100041477
790 Ga0307416_100145275
791 Ga0307414_10054730
792 Ga0307414_10101496
793 Ga0307414_10138424
794 Ga0307414_10191815
795 Ga0307414_10202474
796 Ga0307414_10209628
797 Ga0307414_10239016
798 Ga0307414_10285225
799 Ga0307414_10376913
800 Ga0307414_10473527
801 Ga0307414_10827845
802 Ga0307414_11322659
803 Ga0307411_10002034
804 Ga0307411_10026369
805 Ga0307411_10033317
806 Ga0307411_10082645
807 Ga0307411_10207172
808 Ga0307411_10433780
809 Ga0307411_10534446
810 Ga0307411_10655816
811 Ga0307411_11015152
812 Ga0307415_100188951
813 Ga0307415_100189070
814 Ga0307415_100238820
815 Ga0307415_100507566
816 Ga0307415_100785662
817 Ga0307415_101251112
818 Ga0395899_0000916
819 Ga0395899_0060887
820 Ga0395900_0001285
821 Ga0395898_0001920
822 Ga0395905_0001547
823 Ga0395901_0000671
824 Ga0436365_1596642
825 Ga0439435_0165461
826 Ga0466966_0000027
827 Ga0466959_0149686
828 Ga0495638_0129332
829 Ga0495650_0000461
830 Ga0495584_0051595
831 Ga0495585_0058227
832 Ga0495596_0006245
833 Ga0495583_0001174
834 Ga0495583_0007203
835 Ga0495583_0016431
836 Ga0495606_0003980
837 Ga0495606_0029846
838 Ga0495606_0188956
839 Ga0495610_0211225
840 Ga0495616_0231304
841 Ga0495631_0066205
842 Ga0495632_0230633
843 Ga0495637_0041615
844 Ga0495643_0006051
845 Ga0495643_0006635
846 Ga0495643_0035015
847 Ga0495643_0066814
848 Ga0495648_0000111
849 Ga0495663_0000530
850 Ga0495663_0115838
851 Ga0495642_0004819
852 Ga0495598_0003391
853 Ga0495598_0041201
854 Ga0495609_0045108
855 Ga0495621_0003234
856 Ga0495622_0023138
857 Ga0495633_0035401
858 Ga0495668_0000325
859 Ga0495611_0036929
860 Ga0495611_0069142
861 Ga0495625_0000221
862 Ga0495625_0065990
863 Ga0495669_0000159
864 Ga0495670_0022564
865 Ga0495670_0048982
866 Ga0495671_0160406
867 Ga0495660_0047010
868 Ga0495683_0004709
869 Ga0495683_0058042
870 Ga0495687_000089
871 Ga0495687_001092
872 Ga0495677_0011904
873 Ga0495677_0023183
874 Ga0495681_0005617
875 Ga0495681_0088038
876 Ga0496101_0071614
877 Ga0496102_0000067
878 Ga0496102_0746163
879 Ga0496103_0000222
880 Ga0496103_0228213
881 Ga0496104_0003479
882 Ga0496105_0000662
883 Ga0496110_0012321
884 Ga0496114_0007367
885 Ga0496115_0000056
886 Ga0496116_0039774
887 Ga0496117_0000114
888 Ga0496117_0010075
889 Ga0496118_0000082
890 Ga0496118_0000327
891 Ga0496118_0142492
892 Ga0496119_0004578
893 Ga0496120_0040137
894 Ga0496121_0000344
895 Ga0496121_0014959
896 Ga0496121_0039648
897 Ga0496122_0018243
898 Ga0496123_0033485
899 Ga0496124_0000068
900 Ga0496125_0002303
901 Ga0496126_0000157
902 Ga0496126_0020862
903 nmdc:mga0k408_593036_c1
904 nmdc:mga06r32_10173_c1
905 nmdc:mga08y16_1441416_c1
906 Ga0500610_0000206
907 Ga0500643_045054
908 Ga0500583_0211290
909 Ga0500595_000935
910 Ga0500642_0000817
911 Ga0500619_023512
912 Ga0500636_0007450
913 Ga0500645_000585
914 Ga0500645_002731
915 Ga0500596_000088
916 8057105703

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

83

199

0.91

PF08534

Redoxin

Redoxin

82

216

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kng-assembly1.cif.gz_A crystal structure of ccmg reducing oxidoreductase at 1.14 a 0.9329 39 175
2g0f-assembly1.cif.gz_A crystal structure of p144a mutant of e.coli ccmg protein 0.9134 32 174
2b1k-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9085 32 174
3kh9-assembly1.cif.gz_A crystal structure of the periplasmic soluble domain of oxidized ccmg from pseudomonas aeruginosa 0.8956 34 174
3k8n-assembly1.cif.gz_A crystal structure of e. coli ccmg 0.8837 27 174
ID Description Score Start End Superfamily
1kngA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9329 39 175 3.40.30.10
2b1kA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9085 32 174 3.40.30.10
1kngA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8836 39 175 3.40.30.10
3iosA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8702 43 171 3.40.30.10
2b1kA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8683 32 174 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A520JFX6-F1-model_v4 DsbE family thiol:disulfide interchange protein 0.9789 70 175 GO:0016491
GO:0017004
AF-A0A2W4YS53-F1-model_v4 deleted 0.9783 41 175
AF-A0A7Y1T832-F1-model_v4 deleted 0.9771 7 175
AF-A0A2W4YS53-F1-model_v4 deleted 0.9712 41 175
AF-F1ZCJ6-F1-model_v4 Periplasmic protein thiol 0.9671 2 174 GO:0015036
GO:0016020
GO:0017004
GO:0030288

Map